254780862

254780862

NADH dehydrogenase subunit J

GeneID in NCBI database:8209877Locus tag:CLIBASIA_03785
Protein GI in NCBI database:254780862Protein Accession:YP_003065275.1
Gene range:+(831298, 831897)Protein Length:199aa
Gene description:NADH dehydrogenase subunit J
COG prediction:[C] NADH:ubiquinone oxidoreductase subunit 6 (chain J)
KEGG prediction:nuoJ; NADH dehydrogenase subunit J (EC:1.6.99.5); K00339 NADH dehydrogenase I subunit J [EC:1.6.5.3]
SEED prediction:NADH-ubiquinone oxidoreductase chain J (EC 1.6.5.3)
Pathway involved in KEGG:Oxidative phosphorylation [PATH:las00190]
Subsystem involved in SEED:Respiratory Complex I
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM5 TM-Helix
TOPPRED5 TM-Helix
HMMTOP5 TM-Helix
MEMSAT5 TM-Helix
MEMSAT_SVM5 TM-Helix
PHOBIUS5 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MVMQSLFFYLFSFMAIISSFLVVTVRNPIYSVFSLIFAFVNAAGLFLLLGAEFVAMITLVVYVGAVIVFFLFIIMMLDIDIEVAEPRKKRGFLGSFFIGILAAELIVCASNFMVFSAEGELSRLVFKGNNVENIGKVLYTQYAYPLEISGFILLLSMIGAIVLMLRHRRDIKRQDISKQLESNPDNSIVMVKVKSGKGI
cHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEHHHHHHccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccEEEEEEccccccc
ccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHccccccEEEEEEccccccc
MVMQSLFFYLFSFMAIISSFLVVTVRNPIYSVFSLIFAFVNAAGLFLLLGAEFVAMITLVVYVGAVIVFFLFIIMMLDIDievaeprkkrgflgsFFIGILAAELIVCASNFMVFSAEGELSRlvfkgnnvenIGKVLYTQYAYPLEISGFILLLSMIGAIVLMLRHRrdikrqdiskqlesnpdnsiVMVKVKSGKGI
MVMQSLFFYLFSFMAIISSFLVVTVRNPIYSVFSLIFAFVNAAGLFLLLGAEFVAMITLVVYVGAVIVFFLFIIMMLDIDIEVAEPRKKRGFLGSFFIGILAAELIVCASNFMVFSAEGELSRLVFKGNNVENIGKVLYTQYAYPLEISGFILLLSMIGAIVLMLRHRRDIKRQdiskqlesnpdnsivmvkvksgkgi
MVMQSLFFYLFSFMAIISSFLVVTVRNPIYSVFSLIfafvnaaglflllgaefvaMITLVVYVGAVIVFFLFIIMMLDIDIEVAEPRKKRGFLGSFFIGILAAELIVCASNFMVFSAEGELSRLVFKGNNVENIGKVLYTQYAYPLEISGFILLLSMIGAIVLMLRHRRDIKRQDISKQLESNPDNSIVMVKVKSGKGI
MVMQSLFFYLFSFMAIISSFLVVTVRNPIYSVFSLIFAFVNAAGLFLLLGAEFVAMITLVVYVGAVIVFFLFIIMMLDIDIEVAEPRKKRGFLGSFFIGILAAELIVCASNFMVFSAEGELSRLVFKGNNVENIGKVLYTQYAYPLEISGFILLLSMIGAIVLMLRHR******D****LESNPDNSIVMVKVK*****
MVMQSLFFYLFSFMAIISSFLVVTVRNPIYSVFSLIFAFVNAAGLFLLLGAEFVAMITLVVYVGAVIVFFLFIIMMLDIDIEVAEPRKKRGFLGSFFIGILAAELIVCASNFMVFSAEGELSRLVFKGNNVENIGKVLYTQYAYPLEISGFILLLSMIGAIVLMLRHRRDIKRQDISKQLESNPDNSIVMVKVKSGKGI
MVMQSLFFYLFSFMAIISSFLVVTVRNPIYSVFSLIFAFVNAAGLFLLLGAEFVAMITLVVYVGAVIVFFLFIIMMLDIDIEVAEPRKKRGFLGSFFIGILAAELIVCASNFMVFSAEGELSRLVFKGNNVENIGKVLYTQYAYPLEISGFILLLSMIGAIVLMLRHRRDIKRQDISKQLESNPDNSIVMVKVKS****
ooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVMQSLFFYLFSFMAIISSFLVVTVRNPIYSVFSLIFAFVNAAGLFLLLGAEFVAMITLVVYVGAVIVFFLFIIMMLDIDIEVAEPRKKRGFLGSFFIGILAAELIVCASNFMVFSAEGELSRLVFKGNNVENIGKVLYTQYAYPLEISGFILLLSMIGAIVLMLRHRRDIKRQDISKQLESNPDNSIVMVKVKSGKGI
MVMQSLFFYLFSFMAIISSFLVVTVRNPIYSVFSLIFAFVNAAGLFLLLGAEFVAMITLVVYVGAVIVFFLFIIMMLDIDIEVAEPRKKRGFLGSFFIGILAAELIVCASNFMVFSAEGELSRLVFKGNNVENIGKVLYTQYAYPLEISGFILLLSMIGAIVLMLRHRRDIKRQDISKQLESNPDNSIVMVKVKSGKGI
MVMQSLFFYLFSFMAIISSFLVVTVRNPIYSVFSLIFAFVNAAGLFLLLGAEFVAMITLVVYVGAVIVFFLFIIMMLDIDIEVAEPRKKRGFLGSFFIGILAAELIVCASNFMVFSAEGELSRLVFKGNNVENIGKVLYTQYAYPLEISGFILLLSMIGAIVLMLRHRRDIKRQDISKQLESNPDNSIVMVKVKSGKGI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target199 NADH dehydrogenase subunit J [Candidatus Liberibacter a
315122716148 NADH dehydrogenase subunit J [Candidatus Liberibacter s 1 8e-60
150396122222 NADH dehydrogenase subunit J [Sinorhizobium medicae WSM 1 3e-46
222085586204 NADH-ubiquinone oxidoreductase chain J protein [Agrobac 1 5e-46
222148284204 NADH dehydrogenase subunit J [Agrobacterium vitis S4] L 1 1e-45
15965028204 NADH dehydrogenase subunit J [Sinorhizobium meliloti 10 1 2e-45
163759531204 NADH dehydrogenase subunit J [Hoeflea phototrophica DFL 1 1e-44
227821628204 NADH dehydrogenase subunit J [Sinorhizobium fredii NGR2 1 2e-44
15888608204 NADH dehydrogenase subunit J [Agrobacterium tumefaciens 1 6e-44
209548873204 NADH dehydrogenase subunit J [Rhizobium leguminosarum b 1 7e-44
116251476204 NADH dehydrogenase subunit J [Rhizobium leguminosarum b 1 7e-44
>gi|315122716|ref|YP_004063205.1| NADH dehydrogenase subunit J [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 148 Back     alignment and organism information
 Score =  233 bits (595), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 115/144 (79%), Positives = 130/144 (90%)

Query: 56  MITLVVYVGAVIVFFLFIIMMLDIDIEVAEPRKKRGFLGSFFIGILAAELIVCASNFMVF 115
           MITLVVYVGAVIV FLFIIMMLDID+E A+PR+ R FLG+FFIGILAAEL VCASN +VF
Sbjct: 1   MITLVVYVGAVIVLFLFIIMMLDIDVEEAKPRRNRPFLGAFFIGILAAELFVCASNLLVF 60

Query: 116 SAEGELSRLVFKGNNVENIGKVLYTQYAYPLEISGFILLLSMIGAIVLMLRHRRDIKRQD 175
             EGE+SRLVF+GNN E+IG+VLYT+Y YPLEISGFILLLSMIGAIVLMLRHR  IKRQ+
Sbjct: 61  GLEGEVSRLVFRGNNTEDIGEVLYTKYIYPLEISGFILLLSMIGAIVLMLRHRPGIKRQN 120

Query: 176 ISKQLESNPDNSIVMVKVKSGKGI 199
           ISKQL+SNP NS+ +VKVKSG+GI
Sbjct: 121 ISKQLKSNPGNSVTVVKVKSGEGI 144


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150396122|ref|YP_001326589.1| NADH dehydrogenase subunit J [Sinorhizobium medicae WSM419] Length = 222 Back     alignment and organism information
>gi|222085586|ref|YP_002544116.1| NADH-ubiquinone oxidoreductase chain J protein [Agrobacterium radiobacter K84] Length = 204 Back     alignment and organism information
>gi|222148284|ref|YP_002549241.1| NADH dehydrogenase subunit J [Agrobacterium vitis S4] Length = 204 Back     alignment and organism information
>gi|15965028|ref|NP_385381.1| NADH dehydrogenase subunit J [Sinorhizobium meliloti 1021] Length = 204 Back     alignment and organism information
>gi|163759531|ref|ZP_02166616.1| NADH dehydrogenase subunit J [Hoeflea phototrophica DFL-43] Length = 204 Back     alignment and organism information
>gi|227821628|ref|YP_002825598.1| NADH dehydrogenase subunit J [Sinorhizobium fredii NGR234] Length = 204 Back     alignment and organism information
>gi|15888608|ref|NP_354289.1| NADH dehydrogenase subunit J [Agrobacterium tumefaciens str. C58] Length = 204 Back     alignment and organism information
>gi|209548873|ref|YP_002280790.1| NADH dehydrogenase subunit J [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 204 Back     alignment and organism information
>gi|116251476|ref|YP_767314.1| NADH dehydrogenase subunit J [Rhizobium leguminosarum bv. viciae 3841] Length = 204 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target199 NADH dehydrogenase subunit J [Candidatus Liberibacter a
PRK06638198 PRK06638, PRK06638, NADH:ubiquinone oxidoreductase subu 4e-42
COG0839166 COG0839, NuoJ, NADH:ubiquinone oxidoreductase subunit 6 3e-22
MTH00021188 MTH00021, ND6, NADH dehydrogenase subunit 6; Validated 9e-22
MTH00045162 MTH00045, ND6, NADH dehydrogenase subunit 6; Validated 0.002
MTH00057186 MTH00057, ND6, NADH dehydrogenase subunit 6; Provisiona 3e-30
MTH00213239 MTH00213, ND6, NADH dehydrogenase subunit 6; Provisiona 1e-10
PRK0643388 PRK06433, PRK06433, NADH dehydrogenase subunit J; Provi 1e-10
CHL00016182 CHL00016, ndhG, NADH dehydrogenase subunit 6 8e-10
pfam00499140 pfam00499, Oxidored_q3, NADH-ubiquinone/plastoquinone o 1e-07
MTH00213239 MTH00213, ND6, NADH dehydrogenase subunit 6; Provisiona 2e-05
>gnl|CDD|180642 PRK06638, PRK06638, NADH:ubiquinone oxidoreductase subunit J; Provisional Back     alignment and domain information
>gnl|CDD|31181 COG0839, NuoJ, NADH:ubiquinone oxidoreductase subunit 6 (chain J) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|177103 MTH00021, ND6, NADH dehydrogenase subunit 6; Validated Back     alignment and domain information
>gnl|CDD|177120 MTH00045, ND6, NADH dehydrogenase subunit 6; Validated Back     alignment and domain information
>gnl|CDD|177129 MTH00057, ND6, NADH dehydrogenase subunit 6; Provisional Back     alignment and domain information
>gnl|CDD|177256 MTH00213, ND6, NADH dehydrogenase subunit 6; Provisional Back     alignment and domain information
>gnl|CDD|180562 PRK06433, PRK06433, NADH dehydrogenase subunit J; Provisional Back     alignment and domain information
>gnl|CDD|176959 CHL00016, ndhG, NADH dehydrogenase subunit 6 Back     alignment and domain information
>gnl|CDD|144188 pfam00499, Oxidored_q3, NADH-ubiquinone/plastoquinone oxidoreductase chain 6 Back     alignment and domain information
>gnl|CDD|177256 MTH00213, ND6, NADH dehydrogenase subunit 6; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 199 NADH dehydrogenase subunit J [Candidatus Liberibacter a
PRK06638196 NADH dehydrogenase subunit J; Provisional 100.0
MTH00057184 ND6 NADH dehydrogenase subunit 6; Provisional 100.0
MTH00021187 ND6 NADH dehydrogenase subunit 6; Validated 100.0
MTH00045161 ND6 NADH dehydrogenase subunit 6; Validated 98.33
TIGR00940809 2a6301s01 monovalent cation:proton antiporter; InterPro 97.26
MTH00214162 ND6 NADH dehydrogenase subunit 6; Provisional 96.55
MTH00138173 ND6 NADH dehydrogenase subunit 6; Provisional 96.5
MTH00166164 ND6 NADH dehydrogenase subunit 6; Provisional 96.38
MTH00065172 ND6 NADH dehydrogenase subunit 6; Provisional 96.23
MTH00115174 ND6 NADH dehydrogenase subunit 6; Provisional 95.64
CHL00016177 ndhG NADH dehydrogenase subunit 6 100.0
COG0839166 NuoJ NADH:ubiquinone oxidoreductase subunit 6 (chain J) 100.0
MTH00213312 ND6 NADH dehydrogenase subunit 6; Provisional 100.0
pfam00499140 Oxidored_q3 NADH-ubiquinone/plastoquinone oxidoreductas 99.88
PRK12504178 putative monovalent cation/H+ antiporter subunit B; Rev 98.73
MTH00152168 ND6 NADH dehydrogenase subunit 6; Provisional 97.5
MTH00015155 ND6 NADH dehydrogenase subunit 6; Validated 96.99
MTH00212154 ND6 NADH dehydrogenase subunit 6; Provisional 91.13
PRK0643389 NADH dehydrogenase subunit J; Provisional 99.97
PRK12507 334 putative monovalent cation/H+ antiporter subunit B; Rev 98.42
PRK0837894 hypothetical protein; Provisional 98.3
PRK12645800 monovalent cation/H+ antiporter subunit A; Reviewed 98.15
PRK12647761 putative monovalent cation/H+ antiporter subunit A; Rev 98.14
PRK12646800 putative monovalent cation/H+ antiporter subunit A; Rev 98.05
PRK12644 968 putative monovalent cation/H+ antiporter subunit A; Rev 97.76
PRK12648 950 putative monovalent cation/H+ antiporter subunit A; Rev 97.7
PRK12650 969 putative monovalent cation/H+ antiporter subunit A; Rev 97.56
PRK12649800 putative monovalent cation/H+ antiporter subunit A; Rev 97.44
COG156387 Predicted subunit of the Multisubunit Na+/H+ antiporter 96.87
PRK0628080 hypothetical protein; Provisional 96.55
MTH00109175 ND6 NADH dehydrogenase subunit 6; Provisional 95.91
PRK05640151 putative monovalent cation/H+ antiporter subunit B; Rev 94.62
MTH00064151 ND6 NADH dehydrogenase subunit 6; Provisional 91.33
PRK0643972 NADH dehydrogenase subunit J; Provisional 97.76
>PRK06638 NADH dehydrogenase subunit J; Provisional Back     alignment and domain information
>MTH00057 ND6 NADH dehydrogenase subunit 6; Provisional Back     alignment and domain information
>MTH00021 ND6 NADH dehydrogenase subunit 6; Validated Back     alignment and domain information
>MTH00045 ND6 NADH dehydrogenase subunit 6; Validated Back     alignment and domain information
>TIGR00940 2a6301s01 monovalent cation:proton antiporter; InterPro: IPR005663 This family of proteins consists of bacterial multicomponent K+:H+ and Na+:H+ antiporters Back     alignment and domain information
>MTH00214 ND6 NADH dehydrogenase subunit 6; Provisional Back     alignment and domain information
>MTH00138 ND6 NADH dehydrogenase subunit 6; Provisional Back     alignment and domain information
>MTH00166 ND6 NADH dehydrogenase subunit 6; Provisional Back     alignment and domain information
>MTH00065 ND6 NADH dehydrogenase subunit 6; Provisional Back     alignment and domain information
>MTH00115 ND6 NADH dehydrogenase subunit 6; Provisional Back     alignment and domain information
>CHL00016 ndhG NADH dehydrogenase subunit 6 Back     alignment and domain information
>COG0839 NuoJ NADH:ubiquinone oxidoreductase subunit 6 (chain J) [Energy production and conversion] Back     alignment and domain information
>MTH00213 ND6 NADH dehydrogenase subunit 6; Provisional Back     alignment and domain information
>pfam00499 Oxidored_q3 NADH-ubiquinone/plastoquinone oxidoreductase chain 6 Back     alignment and domain information
>PRK12504 putative monovalent cation/H+ antiporter subunit B; Reviewed Back     alignment and domain information
>MTH00152 ND6 NADH dehydrogenase subunit 6; Provisional Back     alignment and domain information
>MTH00015 ND6 NADH dehydrogenase subunit 6; Validated Back     alignment and domain information
>MTH00212 ND6 NADH dehydrogenase subunit 6; Provisional Back     alignment and domain information
>PRK06433 NADH dehydrogenase subunit J; Provisional Back     alignment and domain information
>PRK12507 putative monovalent cation/H+ antiporter subunit B; Reviewed Back     alignment and domain information
>PRK08378 hypothetical protein; Provisional Back     alignment and domain information
>PRK12645 monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>PRK12647 putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>PRK12646 putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>PRK12644 putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>PRK12648 putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>PRK12650 putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>PRK12649 putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>COG1563 Predicted subunit of the Multisubunit Na+/H+ antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06280 hypothetical protein; Provisional Back     alignment and domain information
>MTH00109 ND6 NADH dehydrogenase subunit 6; Provisional Back     alignment and domain information
>PRK05640 putative monovalent cation/H+ antiporter subunit B; Reviewed Back     alignment and domain information
>MTH00064 ND6 NADH dehydrogenase subunit 6; Provisional Back     alignment and domain information
>PRK06439 NADH dehydrogenase subunit J; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00