254780860

254780860

NADH dehydrogenase subunit H

GeneID in NCBI database:8209875Locus tag:CLIBASIA_03775
Protein GI in NCBI database:254780860Protein Accession:YP_003065273.1
Gene range:+(829669, 830715)Protein Length:348aa
Gene description:NADH dehydrogenase subunit H
COG prediction:[C] NADH:ubiquinone oxidoreductase subunit 1 (chain H)
KEGG prediction:nuoH; NADH dehydrogenase subunit H (EC:1.6.99.5); K00337 NADH dehydrogenase I subunit H [EC:1.6.5.3]
SEED prediction:NADH-ubiquinone oxidoreductase chain H (EC 1.6.5.3)
Pathway involved in KEGG:Oxidative phosphorylation [PATH:las00190]
Subsystem involved in SEED:Respiratory Complex I
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM8 TM-Helix
TOPPRED8 TM-Helix
HMMTOP8 TM-Helix
MEMSAT8 TM-Helix
MEMSAT_SVM7 TM-Helix
PHOBIUS9 TM-Helix
SignalP_HMMno
SignalP_NNyes
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------35
MSSFIEDFFVPLFFMAIKSIVFLVGLLIFIAYVLLMDRKVWAAVQLRRGPNVVGPWGLLQSFADFLKFVFKEPIIPSKSNKILFLLAPLVSVILSLSAWAVVPVADGWIIADINVGILYILAISSLEIYGIIIGGWASNSKYAFLGALRSAAQMISYEVSIGLVIVTVVLCAGSLNLTDIVYSQKSGLGTFLGFPPSMLDWYWLALFPMFVVFFISLLAETNRPPFDLSEAESELVAGYMVEYSSTPYLLFMLAEYSTIVLMCTLASILFLGGWLPPFDISLFKSIPGFFWLVFKTLGLFFMVAMVKAFVPRYRYDQLMRLGWKVFLPLSFAMVLIVSFFLKIYTLIR
ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHc
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccEEccccccccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHccccccccccHHHHccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccccHEEEEEEEEccccccEcccHHHHcccccccccccHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccccccccEcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcc
MSSFIEDFFVPLFFMAIKSIVFLVGLLIFIAYVLLMDRKVWAAVQlrrgpnvvgpwglLQSFADFLKFvfkepiipsksnkiLFLLAPLVSVILSLSAwavvpvadgwiiadINVGILYILAISSLEIYGIIIggwasnskYAFLGALRSAAQMISYEVSIGLVIVTVVLCAGSLNLTDIVYSqksglgtflgfppsmlDWYWLALFPMFVVFFISLLaetnrppfdlseAESELVAGYMVEYSSTPYLLFMLAEYSTIVLMCTLASILFlggwlppfdislfksIPGFFWLVFKTLGLFFMVAMVKAFVPRYRYDQLMRLGWKVFLPLSFAMVLIVSFFLKIYTLIR
MSSFIEDFFVPLFFMAIKSIVFLVGLLIFIAYVLLMDRKVWAAVQLRRGPNVVGPWGLLQSFADFLKFVFKEPIIPSKSNKILFLLAPLVSVILSLSAWAVVPVADGWIIADINVGILYILAISSLEIYGIIIGGWASNSKYAFLGALRSAAQMISYEVSIGLVIVTVVLCAGSLNLTDIVYSQKSGLGTFLGFPPSMLDWYWLALFPMFVVFFISLLAETNRPPFDLSEAESELVAGYMVEYSSTPYLLFMLAEYSTIVLMCTLASILFLGGWLPPFDISLFKSIPGFFWLVFKTLGLFFMVAMVKAFVPRYRYDQLMRLGWKVFLPLSFAMVLIVSFFLKIYTLIR
MSSFIEDFFVPLFFMAIKSIVFLVGLLIFIAYVLLMDRKVWAAVQLRRGPNVVGPWGLLQSFADFLKFVFKEPIIPSKSNKILFLLAPLVSVILSLSAWAVVPVADGWIIADINVGILYILAISSLEIYGIIIGGWASNSKYAFLGALRSAAQMISYEVSIGLVIVTVVLCAGSLNLTDIVYSQKSGLGTFLGFPPSMLDWYWLALFPMFVVFFISLLAETNRPPFDLSEAESELVAGYMVEYSSTPYLLFMLAEYSTIVLMCTLASILFLGGWLPPFDISLFKSIPGFFWLVFKTLGLFFMVAMVKAFVPRYRYDQLMRLGWKVFLPLSFAMVLIVSFFLKIYTLIR
*SSFIEDFFVPLFFMAIKSIVFLVGLLIFIAYVLLMDRKVWAAVQLRRGPNVVGPWGLLQSFADFLKFVFKEPIIPSKSNKILFLLAPLVSVILSLSAWAVVPVADGWIIADINVGILYILAISSLEIYGIIIGGWASNSKYAFLGALRSAAQMISYEVSIGLVIVTVVLCAGSLNLTDIVYSQKSGLGTFLGFPPSMLDWYWLALFPMFVVFFISLLAETNRPPFDLSEAESELVAGYMVEYSSTPYLLFMLAEYSTIVLMCTLASILFLGGWLPPFDISLFKSIPGFFWLVFKTLGLFFMVAMVKAFVPRYRYDQLMRLGWKVFLPLSFAMVLIVSFFLKIYTLIR
MSSFIEDFFVPLFFMAIKSIVFLVGLLIFIAYVLLMDRKVWAAVQLRRGPNVVGPWGLLQSFADFLKFVFKEPIIPSKSNKILFLLAPLVSVILSLSAWAVVPVADGWIIADINVGILYILAISSLEIYGIIIGGWASNSKYAFLGALRSAAQMISYEVSIGLVIVTVVLCAGSLNLTDIVYSQKSGLGTFLGFPPSMLDWYWLALFPMFVVFFISLLAETNRPPFDLSEAESELVAGYMVEYSSTPYLLFMLAEYSTIVLMCTLASILFLGGWLPPFDISLFKSIPGFFWLVFKTLGLFFMVAMVKAFVPRYRYDQLMRLGWKVFLPLSFAMVLIVSFFLKIYTLIR
*SSFIEDFFVPLFFMAIKSIVFLVGLLIFIAYVLLMDRKVWAAVQLRRGPNVVGPWGLLQSFADFLKFVFKEPIIPSKSNKILFLLAPLVSVILSLSAWAVVPVADGWIIADINVGILYILAISSLEIYGIIIGGWASNSKYAFLGALRSAAQMISYEVSIGLVIVTVVLCAGSLNLTDIVYSQKSGLGTFLGFPPSMLDWYWLALFPMFVVFFISLLAETNRPPFDLSEAESELVAGYMVEYSSTPYLLFMLAEYSTIVLMCTLASILFLGGWLPPFDISLFKSIPGFFWLVFKTLGLFFMVAMVKAFVPRYRYDQLMRLGWKVFLPLSFAMVLIVSFFLKIYTLIR
ooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHo
xxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxx
oooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHo
ooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooo
iiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MSSFIEDFFVPLFFMAIKSIVFLVGLLIFIAYVLLMDRKVWAAVQLRRGPNVVGPWGLLQSFADFLKFVFKEPIIPSKSNKILFLLAPLVSVILSLSAWAVVPVADGWIIADINVGILYILAISSLEIYGIIIGGWASNSKYAFLGALRSAAQMISYEVSIGLVIVTVVLCAGSLNLTDIVYSQKSGLGTFLGFPPSMLDWYWLALFPMFVVFFISLLAETNRPPFDLSEAESELVAGYMVEYSSTPYLLFMLAEYSTIVLMCTLASILFLGGWLPPFDISLFKSIPGFFWLVFKTLGLFFMVAMVKAFVPRYRYDQLMRLGWKVFLPLSFAMVLIVSFFLKIYTLIR
MSSFIEDFFVPLFFMAIKSIVFLVGLLIFIAYVLLMDRKVWAAVQLRRGPNVVGPWGLLQSFADFLKFVFKEPIIPSKSNKILFLLAPLVSVILSLSAWAVVPVADGWIIADINVGILYILAISSLEIYGIIIGGWASNSKYAFLGALRSAAQMISYEVSIGLVIVTVVLCAGSLNLTDIVYSQKSGLGTFLGFPPSMLDWYWLALFPMFVVFFISLLAETNRPPFDLSEAESELVAGYMVEYSSTPYLLFMLAEYSTIVLMCTLASILFLGGWLPPFDISLFKSIPGFFWLVFKTLGLFFMVAMVKAFVPRYRYDQLMRLGWKVFLPLSFAMVLIVSFFLKIYTLIR
MSSFIEDFFVPLFFMAIKSIVFLVGLLIFIAYVLLMDRKVWAAVQLRRGPNVVGPWGLLQSFADFLKFVFKEPIIPSKSNKILFLLAPLVSVILSLSAWAVVPVADGWIIADINVGILYILAISSLEIYGIIIGGWASNSKYAFLGALRSAAQMISYEVSIGLVIVTVVLCAGSLNLTDIVYSQKSGLGTFLGFPPSMLDWYWLALFPMFVVFFISLLAETNRPPFDLSEAESELVAGYMVEYSSTPYLLFMLAEYSTIVLMCTLASILFLGGWLPPFDISLFKSIPGFFWLVFKTLGLFFMVAMVKAFVPRYRYDQLMRLGWKVFLPLSFAMVLIVSFFLKIYTLIR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target348 NADH dehydrogenase subunit H [Candidatus Liberibacter a
315122718345 NADH dehydrogenase subunit H [Candidatus Liberibacter s 1 1e-176
222085584347 NADH-ubiquinone oxidoreductase chain H protein [Agrobac 1 1e-142
190891294347 NADH-ubiquinone oxidoreductase, chain H [Rhizobium etli 1 1e-141
209548871347 NADH dehydrogenase subunit H [Rhizobium leguminosarum b 1 1e-141
86357246347 NADH dehydrogenase subunit H [Rhizobium etli CFN 42] Le 1 1e-141
327188495347 NADH-ubiquinone oxidoreductase protein, chain H [Rhizob 1 1e-141
260462238347 NADH dehydrogenase (quinone) [Mesorhizobium opportunist 1 1e-140
222148282347 NADH dehydrogenase subunit H [Agrobacterium vitis S4] L 1 1e-140
116251474347 NADH dehydrogenase subunit H [Rhizobium leguminosarum b 1 1e-140
241204095347 NADH dehydrogenase subunit H [Rhizobium leguminosarum b 1 1e-140
>gi|315122718|ref|YP_004063207.1| NADH dehydrogenase subunit H [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 345 Back     alignment and organism information
 Score =  620 bits (1599), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 309/343 (90%), Positives = 331/343 (96%)

Query: 1   MSSFIEDFFVPLFFMAIKSIVFLVGLLIFIAYVLLMDRKVWAAVQLRRGPNVVGPWGLLQ 60
           M SF+ +FFVPLFFM IKSIVFLVG+LIF+AY+LLMDRK+WAAVQLRRGPNVVGPWGL Q
Sbjct: 1   MFSFLGEFFVPLFFMIIKSIVFLVGVLIFVAYILLMDRKIWAAVQLRRGPNVVGPWGLFQ 60

Query: 61  SFADFLKFVFKEPIIPSKSNKILFLLAPLVSVILSLSAWAVVPVADGWIIADINVGILYI 120
           SFADFLKFVFKEPIIP+KSNK LFLLAPL+S ILSLSAWAVVPVADGW+IADINVGILYI
Sbjct: 61  SFADFLKFVFKEPIIPAKSNKFLFLLAPLISAILSLSAWAVVPVADGWVIADINVGILYI 120

Query: 121 LAISSLEIYGIIIGGWASNSKYAFLGALRSAAQMISYEVSIGLVIVTVVLCAGSLNLTDI 180
           LAISSLE+YGIIIGGWASNSKYAFLGALRSAAQMISYEVSIGLVIVTV+LCAGSLNLTDI
Sbjct: 121 LAISSLEVYGIIIGGWASNSKYAFLGALRSAAQMISYEVSIGLVIVTVLLCAGSLNLTDI 180

Query: 181 VYSQKSGLGTFLGFPPSMLDWYWLALFPMFVVFFISLLAETNRPPFDLSEAESELVAGYM 240
           V +QKSG+GT LGFPPS+LDWYWLALFPMFV+FFISLLAETNRPPFDLSEAESELVAGYM
Sbjct: 181 VNAQKSGIGTILGFPPSILDWYWLALFPMFVIFFISLLAETNRPPFDLSEAESELVAGYM 240

Query: 241 VEYSSTPYLLFMLAEYSTIVLMCTLASILFLGGWLPPFDISLFKSIPGFFWLVFKTLGLF 300
           VEYSSTPYLLFMLAEYSTIVLMC L SILFLGGWLPP DI++F+ +PGFFWLVFKTLG+F
Sbjct: 241 VEYSSTPYLLFMLAEYSTIVLMCVLTSILFLGGWLPPVDIAVFRYVPGFFWLVFKTLGVF 300

Query: 301 FMVAMVKAFVPRYRYDQLMRLGWKVFLPLSFAMVLIVSFFLKI 343
           FMV+MVKAFVPRYRYDQLMRLGWKVFLPLSF+MVLIVSFFLKI
Sbjct: 301 FMVSMVKAFVPRYRYDQLMRLGWKVFLPLSFSMVLIVSFFLKI 343


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085584|ref|YP_002544114.1| NADH-ubiquinone oxidoreductase chain H protein [Agrobacterium radiobacter K84] Length = 347 Back     alignment and organism information
>gi|190891294|ref|YP_001977836.1| NADH-ubiquinone oxidoreductase, chain H [Rhizobium etli CIAT 652] Length = 347 Back     alignment and organism information
>gi|209548871|ref|YP_002280788.1| NADH dehydrogenase subunit H [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 347 Back     alignment and organism information
>gi|86357246|ref|YP_469138.1| NADH dehydrogenase subunit H [Rhizobium etli CFN 42] Length = 347 Back     alignment and organism information
>gi|327188495|gb|EGE55709.1| NADH-ubiquinone oxidoreductase protein, chain H [Rhizobium etli CNPAF512] Length = 347 Back     alignment and organism information
>gi|260462238|ref|ZP_05810482.1| NADH dehydrogenase (quinone) [Mesorhizobium opportunistum WSM2075] Length = 347 Back     alignment and organism information
>gi|222148282|ref|YP_002549239.1| NADH dehydrogenase subunit H [Agrobacterium vitis S4] Length = 347 Back     alignment and organism information
>gi|116251474|ref|YP_767312.1| NADH dehydrogenase subunit H [Rhizobium leguminosarum bv. viciae 3841] Length = 347 Back     alignment and organism information
>gi|241204095|ref|YP_002975191.1| NADH dehydrogenase subunit H [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 347 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target348 NADH dehydrogenase subunit H [Candidatus Liberibacter a
PRK06076322 PRK06076, PRK06076, NADH:ubiquinone oxidoreductase subu 1e-119
COG1005332 COG1005, NuoH, NADH:ubiquinone oxidoreductase subunit 1 6e-92
MTH00054324 MTH00054, ND1, NADH dehydrogenase subunit 1; Provisiona 4e-87
MTH00216327 MTH00216, ND1, NADH dehydrogenase subunit 1; Provisiona 3e-86
MTH00111323 MTH00111, ND1, NADH dehydrogenase subunit 1; Provisiona 4e-75
MTH00071322 MTH00071, ND1, NADH dehydrogenase subunit 1; Provisiona 6e-75
MTH00134324 MTH00134, ND1, NADH dehydrogenase subunit 1; Provisiona 9e-75
MTH00040323 MTH00040, ND1, NADH dehydrogenase subunit 1; Validated 7e-74
MTH00029343 MTH00029, ND1, NADH dehydrogenase subunit 1; Provisiona 3e-73
MTH00218311 MTH00218, ND1, NADH dehydrogenase subunit 1; Provisiona 8e-73
MTH00104318 MTH00104, ND1, NADH dehydrogenase subunit 1; Provisiona 2e-70
KOG4770315 KOG4770, KOG4770, KOG4770, NADH dehydrogenase subunit 1 7e-69
MTH00143307 MTH00143, ND1, NADH dehydrogenase subunit 1; Provisiona 8e-69
MTH00225305 MTH00225, ND1, NADH dehydrogenase subunit 1; Provisiona 9e-66
MTH00193306 MTH00193, ND1, NADH dehydrogenase subunit 1; Provisiona 6e-65
MTH00195307 MTH00195, ND1, NADH dehydrogenase subunit 1; Provisiona 7e-62
MTH00010311 MTH00010, ND1, NADH dehydrogenase subunit 1; Validated 2e-56
CHL00032363 CHL00032, ndhA, NADH dehydrogenase subunit 1 6e-55
MTH00090284 MTH00090, ND1, NADH dehydrogenase subunit 1; Provisiona 4e-37
MTH00058293 MTH00058, ND1, NADH dehydrogenase subunit 1; Provisiona 1e-36
COG0650309 COG0650, HyfC, Formate hydrogenlyase subunit 4 [Energy 1e-22
pfam00146309 pfam00146, NADHdh, NADH dehydrogenase 9e-99
>gnl|CDD|180386 PRK06076, PRK06076, NADH:ubiquinone oxidoreductase subunit H; Provisional Back     alignment and domain information
>gnl|CDD|31209 COG1005, NuoH, NADH:ubiquinone oxidoreductase subunit 1 (chain H) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|177127 MTH00054, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|164761 MTH00216, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|177173 MTH00111, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|177143 MTH00071, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|177192 MTH00134, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|177115 MTH00040, ND1, NADH dehydrogenase subunit 1; Validated Back     alignment and domain information
>gnl|CDD|177108 MTH00029, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|177258 MTH00218, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|177166 MTH00104, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|39967 KOG4770, KOG4770, KOG4770, NADH dehydrogenase subunit 1 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|177201 MTH00143, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|177261 MTH00225, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|177241 MTH00193, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|177242 MTH00195, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|164586 MTH00010, ND1, NADH dehydrogenase subunit 1; Validated Back     alignment and domain information
>gnl|CDD|176973 CHL00032, ndhA, NADH dehydrogenase subunit 1 Back     alignment and domain information
>gnl|CDD|177153 MTH00090, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|177130 MTH00058, ND1, NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>gnl|CDD|30995 COG0650, HyfC, Formate hydrogenlyase subunit 4 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|109212 pfam00146, NADHdh, NADH dehydrogenase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 348 NADH dehydrogenase subunit H [Candidatus Liberibacter a
CHL00032359 ndhA NADH dehydrogenase subunit 1 100.0
COG1005332 NuoH NADH:ubiquinone oxidoreductase subunit 1 (chain H) 100.0
MTH00029343 ND1 NADH dehydrogenase subunit 1; Provisional 100.0
MTH00216327 ND1 NADH dehydrogenase subunit 1; Provisional 100.0
PRK06076335 NADH dehydrogenase subunit H; Provisional 100.0
MTH00017327 consensus 100.0
MTH00054321 ND1 NADH dehydrogenase subunit 1; Provisional 100.0
MTH00040323 ND1 NADH dehydrogenase subunit 1; Validated 100.0
MTH00111323 ND1 NADH dehydrogenase subunit 1; Provisional 100.0
MTH00071322 ND1 NADH dehydrogenase subunit 1; Provisional 100.0
MTH00104318 ND1 NADH dehydrogenase subunit 1; Provisional 100.0
MTH00134324 ND1 NADH dehydrogenase subunit 1; Provisional 100.0
pfam00146309 NADHdh NADH dehydrogenase. 100.0
MTH00218314 ND1 NADH dehydrogenase subunit 1; Provisional 100.0
MTH00143306 ND1 NADH dehydrogenase subunit 1; Provisional 100.0
MTH00193306 ND1 NADH dehydrogenase subunit 1; Provisional 100.0
MTH00010311 ND1 NADH dehydrogenase subunit 1; Validated 100.0
MTH00195307 ND1 NADH dehydrogenase subunit 1; Provisional 100.0
MTH00159307 consensus 100.0
MTH00058296 ND1 NADH dehydrogenase subunit 1; Provisional 100.0
KOG4770315 consensus 100.0
MTH00090285 ND1 NADH dehydrogenase subunit 1; Provisional 100.0
COG0650309 HyfC Formate hydrogenlyase subunit 4 [Energy production 100.0
TIGR01972 532 NDH_I_M proton-translocating NADH-quinone oxidoreductas 93.44
>CHL00032 ndhA NADH dehydrogenase subunit 1 Back     alignment and domain information
>COG1005 NuoH NADH:ubiquinone oxidoreductase subunit 1 (chain H) [Energy production and conversion] Back     alignment and domain information
>MTH00029 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>MTH00216 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>PRK06076 NADH dehydrogenase subunit H; Provisional Back     alignment and domain information
>MTH00017 consensus Back     alignment and domain information
>MTH00054 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>MTH00040 ND1 NADH dehydrogenase subunit 1; Validated Back     alignment and domain information
>MTH00111 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>MTH00071 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>MTH00104 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>MTH00134 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>pfam00146 NADHdh NADH dehydrogenase Back     alignment and domain information
>MTH00218 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>MTH00143 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>MTH00193 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>MTH00010 ND1 NADH dehydrogenase subunit 1; Validated Back     alignment and domain information
>MTH00195 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>MTH00159 consensus Back     alignment and domain information
>MTH00058 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>KOG4770 consensus Back     alignment and domain information
>MTH00090 ND1 NADH dehydrogenase subunit 1; Provisional Back     alignment and domain information
>COG0650 HyfC Formate hydrogenlyase subunit 4 [Energy production and conversion] Back     alignment and domain information
>TIGR01972 NDH_I_M proton-translocating NADH-quinone oxidoreductase, chain M; InterPro: IPR010227 This entry describes the 13th (based on Escherichia coli) structural gene, M, of bacterial NADH dehydrogenase I, as well as chain 4 of the corresponding mitochondrial complex I and of the chloroplast NAD(P)H dehydrogenase complex Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00