254780861

254780861

NADH dehydrogenase subunit I

GeneID in NCBI database:8209876Locus tag:CLIBASIA_03780
Protein GI in NCBI database:254780861Protein Accession:YP_003065274.1
Gene range:+(830726, 831217)Protein Length:163aa
Gene description:NADH dehydrogenase subunit I
COG prediction:none
KEGG prediction:nuoI; NADH dehydrogenase subunit I (EC:1.6.99.5); K00338 NADH dehydrogenase I subunit I [EC:1.6.5.3]
SEED prediction:NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)
Pathway involved in KEGG:Oxidative phosphorylation [PATH:las00190]
Subsystem involved in SEED:Respiratory Complex I
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160---
MRIFRCNVSFLFLKEFVGAFFLCLRYFFKAKTTINYPFEKGSTSPRFRGEHALRRYPNGEERCIACKLCEAICPAQAITIESGPRCHDGTRRTVRYDIDMIKCIYCGLCQEACPVDAIVEGPNFEFATETRQELYYDKERLLNNGDRWESEIVRNIVTDSPYR
cHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHccccccHHHHcccccEEEccccccccccccccEEEEEHHHccccccHHHHcccccEEcccHHHccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHcccccccccccccccccHHHcccccEEEHcccccccccccEEccEEcccccccccHHHHHcccccEEEccccccccccHHHHHHcHHHHHHccccHHHHHHHHHHHccccc
mrifrcnvSFLFLKEFVGAFFLCLRYFFkakttinypfekgstsprfrgehalrrypngeercIACKLCeaicpaqaitiesgprchdgtrrtvrydidMIKCIycglcqeacpvdaivegpnfefaTETRQELYYDKerllnngdrweSEIVRNIVTDSPYR
MRIFRCNVSFLFLKEFVGAFFLCLRYFFKAKttinypfekgstsprfrgeHALRRYPNGEERCIACKLCEAICPAQaitiesgprchdgtrRTVRYDIDMIKCIYCGLCQEACPVDAIVEGPNFEFATETRQELYYDKErllnngdrweseivrnivtdspyr
MRIFRCNVSFLFLKEFVGAFFLCLRYFFKAKTTINYPFEKGSTSPRFRGEHALRRYPNGEERCIACKLCEAICPAQAITIESGPRCHDGTRRTVRYDIDMIKCIYCGLCQEACPVDAIVEGPNFEFATETRQELYYDKERLLNNGDRWESEIVRNIVTDSPYR
******NVSFLFLKEFVGAFFLCLRYFFKAKTTINYPFEKGSTSPRFRGEHALRRYPNGEERCIACKLCEAICPAQAITIESGP****GTRRTVRYDIDMIKCIYCGLCQEACPVDAIVEGPNFEFATETRQELYYDKERLLNNGDRWESEIVR*********
MRIFRCNVSFLFLKEFVGAFFLCLRYFFKAKTTINYPFEKGSTSPRFRGEHALRRYPNGEERCIACKLCEAICPAQAITIESGPRCHDGTRRTVRYDIDMIKCIYCGLCQEACPVDAIVEGPNFEFATETRQELYYDKERLLNNGDRWESEIVRNIVTDSPYR
MRIFRCNVSFLFLKEFVGAFFLCLRYFFKAKTTINYPFEKGSTSPRFRGEHALRRYPNGEERCIACKLCEAICPAQAITIESGPRCHDGTRRTVRYDIDMIKCIYCGLCQEACPVDAIVEGPNFEFATETRQELYYDKERLLNNGDRWESEIVRNIVTDSP*R
iiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRIFRCNVSFLFLKEFVGAFFLCLRYFFKAKTTINYPFEKGSTSPRFRGEHALRRYPNGEERCIACKLCEAICPAQAITIESGPRCHDGTRRTVRYDIDMIKCIYCGLCQEACPVDAIVEGPNFEFATETRQELYYDKERLLNNGDRWESEIVRNIVTDSPYR
MRIFRCNVSFLFLKEFVGAFFLCLRYFFKAKTTINYPFEKGSTSPRFRGEHALRRYPNGEERCIACKLCEAICPAQAITIESGPRCHDGTRRTVRYDIDMIKCIYCGLCQEACPVDAIVEGPNFEFATETRQELYYDKERLLNNGDRWESEIVRNIVTDSPYR
MRIFRCNVSFLFLKEFVGAFFLCLRYFFKAKTTINYPFEKGSTSPRFRGEHALRRYPNGEERCIACKLCEAICPAQAITIESGPRCHDGTRRTVRYDIDMIKCIYCGLCQEACPVDAIVEGPNFEFATETRQELYYDKERLLNNGDRWESEIVRNIVTDSPYR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target163 NADH dehydrogenase subunit I [Candidatus Liberibacter a
254780416113 putative ferredoxin protein [Candidatus Liberibact 0.031
254780416113 putative ferredoxin protein [Candidatus Liberibact 0.032
>gi|254780416|ref|YP_003064829.1| putative ferredoxin protein [Candidatus Liberibacter asiaticus str. psy62] Length = 113 Back     alignment
 Score = 29.6 bits (65), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 13/60 (21%)

Query: 61  ERCIACKL--CEAICPAQAITIESGPRCHDGTRRTVRYDIDMIKCIYCGLCQEACPVDAI 118
           E CI CK   C  +CP            ++G        I   +CI CG+C+  CPVDAI
Sbjct: 7   ENCILCKHTDCVEVCPVDCF--------YEGENFLA---IHPDECIDCGVCEPECPVDAI 55

>gi|254780416|ref|YP_003064829.1| putative ferredoxin protein [Candidatus Liberibacter asiaticus str. psy62] Length = 113 Back     alignment
 Score = 29.6 bits (65), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 3/38 (7%)

Query: 47 FRGEHALRRYPNGEERCIACKLCEAICPAQAITIESGP 84
          + GE+ L  +P+    CI C +CE  CP  AI  ++ P
Sbjct: 27 YEGENFLAIHPD---ECIDCGVCEPECPVDAIKPDTEP 61

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target163 NADH dehydrogenase subunit I [Candidatus Liberibacter a
315122717159 NADH dehydrogenase subunit I [Candidatus Liberibacter s 1 3e-83
227821627163 NADH dehydrogenase subunit I [Sinorhizobium fredii NGR2 1 4e-76
222085585165 NADH-ubiquinone oxidoreductase chain I protein [Agrobac 1 5e-76
116251475163 NADH dehydrogenase subunit I [Rhizobium leguminosarum b 1 8e-76
163759532162 NADH dehydrogenase subunit I [Hoeflea phototrophica DFL 1 2e-75
15965027164 NADH dehydrogenase subunit I [Sinorhizobium meliloti 10 1 3e-75
307301099163 NADH-quinone oxidoreductase, chain I [Sinorhizobium mel 1 3e-75
86357247163 NADH dehydrogenase subunit I [Rhizobium etli CFN 42] Le 1 6e-75
150396121163 NADH dehydrogenase subunit I [Sinorhizobium medicae WSM 1 1e-74
15888607163 NADH dehydrogenase subunit I [Agrobacterium tumefaciens 1 1e-74
>gi|315122717|ref|YP_004063206.1| NADH dehydrogenase subunit I [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 159 Back     alignment and organism information
 Score =  311 bits (796), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 148/158 (93%), Positives = 153/158 (96%)

Query: 6   CNVSFLFLKEFVGAFFLCLRYFFKAKTTINYPFEKGSTSPRFRGEHALRRYPNGEERCIA 65
           CNVSFLFLKEFV +FFLC+RYFFKAK TINYPFEKGS SPRFRGEHALRRYPNGEERCIA
Sbjct: 2   CNVSFLFLKEFVLSFFLCMRYFFKAKATINYPFEKGSVSPRFRGEHALRRYPNGEERCIA 61

Query: 66  CKLCEAICPAQAITIESGPRCHDGTRRTVRYDIDMIKCIYCGLCQEACPVDAIVEGPNFE 125
           CKLCEA+CPAQAITIESGPR HDGTRRTVRYDIDMIKCIYCGLCQEACPVDAIVEGPNFE
Sbjct: 62  CKLCEAVCPAQAITIESGPRLHDGTRRTVRYDIDMIKCIYCGLCQEACPVDAIVEGPNFE 121

Query: 126 FATETRQELYYDKERLLNNGDRWESEIVRNIVTDSPYR 163
           FATETR+ELYYDKERLL+NGDRWESEIVRNIV DSPYR
Sbjct: 122 FATETRKELYYDKERLLDNGDRWESEIVRNIVIDSPYR 159


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227821627|ref|YP_002825597.1| NADH dehydrogenase subunit I [Sinorhizobium fredii NGR234] Length = 163 Back     alignment and organism information
>gi|222085585|ref|YP_002544115.1| NADH-ubiquinone oxidoreductase chain I protein [Agrobacterium radiobacter K84] Length = 165 Back     alignment and organism information
>gi|116251475|ref|YP_767313.1| NADH dehydrogenase subunit I [Rhizobium leguminosarum bv. viciae 3841] Length = 163 Back     alignment and organism information
>gi|163759532|ref|ZP_02166617.1| NADH dehydrogenase subunit I [Hoeflea phototrophica DFL-43] Length = 162 Back     alignment and organism information
>gi|15965027|ref|NP_385380.1| NADH dehydrogenase subunit I [Sinorhizobium meliloti 1021] Length = 164 Back     alignment and organism information
>gi|307301099|ref|ZP_07580868.1| NADH-quinone oxidoreductase, chain I [Sinorhizobium meliloti BL225C] Length = 163 Back     alignment and organism information
>gi|86357247|ref|YP_469139.1| NADH dehydrogenase subunit I [Rhizobium etli CFN 42] Length = 163 Back     alignment and organism information
>gi|150396121|ref|YP_001326588.1| NADH dehydrogenase subunit I [Sinorhizobium medicae WSM419] Length = 163 Back     alignment and organism information
>gi|15888607|ref|NP_354288.1| NADH dehydrogenase subunit I [Agrobacterium tumefaciens str. C58] Length = 163 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target163 NADH dehydrogenase subunit I [Candidatus Liberibacter a
PRK05888164 PRK05888, PRK05888, NADH dehydrogenase subunit I; Provi 2e-65
COG1143172 COG1143, NuoI, Formate hydrogenlyase subunit 6/NADH:ubi 4e-43
TIGR01971122 TIGR01971, NuoI, NADH-quinone oxidoreductase, chain I 9e-41
PRK08222181 PRK08222, PRK08222, hydrogenase 4 subunit H; Validated 5e-14
TIGR00403183 TIGR00403, ndhI, NADH-plastoquinone oxidoreductase subu 4e-13
PRK12387180 PRK12387, PRK12387, formate hydrogenlyase complex iron- 9e-13
CHL00014167 CHL00014, ndhI, NADH dehydrogenase subunit I 9e-12
KOG3256212 KOG3256, KOG3256, KOG3256, NADH:ubiquinone oxidoreducta 5e-62
PRK13984 604 PRK13984, PRK13984, putative oxidoreductase; Provisiona 2e-10
PRK13795636 PRK13795, PRK13795, hypothetical protein; Provisional 3e-08
COG2768354 COG2768, COG2768, Uncharacterized Fe-S center protein [ 7e-07
PRK08348120 PRK08348, PRK08348, NADH-plastoquinone oxidoreductase s 2e-06
COG114491 COG1144, COG1144, Pyruvate:ferredoxin oxidoreductase an 2e-05
COG114599 COG1145, NapF, Ferredoxin [Energy production and conver 2e-05
COG3383 978 COG3383, COG3383, Uncharacterized anaerobic dehydrogena 3e-05
COG4656529 COG4656, RnfC, Predicted NADH:ubiquinone oxidoreductase 2e-04
PRK09623105 PRK09623, vorD, 2-ketoisovalerate ferredoxin oxidoreduc 0.002
PRK07118280 PRK07118, PRK07118, ferredoxin; Validated 1e-08
TIGR02700234 TIGR02700, flavo_MJ0208, archaeoflavoprotein, MJ0208 fa 1e-07
TIGR02512 374 TIGR02512, Fe_only_hydrog, hydrogenases, Fe-only 1e-07
PRK12771564 PRK12771, PRK12771, putative glutamate synthase (NADPH) 2e-06
TIGR03224 411 TIGR03224, benzo_boxA, benzoyl-CoA oxygenase/reductase, 6e-06
COG1149 284 COG1149, COG1149, MinD superfamily P-loop ATPase contai 7e-06
TIGR02494 295 TIGR02494, PFLE_PFLC, glycyl-radical enzyme activating 2e-05
COG2221317 COG2221, DsrA, Dissimilatory sulfite reductase (desulfo 3e-05
COG4231640 COG4231, COG4231, Indolepyruvate ferredoxin oxidoreduct 3e-05
PRK14028312 PRK14028, PRK14028, pyruvate ferredoxin oxidoreductase 3e-05
PRK06273165 PRK06273, PRK06273, ferredoxin; Provisional 4e-05
TIGR0217978 TIGR02179, PorD_KorD, 2-oxoacid:acceptor oxidoreductase 4e-05
TIGR01944165 TIGR01944, rnfB, electron transport complex, RnfABCDGE 9e-05
COG1148 622 COG1148, HdrA, Heterodisulfide reductase, subunit A and 1e-04
TIGR03336595 TIGR03336, IOR_alpha, indolepyruvate ferredoxin oxidore 1e-04
PRK08318420 PRK08318, PRK08318, dihydropyrimidine dehydrogenase sub 1e-04
COG1142165 COG1142, HycB, Fe-S-cluster-containing hydrogenase comp 2e-04
COG114668 COG1146, COG1146, Ferredoxin [Energy production and con 4e-04
PRK06991270 PRK06991, PRK06991, ferredoxin; Provisional 4e-04
COG1148622 COG1148, HdrA, Heterodisulfide reductase, subunit A and 5e-04
PRK07118280 PRK07118, PRK07118, ferredoxin; Validated 5e-04
TIGR03294228 TIGR03294, FrhG, coenzyme F420 hydrogenase, subunit gam 6e-04
TIGR02176 1165 TIGR02176, pyruv_ox_red, pyruvate:ferredoxin (flavodoxi 0.001
PRK12769 654 PRK12769, PRK12769, putative oxidoreductase Fe-S bindin 0.001
TIGR03379 397 TIGR03379, glycerol3P_GlpC, glycerol-3-phosphate dehydr 0.001
PRK05113191 PRK05113, PRK05113, electron transport complex protein 0.001
COG1149 284 COG1149, COG1149, MinD superfamily P-loop ATPase contai 0.002
COG1142165 COG1142, HycB, Fe-S-cluster-containing hydrogenase comp 0.002
COG1600337 COG1600, COG1600, Uncharacterized Fe-S protein [Energy 0.002
COG0247 388 COG0247, GlpC, Fe-S oxidoreductase [Energy production a 0.003
COG2878198 COG2878, COG2878, Predicted NADH:ubiquinone oxidoreduct 0.004
COG1245 591 COG1245, COG1245, Predicted ATPase, RNase L inhibitor ( 0.004
PRK07118280 PRK07118, PRK07118, ferredoxin; Validated 0.004
PRK00783263 PRK00783, PRK00783, DNA-directed RNA polymerase subunit 0.004
PRK09898208 PRK09898, PRK09898, hypothetical protein; Provisional 0.004
PRK06991 270 PRK06991, PRK06991, ferredoxin; Provisional 3e-04
TIGR01944165 TIGR01944, rnfB, electron transport complex, RnfABCDGE 0.001
PRK05113191 PRK05113, PRK05113, electron transport complex protein 0.002
pfam0003724 pfam00037, Fer4, 4Fe-4S binding domain 0.003
>gnl|CDD|180305 PRK05888, PRK05888, NADH dehydrogenase subunit I; Provisional Back     alignment and domain information
>gnl|CDD|31338 COG1143, NuoI, Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162631 TIGR01971, NuoI, NADH-quinone oxidoreductase, chain I Back     alignment and domain information
>gnl|CDD|181301 PRK08222, PRK08222, hydrogenase 4 subunit H; Validated Back     alignment and domain information
>gnl|CDD|129498 TIGR00403, ndhI, NADH-plastoquinone oxidoreductase subunit I protein Back     alignment and domain information
>gnl|CDD|183492 PRK12387, PRK12387, formate hydrogenlyase complex iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|176957 CHL00014, ndhI, NADH dehydrogenase subunit I Back     alignment and domain information
>gnl|CDD|38466 KOG3256, KOG3256, KOG3256, NADH:ubiquinone oxidoreductase, NDUFS8/23 kDa subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|172486 PRK13984, PRK13984, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|184331 PRK13795, PRK13795, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|32630 COG2768, COG2768, Uncharacterized Fe-S center protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|181399 PRK08348, PRK08348, NADH-plastoquinone oxidoreductase subunit; Provisional Back     alignment and domain information
>gnl|CDD|31339 COG1144, COG1144, Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|31340 COG1145, NapF, Ferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|33190 COG3383, COG3383, Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>gnl|CDD|34275 COG4656, RnfC, Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|170016 PRK09623, vorD, 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>gnl|CDD|180852 PRK07118, PRK07118, ferredoxin; Validated Back     alignment and domain information
>gnl|CDD|131747 TIGR02700, flavo_MJ0208, archaeoflavoprotein, MJ0208 family Back     alignment and domain information
>gnl|CDD|162896 TIGR02512, Fe_only_hydrog, hydrogenases, Fe-only Back     alignment and domain information
>gnl|CDD|183735 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>gnl|CDD|132268 TIGR03224, benzo_boxA, benzoyl-CoA oxygenase/reductase, BoxA protein Back     alignment and domain information
>gnl|CDD|31343 COG1149, COG1149, MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162887 TIGR02494, PFLE_PFLC, glycyl-radical enzyme activating protein family Back     alignment and domain information
>gnl|CDD|32403 COG2221, DsrA, Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|33956 COG4231, COG4231, Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|172522 PRK14028, PRK14028, pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional Back     alignment and domain information
>gnl|CDD|180502 PRK06273, PRK06273, ferredoxin; Provisional Back     alignment and domain information
>gnl|CDD|131234 TIGR02179, PorD_KorD, 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information
>gnl|CDD|162616 TIGR01944, rnfB, electron transport complex, RnfABCDGE type, B subunit Back     alignment and domain information
>gnl|CDD|31342 COG1148, HdrA, Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|163218 TIGR03336, IOR_alpha, indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>gnl|CDD|181383 PRK08318, PRK08318, dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>gnl|CDD|31337 COG1142, HycB, Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|31341 COG1146, COG1146, Ferredoxin [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|180786 PRK06991, PRK06991, ferredoxin; Provisional Back     alignment and domain information
>gnl|CDD|31342 COG1148, HdrA, Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|180852 PRK07118, PRK07118, ferredoxin; Validated Back     alignment and domain information
>gnl|CDD|132337 TIGR03294, FrhG, coenzyme F420 hydrogenase, subunit gamma Back     alignment and domain information
>gnl|CDD|131231 TIGR02176, pyruv_ox_red, pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric Back     alignment and domain information
>gnl|CDD|183733 PRK12769, PRK12769, putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>gnl|CDD|132422 TIGR03379, glycerol3P_GlpC, glycerol-3-phosphate dehydrogenase, anaerobic, C subunit Back     alignment and domain information
>gnl|CDD|179940 PRK05113, PRK05113, electron transport complex protein RnfB; Provisional Back     alignment and domain information
>gnl|CDD|31343 COG1149, COG1149, MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|31337 COG1142, HycB, Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|31788 COG1600, COG1600, Uncharacterized Fe-S protein [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|30596 COG0247, GlpC, Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|32705 COG2878, COG2878, Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|31438 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|180852 PRK07118, PRK07118, ferredoxin; Validated Back     alignment and domain information
>gnl|CDD|179124 PRK00783, PRK00783, DNA-directed RNA polymerase subunit D; Provisional Back     alignment and domain information
>gnl|CDD|182135 PRK09898, PRK09898, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180786 PRK06991, PRK06991, ferredoxin; Provisional Back     alignment and domain information
>gnl|CDD|162616 TIGR01944, rnfB, electron transport complex, RnfABCDGE type, B subunit Back     alignment and domain information
>gnl|CDD|179940 PRK05113, PRK05113, electron transport complex protein RnfB; Provisional Back     alignment and domain information
>gnl|CDD|143826 pfam00037, Fer4, 4Fe-4S binding domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 163 NADH dehydrogenase subunit I [Candidatus Liberibacter a
PRK05888172 NADH dehydrogenase subunit I; Provisional 100.0
KOG3256212 consensus 100.0
TIGR01971129 NuoI NADH-quinone oxidoreductase, chain I; InterPro: IP 100.0
COG1143172 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone ox 100.0
CHL00014173 ndhI NADH dehydrogenase subunit I 100.0
TIGR00403187 ndhI NADH-plastoquinone oxidoreductase, I subunit; Inte 99.95
PRK13984 604 putative oxidoreductase; Provisional 99.93
PRK06273163 ferredoxin; Provisional 98.68
PRK08348111 NADH-plastoquinone oxidoreductase subunit; Provisional 100.0
PRK08222181 hydrogenase 4 subunit H; Validated 100.0
PRK12387178 formate hydrogenlyase complex iron-sulfur subunit; Prov 99.98
PRK09623105 vorD 2-ketoisovalerate ferredoxin oxidoreductase subuni 99.69
COG3383 978 Uncharacterized anaerobic dehydrogenase [General functi 99.2
PRK08493 819 NADH dehydrogenase subunit G; Validated 99.05
PRK05035 725 electron transport complex protein RnfC; Provisional 98.96
PRK09129 777 NADH dehydrogenase subunit G; Validated 98.88
PRK08166 858 NADH dehydrogenase subunit G; Validated 98.84
COG1149 284 MinD superfamily P-loop ATPase containing an inserted f 98.79
COG2768354 Uncharacterized Fe-S center protein [General function p 98.74
PRK09130 680 NADH dehydrogenase subunit G; Validated 98.71
TIGR01945444 rnfC electron transport complex, RnfABCDGE type, C subu 98.69
PRK07860 809 NADH dehydrogenase subunit G; Validated 98.64
COG1034 693 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 98.58
TIGR02910346 sulfite_red_A sulfite reductase, subunit A; InterPro: I 97.81
TIGR00397213 mauM_napG MauM/NapG family ferredoxin-type protein; Int 97.41
TIGR01973 715 NuoG NADH-quinone oxidoreductase, chain G; InterPro: IP 96.71
TIGR02176 1194 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoredu 95.04
PTZ00305297 NADH:ubiquinone oxidoreductase; Provisional 93.98
PRK09624105 porD pyuvate ferredoxin oxidoreductase subunit delta; R 99.42
PRK09626103 oorD 2-oxoglutarate-acceptor oxidoreductase subunit Oor 99.37
TIGR01944213 rnfB electron transport complex, RnfABCDGE type, B subu 99.35
PRK06991274 ferredoxin; Provisional 99.33
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Reviewed 99.31
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Reviewed 99.29
PRK05113184 electron transport complex protein RnfB; Provisional 99.27
TIGR02176 1194 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoredu 99.26
TIGR0217984 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subu 99.21
TIGR0304880 PS_I_psaC photosystem I iron-sulfur protein PsaC. Membe 99.2
TIGR02700237 flavo_MJ0208 archaeoflavoprotein, MJ0208 family; InterP 99.19
PRK08318413 dihydropyrimidine dehydrogenase; Validated 99.18
PRK09625130 porD pyruvate flavodoxin oxidoreductase subunit delta; 99.14
PRK09477287 napH quinol dehydrogenase membrane component; Provision 99.13
CHL0006581 psaC photosystem I subunit VII 99.13
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 99.12
PRK07118276 ferredoxin; Validated 99.11
COG114491 Pyruvate:ferredoxin oxidoreductase and related 2-oxoaci 99.09
PRK07118276 ferredoxin; Validated 99.08
PRK08764138 ferredoxin; Provisional 99.05
PRK0265181 photosystem I subunit VII; Provisional 99.03
PRK07569236 bidirectional hydrogenase complex protein HoxU; Validat 99.0
TIGR0293696 fdxN_nitrog ferredoxin III, nif-specific; InterPro: IPR 98.89
TIGR02163263 napH_ ferredoxin-type protein, NapH/MauN family; InterP 98.87
PRK10330181 electron transport protein HydN; Provisional 98.86
TIGR03294228 FrhG coenzyme F420 hydrogenase, subunit gamma. This mod 98.82
COG1142165 HycB Fe-S-cluster-containing hydrogenase components 2 [ 98.81
COG2878198 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB 98.8
TIGR02912323 sulfite_red_C sulfite reductase, subunit C; InterPro: I 98.8
COG1148 622 HdrA Heterodisulfide reductase, subunit A and related p 98.79
COG0437203 HybA Fe-S-cluster-containing hydrogenase components 1 [ 98.78
COG114599 NapF Ferredoxin [Energy production and conversion] 98.77
PRK10882329 hydrogenase 2 protein HybA; Provisional 98.75
PRK13795630 hypothetical protein; Provisional 98.73
COG2221317 DsrA Dissimilatory sulfite reductase (desulfoviridin), 98.72
TIGR02494 305 PFLE_PFLC glycyl-radical enzyme activating protein fami 98.71
COG1142165 HycB Fe-S-cluster-containing hydrogenase components 2 [ 98.69
PRK09326 346 F420H2 dehydrogenase subunit F; Provisional 98.66
COG114668 Ferredoxin [Energy production and conversion] 98.61
PRK10194164 ferredoxin-type protein; Provisional 98.61
PRK10194164 ferredoxin-type protein; Provisional 98.58
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha and bet 98.56
TIGR03149225 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S prote 98.52
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alp 98.5
TIGR00402161 napF ferredoxin-type protein NapF; InterPro: IPR004496 98.5
TIGR02745 474 ccoG_rdxA_fixG cytochrome c oxidase accessory protein C 98.49
PRK09898208 hypothetical protein; Provisional 98.49
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Reviewed 98.46
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Reviewed 98.45
PRK09476254 napG quinol dehydrogenase periplasmic component; Provis 98.42
COG1148622 HdrA Heterodisulfide reductase, subunit A and related p 98.39
TIGR02951162 DMSO_dmsB dimethylsulfoxide reductase, chain B; InterPr 98.38
TIGR03224 411 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protei 98.37
PRK10330181 electron transport protein HydN; Provisional 98.32
PRK09476254 napG quinol dehydrogenase periplasmic component; Provis 98.21
COG0437203 HybA Fe-S-cluster-containing hydrogenase components 1 [ 98.16
COG4656529 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit 98.16
TIGR03478321 DMSO_red_II_bet DMSO reductase family type II enzyme, i 98.15
TIGR03287391 methan_mark_16 putative methanogenesis marker 16 metall 98.14
TIGR03478321 DMSO_red_II_bet DMSO reductase family type II enzyme, i 98.1
TIGR01582293 FDH-beta formate dehydrogenase, beta subunit; InterPro: 98.08
PRK12387178 formate hydrogenlyase complex iron-sulfur subunit; Prov 97.9
PRK10882 329 hydrogenase 2 protein HybA; Provisional 97.9
TIGR02951162 DMSO_dmsB dimethylsulfoxide reductase, chain B; InterPr 97.86
PRK00941 779 acetyl-CoA decarbonylase/synthase complex subunit alpha 97.83
cd01916 731 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-C 97.77
TIGR00273450 TIGR00273 iron-sulfur cluster binding protein; InterPro 97.76
TIGR02060138 aprB adenylylsulfate reductase, beta subunit; InterPro: 97.73
TIGR03379 397 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, ana 97.72
PRK13409 590 putative ATPase RIL; Provisional 97.7
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog [Gene 97.69
PRK11168 400 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; P 97.66
PRK08222181 hydrogenase 4 subunit H; Validated 97.61
COG1152 772 CdhA CO dehydrogenase/acetyl-CoA synthase alpha subunit 97.56
COG1139459 Uncharacterized conserved protein containing a ferredox 97.49
COG0479234 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S p 97.48
PRK06259 491 succinate dehydrogenase/fumarate reductase iron-sulfur 97.45
TIGR00314 795 cdhA CO dehydrogenase/acetyl-CoA synthase complex, epsi 97.42
TIGR00276297 TIGR00276 iron-sulfur cluster binding protein, putative 97.42
PRK11274 407 glcF glycolate oxidase iron-sulfur subunit; Provisional 97.39
PRK12385243 fumarate reductase iron-sulfur subunit; Provisional 97.38
TIGR00397213 mauM_napG MauM/NapG family ferredoxin-type protein; Int 97.38
PRK12575235 succinate dehydrogenase iron-sulfur subunit; Provisiona 97.37
PRK12577330 succinate dehydrogenase iron-sulfur subunit; Provisiona 97.35
TIGR02066366 dsrB sulfite reductase, dissimilatory-type beta subunit 97.34
TIGR02486338 RDH reductive dehalogenase; InterPro: IPR012832 This en 97.32
PRK08640252 sdhB succinate dehydrogenase iron-sulfur subunit; Revie 97.32
PRK05950235 sdhB succinate dehydrogenase iron-sulfur subunit; Revie 97.32
COG1600337 Uncharacterized Fe-S protein [Energy production and con 97.23
PRK07570247 succinate dehydrogenase/fumarate reductase iron-sulfur 97.18
PRK12386250 fumarate reductase iron-sulfur subunit; Provisional 97.16
PRK13552240 frdB fumarate reductase iron-sulfur subunit; Provisiona 97.16
TIGR02512 380 Fe_only_hydrog hydrogenases, Fe-only; InterPro: IPR0133 97.16
COG0247 388 GlpC Fe-S oxidoreductase [Energy production and convers 96.9
TIGR03290144 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subuni 96.78
PRK12576311 succinate dehydrogenase iron-sulfur subunit; Provisiona 96.68
COG0348386 NapH Polyferredoxin [Energy production and conversion] 96.65
PRK08493 819 NADH dehydrogenase subunit G; Validated 96.54
KOG0063 592 consensus 96.52
COG1035 332 FrhB Coenzyme F420-reducing hydrogenase, beta subunit [ 96.32
PRK05352448 Na(+)-translocating NADH-quinone reductase subunit A; P 96.3
PRK09477287 napH quinol dehydrogenase membrane component; Provision 96.14
COG244099 FixX Ferredoxin-like protein [Energy production and con 96.11
COG114168 Fer Ferredoxin [Energy production and conversion] 95.9
KOG0063 592 consensus 95.66
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 95.38
PRK098531032 putative selenate reductase subunit YgfK; Provisional 95.35
COG1941247 FrhG Coenzyme F420-reducing hydrogenase, gamma subunit 94.98
COG1453391 Predicted oxidoreductases of the aldo/keto reductase fa 93.96
PRK07860 809 NADH dehydrogenase subunit G; Validated 93.69
TIGR01660 495 narH nitrate reductase, beta subunit; InterPro: IPR0065 93.66
TIGR02163263 napH_ ferredoxin-type protein, NapH/MauN family; InterP 93.16
COG1150195 HdrC Heterodisulfide reductase, subunit C [Energy produ 92.1
COG1140 513 NarY Nitrate reductase beta subunit [Energy production 91.92
PRK08166 858 NADH dehydrogenase subunit G; Validated 91.85
PRK09898208 hypothetical protein; Provisional 99.15
TIGR03149225 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S prote 98.66
PRK09623105 vorD 2-ketoisovalerate ferredoxin oxidoreductase subuni 97.99
PRK09624105 porD pyuvate ferredoxin oxidoreductase subunit delta; R 97.67
PRK05113184 electron transport complex protein RnfB; Provisional 97.37
TIGR01944213 rnfB electron transport complex, RnfABCDGE type, B subu 97.29
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 97.26
PRK0265181 photosystem I subunit VII; Provisional 97.26
PRK08764138 ferredoxin; Provisional 97.23
PRK06991 274 ferredoxin; Provisional 97.19
pfam0003726 Fer4 4Fe-4S binding domain. Superfamily includes protei 97.17
PRK09626103 oorD 2-oxoglutarate-acceptor oxidoreductase subunit Oor 97.16
TIGR03294228 FrhG coenzyme F420 hydrogenase, subunit gamma. This mod 97.02
COG2221317 DsrA Dissimilatory sulfite reductase (desulfoviridin), 96.96
CHL00014173 ndhI NADH dehydrogenase subunit I 96.91
TIGR02745 474 ccoG_rdxA_fixG cytochrome c oxidase accessory protein C 96.79
TIGR0217984 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subu 96.78
PRK06273163 ferredoxin; Provisional 96.73
TIGR0293696 fdxN_nitrog ferredoxin III, nif-specific; InterPro: IPR 96.65
TIGR02486338 RDH reductive dehalogenase; InterPro: IPR012832 This en 96.28
COG114599 NapF Ferredoxin [Energy production and conversion] 96.25
PRK09625130 porD pyruvate flavodoxin oxidoreductase subunit delta; 95.96
PRK13795630 hypothetical protein; Provisional 95.95
TIGR02700237 flavo_MJ0208 archaeoflavoprotein, MJ0208 family; InterP 95.84
COG114491 Pyruvate:ferredoxin oxidoreductase and related 2-oxoaci 95.67
COG2878198 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB 95.39
TIGR01582293 FDH-beta formate dehydrogenase, beta subunit; InterPro: 95.32
COG2768354 Uncharacterized Fe-S center protein [General function p 94.62
TIGR02910346 sulfite_red_A sulfite reductase, subunit A; InterPro: I 93.43
TIGR00276297 TIGR00276 iron-sulfur cluster binding protein, putative 93.05
PRK05035 725 electron transport complex protein RnfC; Provisional 92.98
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alp 92.91
TIGR01945444 rnfC electron transport complex, RnfABCDGE type, C subu 92.71
PRK05950235 sdhB succinate dehydrogenase iron-sulfur subunit; Revie 91.9
PRK12814652 putative NADPH-dependent glutamate synthase small subun 91.66
COG1035332 FrhB Coenzyme F420-reducing hydrogenase, beta subunit [ 91.44
PRK08640252 sdhB succinate dehydrogenase iron-sulfur subunit; Revie 91.24
TIGR03287391 methan_mark_16 putative methanogenesis marker 16 metall 91.2
PRK12386250 fumarate reductase iron-sulfur subunit; Provisional 90.82
PRK07570247 succinate dehydrogenase/fumarate reductase iron-sulfur 90.79
PRK12385243 fumarate reductase iron-sulfur subunit; Provisional 90.5
PRK12575235 succinate dehydrogenase iron-sulfur subunit; Provisiona 90.23
TIGR00403187 ndhI NADH-plastoquinone oxidoreductase, I subunit; Inte 90.03
TIGR00402161 napF ferredoxin-type protein NapF; InterPro: IPR004496 97.63
PRK08318413 dihydropyrimidine dehydrogenase; Validated 97.43
PRK08348111 NADH-plastoquinone oxidoreductase subunit; Provisional 97.42
COG1143172 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone ox 97.4
TIGR0304880 PS_I_psaC photosystem I iron-sulfur protein PsaC. Membe 97.29
PRK13409 590 putative ATPase RIL; Provisional 97.23
PRK05888172 NADH dehydrogenase subunit I; Provisional 97.21
PRK09326 346 F420H2 dehydrogenase subunit F; Provisional 97.17
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog [Gene 97.15
PRK13984 604 putative oxidoreductase; Provisional 97.04
TIGR01971129 NuoI NADH-quinone oxidoreductase, chain I; InterPro: IP 97.0
KOG3256212 consensus 96.92
COG3383 978 Uncharacterized anaerobic dehydrogenase [General functi 96.9
CHL0006581 psaC photosystem I subunit VII 96.68
COG1149284 MinD superfamily P-loop ATPase containing an inserted f 96.59
pfam0003726 Fer4 4Fe-4S binding domain. Superfamily includes protei 96.51
COG114668 Ferredoxin [Energy production and conversion] 96.39
PRK07569236 bidirectional hydrogenase complex protein HoxU; Validat 95.99
TIGR02494 305 PFLE_PFLC glycyl-radical enzyme activating protein fami 95.51
PRK09129 777 NADH dehydrogenase subunit G; Validated 94.64
TIGR03224 411 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protei 94.14
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha and bet 94.1
TIGR02912323 sulfite_red_C sulfite reductase, subunit C; InterPro: I 96.38
>PRK05888 NADH dehydrogenase subunit I; Provisional Back     alignment and domain information
>KOG3256 consensus Back     alignment and domain information
>TIGR01971 NuoI NADH-quinone oxidoreductase, chain I; InterPro: IPR010226 This entry represents the I subunit (one of 14 subunits, A to N) of the NADH-quinone oxidoreductase complex I which generally couples NADH and ubiquinone oxidation/reduction in bacteria and mammalian mitochondria, but may act on NADPH and/or plastoquinone in cyanobacteria and plant chloroplasts Back     alignment and domain information
>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] Back     alignment and domain information
>CHL00014 ndhI NADH dehydrogenase subunit I Back     alignment and domain information
>TIGR00403 ndhI NADH-plastoquinone oxidoreductase, I subunit; InterPro: IPR004497 NADH-plastoquinone oxidoreductase subunit I (1 Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06273 ferredoxin; Provisional Back     alignment and domain information
>PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional Back     alignment and domain information
>PRK08222 hydrogenase 4 subunit H; Validated Back     alignment and domain information
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>COG2768 Uncharacterized Fe-S center protein [General function prediction only] Back     alignment and domain information
>PRK09130 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit; InterPro: IPR010208 The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>TIGR02910 sulfite_red_A sulfite reductase, subunit A; InterPro: IPR014259 This entry represents subunit A, one of the three subunits of the anaerobic sulphite reductase of Salmonella, and close homologues from various Clostridium species, where the three-gene neighbourhood is preserved Back     alignment and domain information
>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein; InterPro: IPR004494 MauM ferredoxin-type protein is involved in methylamine utilization Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G; InterPro: IPR010228 This entry represents the G subunit (one of 14 subunits, A to N) of the NADH-quinone oxidoreductase complex I which generally couples NADH and ubiquinone oxidation/reduction in bacteria and mammalian mitochondria while translocating protons, but may act on NADPH and/or plastoquinone in cyanobacteria and plant chloroplasts Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase; InterPro: IPR011895 The oxidative decarboxylation of pyruvate to acetyl-CoA, a central step in energy metabolism, can occur by two different mechanisms Back     alignment and domain information
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional Back     alignment and domain information
>PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed Back     alignment and domain information
>TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit; InterPro: IPR010207 The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation Back     alignment and domain information
>PRK06991 ferredoxin; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK05113 electron transport complex protein RnfB; Provisional Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase; InterPro: IPR011895 The oxidative decarboxylation of pyruvate to acetyl-CoA, a central step in energy metabolism, can occur by two different mechanisms Back     alignment and domain information
>TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family; InterPro: IPR011898 A number of anaerobic and microaerophilic species lack pyruvate dehydrogenase and have instead a four subunit, oxygen-sensitive pyruvate oxidoreductase, with either ferredoxins or flavodoxins used as the acceptor Back     alignment and domain information
>TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC Back     alignment and domain information
>TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family; InterPro: IPR014073 This entry describes one of two paralogous families of archaeal flavoprotein Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase; Validated Back     alignment and domain information
>PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>PRK09477 napH quinol dehydrogenase membrane component; Provisional Back     alignment and domain information
>CHL00065 psaC photosystem I subunit VII Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK07118 ferredoxin; Validated Back     alignment and domain information
>COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion] Back     alignment and domain information
>PRK07118 ferredoxin; Validated Back     alignment and domain information
>PRK08764 ferredoxin; Provisional Back     alignment and domain information
>PRK02651 photosystem I subunit VII; Provisional Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific; InterPro: IPR014283 This entry consists of ferredoxins which are encoded in the nitrogen fixation regions of many nitrogen-fixing bacteria Back     alignment and domain information
>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family; InterPro: IPR011886 Most members of this family are the NapH protein, found next to NapG,in operons that encode the periplasmic nitrate reductase Back     alignment and domain information
>PRK10330 electron transport protein HydN; Provisional Back     alignment and domain information
>TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma Back     alignment and domain information
>COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] Back     alignment and domain information
>COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion] Back     alignment and domain information
>TIGR02912 sulfite_red_C sulfite reductase, subunit C; InterPro: IPR014261 This entry represents subunit C, one of the three subunits of the anaerobic sulphite reductase of Salmonella, and close homologues from various Clostridium species, where the three-gene neighbourhood is preserved Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] Back     alignment and domain information
>COG1145 NapF Ferredoxin [Energy production and conversion] Back     alignment and domain information
>PRK10882 hydrogenase 2 protein HybA; Provisional Back     alignment and domain information
>PRK13795 hypothetical protein; Provisional Back     alignment and domain information
>COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family; InterPro: IPR012839 This subset of the radical-SAM domain includes a number of probable activating proteins acting on different enzymes all requiring an amino-acid-centred radical Back     alignment and domain information
>COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] Back     alignment and domain information
>PRK09326 F420H2 dehydrogenase subunit F; Provisional Back     alignment and domain information
>COG1146 Ferredoxin [Energy production and conversion] Back     alignment and domain information
>PRK10194 ferredoxin-type protein; Provisional Back     alignment and domain information
>PRK10194 ferredoxin-type protein; Provisional Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>TIGR00402 napF ferredoxin-type protein NapF; InterPro: IPR004496 Members of this family are the ferredoxin-type protein subunits of nitrate reductase Back     alignment and domain information
>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein CcoG; InterPro: IPR014116 Member of this ferredoxin-like protein family, include FixG, CcoG and RdxA, Back     alignment and domain information
>PRK09898 hypothetical protein; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>TIGR02951 DMSO_dmsB dimethylsulfoxide reductase, chain B; InterPro: IPR014297 This family consists of the iron-sulphur subunit, or chain B, of the anaerobic dimethyl sulphoxide reductase enzyme Back     alignment and domain information
>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein Back     alignment and domain information
>PRK10330 electron transport protein HydN; Provisional Back     alignment and domain information
>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional Back     alignment and domain information
>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] Back     alignment and domain information
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit Back     alignment and domain information
>TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein Back     alignment and domain information
>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit Back     alignment and domain information
>TIGR01582 FDH-beta formate dehydrogenase, beta subunit; InterPro: IPR006470 The sequences in this group represent the beta subunit of the gamma-proteobacterial formate dehydrogenase Back     alignment and domain information
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK10882 hydrogenase 2 protein HybA; Provisional Back     alignment and domain information
>TIGR02951 DMSO_dmsB dimethylsulfoxide reductase, chain B; InterPro: IPR014297 This family consists of the iron-sulphur subunit, or chain B, of the anaerobic dimethyl sulphoxide reductase enzyme Back     alignment and domain information
>PRK00941 acetyl-CoA decarbonylase/synthase complex subunit alpha; Validated Back     alignment and domain information
>cd01916 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-CoA decarbonylase, is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA Back     alignment and domain information
>TIGR00273 TIGR00273 iron-sulfur cluster binding protein; InterPro: IPR004452 Members of this family have a perfect 4Fe-4S binding motif C-x(2)-C-x(2)-C-x(3)-CP followed by either a perfect or imperfect (the first Cys replaced by Ser) second copy Back     alignment and domain information
>TIGR02060 aprB adenylylsulfate reductase, beta subunit; InterPro: IPR011802 During dissimilatory sulphate reduction and sulphur oxidation, adenylylsulphate (APS) reductase catalyzes reversibly the two-electron reduction of APS to sulphite and AMP Back     alignment and domain information
>TIGR03379 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, anaerobic, C subunit Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>PRK11168 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; Provisional Back     alignment and domain information
>PRK08222 hydrogenase 4 subunit H; Validated Back     alignment and domain information
>COG1152 CdhA CO dehydrogenase/acetyl-CoA synthase alpha subunit [Energy production and conversion] Back     alignment and domain information
>COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain [Energy production and conversion] Back     alignment and domain information
>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR00314 cdhA CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit; InterPro: IPR004460 Acetyl-CoA decarbonylase/synthase (ACDS) is a multienzyme complex (carbon monoxide dehydrogenase is a synonym) Back     alignment and domain information
>TIGR00276 TIGR00276 iron-sulfur cluster binding protein, putative; InterPro: IPR004453 This is a family of putative iron-sulphur cluster binding proteins Back     alignment and domain information
>PRK11274 glcF glycolate oxidase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein; InterPro: IPR004494 MauM ferredoxin-type protein is involved in methylamine utilization Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR02066 dsrB sulfite reductase, dissimilatory-type beta subunit; InterPro: IPR011808 Dissimilatory sulphite reductase catalyzes the six-electron reduction of sulphite to sulphide, as the terminal reaction in dissimilatory sulphate reduction Back     alignment and domain information
>TIGR02486 RDH reductive dehalogenase; InterPro: IPR012832 This entry represents a family of corrin and 8-iron Fe-S cluster-containing reductive dehalogenases found primarily in halorespiring microorganisms such as Dehalococcoides ethenogenes which contains as many as 17 enzymes of this type with varying substrate ranges Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>COG1600 Uncharacterized Fe-S protein [Energy production and conversion] Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR02512 Fe_only_hydrog hydrogenases, Fe-only; InterPro: IPR013352 This model describes iron-only hydrogenases of anaerobic and microaerophilic bacteria and protozoa Back     alignment and domain information
>COG0247 GlpC Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C Back     alignment and domain information
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>COG0348 NapH Polyferredoxin [Energy production and conversion] Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>KOG0063 consensus Back     alignment and domain information
>COG1035 FrhB Coenzyme F420-reducing hydrogenase, beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional Back     alignment and domain information
>PRK09477 napH quinol dehydrogenase membrane component; Provisional Back     alignment and domain information
>COG2440 FixX Ferredoxin-like protein [Energy production and conversion] Back     alignment and domain information
>COG1141 Fer Ferredoxin [Energy production and conversion] Back     alignment and domain information
>KOG0063 consensus Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>COG1941 FrhG Coenzyme F420-reducing hydrogenase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR01660 narH nitrate reductase, beta subunit; InterPro: IPR006547 The nitrate reductase enzyme complex allows bacteria to use nitrate as an electron acceptor during anaerobic growth Back     alignment and domain information
>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family; InterPro: IPR011886 Most members of this family are the NapH protein, found next to NapG,in operons that encode the periplasmic nitrate reductase Back     alignment and domain information
>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion] Back     alignment and domain information
>COG1140 NarY Nitrate reductase beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK09898 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein Back     alignment and domain information
>PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>PRK05113 electron transport complex protein RnfB; Provisional Back     alignment and domain information
>TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit; InterPro: IPR010207 The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK02651 photosystem I subunit VII; Provisional Back     alignment and domain information
>PRK08764 ferredoxin; Provisional Back     alignment and domain information
>PRK06991 ferredoxin; Provisional Back     alignment and domain information
>pfam00037 Fer4 4Fe-4S binding domain Back     alignment and domain information
>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed Back     alignment and domain information
>TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma Back     alignment and domain information
>COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>CHL00014 ndhI NADH dehydrogenase subunit I Back     alignment and domain information
>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein CcoG; InterPro: IPR014116 Member of this ferredoxin-like protein family, include FixG, CcoG and RdxA, Back     alignment and domain information
>TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family; InterPro: IPR011898 A number of anaerobic and microaerophilic species lack pyruvate dehydrogenase and have instead a four subunit, oxygen-sensitive pyruvate oxidoreductase, with either ferredoxins or flavodoxins used as the acceptor Back     alignment and domain information
>PRK06273 ferredoxin; Provisional Back     alignment and domain information
>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific; InterPro: IPR014283 This entry consists of ferredoxins which are encoded in the nitrogen fixation regions of many nitrogen-fixing bacteria Back     alignment and domain information
>TIGR02486 RDH reductive dehalogenase; InterPro: IPR012832 This entry represents a family of corrin and 8-iron Fe-S cluster-containing reductive dehalogenases found primarily in halorespiring microorganisms such as Dehalococcoides ethenogenes which contains as many as 17 enzymes of this type with varying substrate ranges Back     alignment and domain information
>COG1145 NapF Ferredoxin [Energy production and conversion] Back     alignment and domain information
>PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>PRK13795 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family; InterPro: IPR014073 This entry describes one of two paralogous families of archaeal flavoprotein Back     alignment and domain information
>COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion] Back     alignment and domain information
>COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion] Back     alignment and domain information
>TIGR01582 FDH-beta formate dehydrogenase, beta subunit; InterPro: IPR006470 The sequences in this group represent the beta subunit of the gamma-proteobacterial formate dehydrogenase Back     alignment and domain information
>COG2768 Uncharacterized Fe-S center protein [General function prediction only] Back     alignment and domain information
>TIGR02910 sulfite_red_A sulfite reductase, subunit A; InterPro: IPR014259 This entry represents subunit A, one of the three subunits of the anaerobic sulphite reductase of Salmonella, and close homologues from various Clostridium species, where the three-gene neighbourhood is preserved Back     alignment and domain information
>TIGR00276 TIGR00276 iron-sulfur cluster binding protein, putative; InterPro: IPR004453 This is a family of putative iron-sulphur cluster binding proteins Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit; InterPro: IPR010208 The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>COG1035 FrhB Coenzyme F420-reducing hydrogenase, beta subunit [Energy production and conversion] Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR00403 ndhI NADH-plastoquinone oxidoreductase, I subunit; InterPro: IPR004497 NADH-plastoquinone oxidoreductase subunit I (1 Back     alignment and domain information
>TIGR00402 napF ferredoxin-type protein NapF; InterPro: IPR004496 Members of this family are the ferredoxin-type protein subunits of nitrate reductase Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase; Validated Back     alignment and domain information
>PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional Back     alignment and domain information
>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] Back     alignment and domain information
>TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK05888 NADH dehydrogenase subunit I; Provisional Back     alignment and domain information
>PRK09326 F420H2 dehydrogenase subunit F; Provisional Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01971 NuoI NADH-quinone oxidoreductase, chain I; InterPro: IPR010226 This entry represents the I subunit (one of 14 subunits, A to N) of the NADH-quinone oxidoreductase complex I which generally couples NADH and ubiquinone oxidation/reduction in bacteria and mammalian mitochondria, but may act on NADPH and/or plastoquinone in cyanobacteria and plant chloroplasts Back     alignment and domain information
>KOG3256 consensus Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>CHL00065 psaC photosystem I subunit VII Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>pfam00037 Fer4 4Fe-4S binding domain Back     alignment and domain information
>COG1146 Ferredoxin [Energy production and conversion] Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family; InterPro: IPR012839 This subset of the radical-SAM domain includes a number of probable activating proteins acting on different enzymes all requiring an amino-acid-centred radical Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>TIGR02912 sulfite_red_C sulfite reductase, subunit C; InterPro: IPR014261 This entry represents subunit C, one of the three subunits of the anaerobic sulphite reductase of Salmonella, and close homologues from various Clostridium species, where the three-gene neighbourhood is preserved Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target163 NADH dehydrogenase subunit I [Candidatus Liberibacter a
2fug_9182 Crystal Structure Of The Hydrophilic Domain Of Resp 4e-28
3bk7_A 607 Structure Of The Complete Abce1RNAASE-L Inhibitor P 7e-04
1b0p_A 1231 Crystal Structure Of Pyruvate-Ferredoxin Oxidoreduc 2e-04
2vkr_A103 3fe-4s, 4fe-4s Plus Zn Acidianus Ambivalens Ferredo 3e-04
1xer_A103 Structure Of Ferredoxin Length = 103 0.001
1hfe_L 421 1.6 A Resolution Structure Of The Fe-Only Hydrogena 0.002
gi|90109660|pdb|2FUG|9 Chain 9, Crystal Structure Of The Hydrophilic Domain Of Respiratory Complex I From Thermus Thermophilus Length = 182 Back     alignment and structure
 Score =  127 bits (320), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 59/152 (38%), Positives = 81/152 (53%), Gaps = 7/152 (4%)

Query: 11  LFLKEFVGAFFLCLRYFFKAKTTINYPFEKGSTSPRFRGEHALRRYPNGEERCIACKLCE 70
           + LK    +  + L+Y F    T+ YP    +  PRF G H L R+PNG E+CI C LC 
Sbjct: 1   MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCA 60

Query: 71  AICPAQAITIESGPRCHD-----GTRRTVRYDIDMIKCIYCGLCQEACPVDAIVEGPNFE 125
           A CPA AI +E      +     G R    Y+I+M++CI+CGLC+EACP  AIV G +FE
Sbjct: 61  AACPAYAIYVEPAENDPENPVSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFE 120

Query: 126 FATETRQELYYDKERLL--NNGDRWESEIVRN 155
            A     +L Y KE +L    G + +    + 
Sbjct: 121 MADYEYSDLVYGKEDMLVDVVGTKPQRREAKR 152


>gi|163931196|pdb|3BK7|A Chain A, Structure Of The Complete Abce1RNAASE-L Inhibitor Protein From Pyrococcus Abysii Length = 607 Back     alignment and structure
>gi|4558091|pdb|1B0P|A Chain A, Crystal Structure Of Pyruvate-Ferredoxin Oxidoreductase From Desulfovibrio Africanus Length = 1231 Back     alignment and structure
gi|169404651|pdb|2VKR|A Chain A, 3fe-4s, 4fe-4s Plus Zn Acidianus Ambivalens Ferredoxin Length = 103 Back     alignment and structure
>gi|157834237|pdb|1XER|A Chain A, Structure Of Ferredoxin Length = 103 Back     alignment and structure
gi|290560604|pdb|1HFE|L Chain L, 1.6 A Resolution Structure Of The Fe-Only Hydrogenase From Desulfovibrio Desulfuricans Length = 421 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target163 NADH dehydrogenase subunit I [Candidatus Liberibacter a
3i9v_9182 NADH-quinone oxidoreductase subunit 9; electron transpo 4e-34
2c42_A 1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron- 2e-05
1jb0_C80 Photosystem I iron-sulfur center; membrane protein, mul 2e-10
2fdn_A55 Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0. 6e-10
3eun_A82 Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4 4e-09
1xer_A103 Ferredoxin; electron transport, iron-sulfur, duplicatio 8e-09
3gyx_B166 Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3. 1e-08
2zvs_A85 Uncharacterized ferredoxin-like protein YFHL; electron 2e-08
1rgv_A80 Ferredoxin; electron transport; 2.90A {Thauera aromatic 2e-08
2fgo_A82 Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, r 4e-08
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer, fla 3e-07
1dwl_A59 Ferredoxin I; electron transfer, model, heteronuclear d 6e-07
1f2g_A58 Ferredoxin II; electron transport, FDII desulfovibrio g 1e-06
1hfe_L 421 Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger su 1e-06
1sj1_A66 Ferredoxin; thermostability, iron-sulfur cluster, hexam 1e-06
1iqz_A81 Ferredoxin; iron-sulfer protein, ultlahigh resolution a 4e-06
1jnr_B150 Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1. 7e-06
1h98_A78 Ferredoxin; electron transport, thermophilic, iron-sulf 8e-06
1q16_B 512 Respiratory nitrate reductase 1 beta chain; membrane pr 1e-05
1q16_B 512 Respiratory nitrate reductase 1 beta chain; membrane pr 1e-04
1kqf_B294 FDH-N beta, formate dehydrogenase, nitrate-inducible, i 2e-05
2v2k_A105 Ferredoxin; iron, 3Fe-4S, 4Fe-4S, transport, iron-sulfu 2e-05
1bc6_A77 7-Fe ferredoxin; electron transport, iron-sulfur; NMR { 3e-05
1rof_A60 Ferredoxin; electron transport, iron-sulfur; NMR {Therm 9e-05
1dax_A64 Ferredoxin I; electron transport, electron-transfer pro 1e-04
2ivf_B352 Ethylbenzene dehydrogenase beta-subunit; anaerobic hydr 8e-04
1ti6_B274 Pyrogallol hydroxytransferase small subunit; molybdenum 0.001
3mm5_B366 Sulfite reductase, dissimilatory-type subunit BET; alph 0.001
1h0h_B214 Formate dehydrogenase (small subunit); tungsten seleniu 0.002
3i9v_3 783 NADH-quinone oxidoreductase subunit 3; electron transpo 0.003
>3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, 4Fe- 4S, cell membrane, flavoprotein, FMN, iron; HET: FMN; 3.10A {Thermus thermophilus HB8} PDB: 2fug_9* 3iam_9* 3ias_9* Length = 182 Back     alignment and structure
 Score =  138 bits (349), Expect = 4e-34
 Identities = 59/152 (38%), Positives = 81/152 (53%), Gaps = 7/152 (4%)

Query: 11  LFLKEFVGAFFLCLRYFFKAKTTINYPFEKGSTSPRFRGEHALRRYPNGEERCIACKLCE 70
           + LK    +  + L+Y F    T+ YP    +  PRF G H L R+PNG E+CI C LC 
Sbjct: 1   MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCA 60

Query: 71  AICPAQAITIESGP-----RCHDGTRRTVRYDIDMIKCIYCGLCQEACPVDAIVEGPNFE 125
           A CPA AI +E            G R    Y+I+M++CI+CGLC+EACP  AIV G +FE
Sbjct: 61  AACPAYAIYVEPAENDPENPVSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFE 120

Query: 126 FATETRQELYYDKERLLNN--GDRWESEIVRN 155
            A     +L Y KE +L +  G + +    + 
Sbjct: 121 MADYEYSDLVYGKEDMLVDVVGTKPQRREAKR 152


>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Length = 1231 Back     alignment and structure
>1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthesis; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 2o01_C* Length = 80 Back     alignment and structure
>2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A Length = 55 Back     alignment and structure
>3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} PDB: 1blu_A 3exy_A Length = 82 Back     alignment and structure
>1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A Length = 103 Back     alignment and structure
>3gyx_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Length = 166 Back     alignment and structure
>2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron- sulfur clusters, reduction potential; 1.65A {Escherichia coli k-12} Length = 85 Back     alignment and structure
>1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica K172} SCOP: d.58.1.1 Length = 80 Back     alignment and structure
>2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa} Length = 82 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Length = 1025 Back     alignment and structure
>1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfovibrio desulfuricans} SCOP: i.4.1.1 Length = 59 Back     alignment and structure
>1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A Length = 58 Back     alignment and structure
>1hfe_L Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger subunit)); X-RAY crystallography, hydrogene metabolism, periplasm; 1.60A {Desulfovibrio vulgaris subsp} SCOP: c.96.1.1 d.58.1.5 PDB: 1e08_A* 1gx7_A* Length = 421 Back     alignment and structure
>1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A Length = 66 Back     alignment and structure
>1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A* Length = 81 Back     alignment and structure
>1jnr_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.1.5 PDB: 1jnz_B* 2fja_B* 2fjb_B* 2fjd_B* 2fje_B* Length = 150 Back     alignment and structure
>1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2 Length = 78 Back     alignment and structure
>1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* Length = 512 Back     alignment and structure
>1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* Length = 512 Back     alignment and structure
>1kqf_B FDH-N beta, formate dehydrogenase, nitrate-inducible, iron- sulfur subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* Length = 294 Back     alignment and structure
>2v2k_A Ferredoxin; iron, 3Fe-4S, 4Fe-4S, transport, iron-sulfur, mycobacterium tuberculosis, Fe-S cluster, metal-binding, electron transfer; 1.6A {Mycobacterium smegmatis} Length = 105 Back     alignment and structure
>1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A Length = 77 Back     alignment and structure
>1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A Length = 60 Back     alignment and structure
>1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A Length = 64 Back     alignment and structure
>2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- bismgd enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Azoarcus SP} Length = 352 Back     alignment and structure
>1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* Length = 274 Back     alignment and structure
>3mm5_B Sulfite reductase, dissimilatory-type subunit BET; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3c7b_B* 3mm6_B* 3mm7_B* 3mm8_B* 3mm9_B* 3mma_B* 3mmb_B* 3mmc_B* Length = 366 Back     alignment and structure