254780864

254780864

NADH-ubiquinone oxidoreductase, chain 4L

GeneID in NCBI database:8209879Locus tag:CLIBASIA_03795
Protein GI in NCBI database:254780864Protein Accession:YP_003065277.1
Gene range:+(832000, 832206)Protein Length:68aa
Gene description:NADH-ubiquinone oxidoreductase, chain 4L
COG prediction:[C] NADH:ubiquinone oxidoreductase subunit 11 or 4L (chain K)
KEGG prediction:nuoK; NADH-ubiquinone oxidoreductase, chain 4L; K00340 NADH dehydrogenase I subunit K [EC:1.6.5.3]
SEED prediction:NADH-ubiquinone oxidoreductase chain K (EC 1.6.5.3)
Pathway involved in KEGG:Oxidative phosphorylation [PATH:las00190]
Subsystem involved in SEED:Respiratory Complex I
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------
MSIELMLLAVNLNMISFSAYMQDISGQIFSLFILLVAAAETSIGLAILVIFYRKCGSISVDDFNQMKG
cHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHcc
cHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHccc
MSIELMLLAVNLNMISFSAYMQDISGQIFSLFILLVAAAETSIGLAILVIFYRkcgsisvddfnqmkg
MSIELMLLAVNLNMISFSAYMQDISGQIFSLFILLVAAAETSIGLAILVIFYRKCGSISVDDFNQMKG
MSIELMLLAVNLNMISFSAYMQDISGQIFSLFILLVAAAETSIGLAILVIFYRKCGSISVDDFNQMKG
MSIELMLLAVNLNMISFSAYMQDISGQIFSLFILLVAAAETSIGLAILVIFYRKCGSISVDDFNQMKG
MSIELMLLAVNLNMISFSAYMQDISGQIFSLFILLVAAAETSIGLAILVIFYRKCGSISVDDFNQMKG
MSIELMLLAVNLNMISFSAYMQDISGQIFSLFILLVAAAETSIGLAILVIFYRKCGSISVDDFNQMK*
oooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
HHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
iiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
ooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
iiiiHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIELMLLAVNLNMISFSAYMQDISGQIFSLFILLVAAAETSIGLAILVIFYRKCGSISVDDFNQMKG
MSIELMLLAVNLNMISFSAYMQDISGQIFSLFILLVAAAETSIGLAILVIFYRKCGSISVDDFNQMKG
MSIELMLLAVNLNMISFSAYMQDISGQIFSLFILLVAAAETSIGLAILVIFYRKCGSISVDDFNQMKG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target68 NADH-ubiquinone oxidoreductase, chain 4L [Candidatus Li
254780535 247 3-ketoacyl-(acyl-carrier-protein) reductase [Candi 0.041
>gi|254780535|ref|YP_003064948.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 247 Back     alignment
 Score = 27.7 bits (60), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 35 LVAAAETSIGLAILVIFYRKCGSISVDDFNQMK 67
          LV  A  SIGLAI  I Y++  S+ +   +Q K
Sbjct: 10 LVTGASGSIGLAIAKILYKQGASVGLHGTSQEK 42

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target68 NADH-ubiquinone oxidoreductase, chain 4L [Candidatus Li
315122715102 NADH-ubiquinone oxidoreductase, chain 4L [Candidatus Li 1 2e-27
83592900102 NADH-ubiquinone oxidoreductase, chain 4L [Rhodospirillu 1 9e-21
157826243104 NADH dehydrogenase subunit K [Rickettsia akari str. Har 1 4e-20
239946838110 NADH-quinone oxidoreductase subunit K [Rickettsia endos 1 5e-20
157964939112 NADH dehydrogenase subunit K [Rickettsia massiliae MTU5 1 5e-20
91204901109 NADH dehydrogenase subunit K [Rickettsia bellii RML369- 1 6e-20
75535956110 RecName: Full=NADH-quinone oxidoreductase subunit K; Al 1 9e-20
162022117104 NADH dehydrogenase subunit K [Rickettsia felis URRWXCal 1 9e-20
157804160104 NADH dehydrogenase subunit K [Rickettsia canadensis str 1 2e-19
157829057104 NADH dehydrogenase subunit K [Rickettsia rickettsii str 1 2e-19
>gi|315122715|ref|YP_004063204.1| NADH-ubiquinone oxidoreductase, chain 4L [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 102 Back     alignment and organism information
 Score =  125 bits (313), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/68 (91%), Positives = 67/68 (98%)

Query: 1   MSIELMLLAVNLNMISFSAYMQDISGQIFSLFILLVAAAETSIGLAILVIFYRKCGSISV 60
           MSIE+MLLAVNLNMISFSAYMQDI+GQIFSLFIL+VAAAETSIGLAILV+FYRK GSISV
Sbjct: 35  MSIEIMLLAVNLNMISFSAYMQDIAGQIFSLFILVVAAAETSIGLAILVVFYRKRGSISV 94

Query: 61  DDFNQMKG 68
           DDFN+MKG
Sbjct: 95  DDFNRMKG 102


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|83592900|ref|YP_426652.1| NADH-ubiquinone oxidoreductase, chain 4L [Rhodospirillum rubrum ATCC 11170] Length = 102 Back     alignment and organism information
>gi|157826243|ref|YP_001493963.1| NADH dehydrogenase subunit K [Rickettsia akari str. Hartford] Length = 104 Back     alignment and organism information
>gi|239946838|ref|ZP_04698591.1| NADH-quinone oxidoreductase subunit K [Rickettsia endosymbiont of Ixodes scapularis] Length = 110 Back     alignment and organism information
>gi|157964939|ref|YP_001499763.1| NADH dehydrogenase subunit K [Rickettsia massiliae MTU5] Length = 112 Back     alignment and organism information
>gi|91204901|ref|YP_537256.1| NADH dehydrogenase subunit K [Rickettsia bellii RML369-C] Length = 109 Back     alignment and organism information
>gi|75535956|sp|Q4UK28|NUOK_RICFE RecName: Full=NADH-quinone oxidoreductase subunit K; AltName: Full=NADH dehydrogenase I subunit K; AltName: Full=NDH-1 subunit K Length = 110 Back     alignment and organism information
>gi|162022117|ref|YP_247272.2| NADH dehydrogenase subunit K [Rickettsia felis URRWXCal2] Length = 104 Back     alignment and organism information
>gi|157804160|ref|YP_001492709.1| NADH dehydrogenase subunit K [Rickettsia canadensis str. McKiel] Length = 104 Back     alignment and organism information
>gi|157829057|ref|YP_001495299.1| NADH dehydrogenase subunit K [Rickettsia rickettsii str. 'Sheila Smith'] Length = 104 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target68 NADH-ubiquinone oxidoreductase, chain 4L [Candidatus Li
PRK05715100 PRK05715, PRK05715, NADH:ubiquinone oxidoreductase subu 1e-20
CHL00015101 CHL00015, ndhE, NADH dehydrogenase subunit 4L 7e-12
MTH0018099 MTH00180, ND4L, NADH dehydrogenase subunit 4L; Provisio 2e-11
pfam0042096 pfam00420, Oxidored_q2, NADH-ubiquinone/plastoquinone o 1e-10
MTH0000199 MTH00001, ND4L, NADH dehydrogenase subunit 4L; Provisio 4e-08
MTH0019299 MTH00192, ND4L, NADH dehydrogenase subunit 4L; Provisio 2e-07
KOG4669100 KOG4669, KOG4669, KOG4669, NADH dehydrogenase subunit 4 3e-05
COG0713100 COG0713, NuoK, NADH:ubiquinone oxidoreductase subunit 1 2e-14
>gnl|CDD|180218 PRK05715, PRK05715, NADH:ubiquinone oxidoreductase subunit K; Validated Back     alignment and domain information
>gnl|CDD|176958 CHL00015, ndhE, NADH dehydrogenase subunit 4L Back     alignment and domain information
>gnl|CDD|177231 MTH00180, ND4L, NADH dehydrogenase subunit 4L; Provisional Back     alignment and domain information
>gnl|CDD|144131 pfam00420, Oxidored_q2, NADH-ubiquinone/plastoquinone oxidoreductase chain 4L Back     alignment and domain information
>gnl|CDD|177099 MTH00001, ND4L, NADH dehydrogenase subunit 4L; Provisional Back     alignment and domain information
>gnl|CDD|177240 MTH00192, ND4L, NADH dehydrogenase subunit 4L; Provisional Back     alignment and domain information
>gnl|CDD|39868 KOG4669, KOG4669, KOG4669, NADH dehydrogenase subunit 4L and related proteins [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|31057 COG0713, NuoK, NADH:ubiquinone oxidoreductase subunit 11 or 4L (chain K) [Energy production and conversion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 68 NADH-ubiquinone oxidoreductase, chain 4L [Candidatus Li
MTH0018099 ND4L NADH dehydrogenase subunit 4L; Provisional 99.96
MTH0019299 ND4L NADH dehydrogenase subunit 4L; Provisional 99.96
COG0713100 NuoK NADH:ubiquinone oxidoreductase subunit 11 or 4L (c 99.96
MTH0000197 ND4L NADH dehydrogenase subunit 4L; Provisional 99.96
PRK0571599 NADH dehydrogenase subunit K; Validated 99.95
CHL00015101 ndhE NADH dehydrogenase subunit 4L 99.95
pfam0042096 Oxidored_q2 NADH-ubiquinone/plastoquinone oxidoreductas 99.83
KOG4669100 consensus 99.69
MTH0004397 ND4L NADH dehydrogenase subunit 4L; Validated 99.44
MTH0012598 ND4L NADH dehydrogenase subunit 4L; Provisional 99.44
MTH0006798 ND4L NADH dehydrogenase subunit 4L; Provisional 99.35
MTH0012698 ND4L NADH dehydrogenase subunit 4L; Provisional 99.24
MTH0010798 ND4L NADH dehydrogenase subunit 4L; Provisional 99.1
MTH0018195 ND4L NADH dehydrogenase subunit 4L; Provisional 98.89
PRK08388117 putative monovalent cation/H+ antiporter subunit C; Rev 98.66
PRK08389111 putative monovalent cation/H+ antiporter subunit C; Rev 98.52
MTH0001397 ND4L NADH dehydrogenase subunit 4L; Validated 98.35
MTH0016295 ND4L NADH dehydrogenase subunit 4L; Provisional 98.21
MTH0014998 ND4L NADH dehydrogenase subunit 4L; Provisional 98.16
MTH0018898 ND4L NADH dehydrogenase subunit 4L; Provisional 98.14
PRK12661142 putative monovalent cation/H+ antiporter subunit C; Rev 97.94
PRK07375112 putative monovalent cation/H+ antiporter subunit C; Rev 97.81
PRK12660114 putative monovalent cation/H+ antiporter subunit C; Rev 97.56
PRK12659119 putative monovalent cation/H+ antiporter subunit C; Rev 97.49
PRK08600113 putative monovalent cation/H+ antiporter subunit C; Rev 97.42
PRK12658125 putative monovalent cation/H+ antiporter subunit C; Rev 97.24
COG1006115 MnhC Multisubunit Na+/H+ antiporter, MnhC subunit [Inor 96.65
PRK09094115 putative monovalent cation/H+ antiporter subunit C; Rev 96.03
>MTH00180 ND4L NADH dehydrogenase subunit 4L; Provisional Back     alignment and domain information
>MTH00192 ND4L NADH dehydrogenase subunit 4L; Provisional Back     alignment and domain information
>COG0713 NuoK NADH:ubiquinone oxidoreductase subunit 11 or 4L (chain K) [Energy production and conversion] Back     alignment and domain information
>MTH00001 ND4L NADH dehydrogenase subunit 4L; Provisional Back     alignment and domain information
>PRK05715 NADH dehydrogenase subunit K; Validated Back     alignment and domain information
>CHL00015 ndhE NADH dehydrogenase subunit 4L Back     alignment and domain information
>pfam00420 Oxidored_q2 NADH-ubiquinone/plastoquinone oxidoreductase chain 4L Back     alignment and domain information
>KOG4669 consensus Back     alignment and domain information
>MTH00043 ND4L NADH dehydrogenase subunit 4L; Validated Back     alignment and domain information
>MTH00125 ND4L NADH dehydrogenase subunit 4L; Provisional Back     alignment and domain information
>MTH00067 ND4L NADH dehydrogenase subunit 4L; Provisional Back     alignment and domain information
>MTH00126 ND4L NADH dehydrogenase subunit 4L; Provisional Back     alignment and domain information
>MTH00107 ND4L NADH dehydrogenase subunit 4L; Provisional Back     alignment and domain information
>MTH00181 ND4L NADH dehydrogenase subunit 4L; Provisional Back     alignment and domain information
>PRK08388 putative monovalent cation/H+ antiporter subunit C; Reviewed Back     alignment and domain information
>PRK08389 putative monovalent cation/H+ antiporter subunit C; Reviewed Back     alignment and domain information
>MTH00013 ND4L NADH dehydrogenase subunit 4L; Validated Back     alignment and domain information
>MTH00162 ND4L NADH dehydrogenase subunit 4L; Provisional Back     alignment and domain information
>MTH00149 ND4L NADH dehydrogenase subunit 4L; Provisional Back     alignment and domain information
>MTH00188 ND4L NADH dehydrogenase subunit 4L; Provisional Back     alignment and domain information
>PRK12661 putative monovalent cation/H+ antiporter subunit C; Reviewed Back     alignment and domain information
>PRK07375 putative monovalent cation/H+ antiporter subunit C; Reviewed Back     alignment and domain information
>PRK12660 putative monovalent cation/H+ antiporter subunit C; Reviewed Back     alignment and domain information
>PRK12659 putative monovalent cation/H+ antiporter subunit C; Reviewed Back     alignment and domain information
>PRK08600 putative monovalent cation/H+ antiporter subunit C; Reviewed Back     alignment and domain information
>PRK12658 putative monovalent cation/H+ antiporter subunit C; Reviewed Back     alignment and domain information
>COG1006 MnhC Multisubunit Na+/H+ antiporter, MnhC subunit [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09094 putative monovalent cation/H+ antiporter subunit C; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00