254780865

254780865

NADH dehydrogenase subunit L

GeneID in NCBI database:8209880Locus tag:CLIBASIA_03800
Protein GI in NCBI database:254780865Protein Accession:YP_003065278.1
Gene range:+(832208, 834208)Protein Length:666aa
Gene description:NADH dehydrogenase subunit L
COG prediction:[C] [P] NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunit
KEGG prediction:nuoL; NADH dehydrogenase subunit L; K00341 NADH dehydrogenase I subunit L [EC:1.6.5.3]
SEED prediction:NADH-ubiquinone oxidoreductase chain L (EC 1.6.5.3)
Pathway involved in KEGG:Oxidative phosphorylation [PATH:las00190]
Subsystem involved in SEED:Respiratory Complex I
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM16 TM-Helix
TOPPRED16 TM-Helix
HMMTOP17 TM-Helix
MEMSAT16 TM-Helix
MEMSAT_SVM16 TM-Helix
PHOBIUS16 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660------
MAMIYEVIVFLPLIGAVFSGFFGRLMGKQFADIFTSLLMVIGAFLSWYVFYEIGFGHDVQVVKREIFPWIIFDGLDIPWGLRIDTLSSVMFVVVNSISAVVHIYSIGYMHDDPHRPRFFSYLSFFTFAMLVLVSSDNLLQMFFGWEGVGLASYLLIGFWSFKESAIKASMKAFVVNRIGDLGLILAISAIIYLFHSVDFDAVFQNASHYWKIGNSVSSGMVSHRSFSFFGIDVHPHDSIAIICLLFFLGAMGKSAQLLLHVWLPDAMEGPTPVSALIHAATMVTAGVFLVARMSPLFELSPFVLDCITVLGCITAFFAATVGLVQHDIKRVIAYSTCSQLGYMFVALGCRAYGASIFHLFTHAFFKALLFLGSGSVIHAVAGEQDMRRMGGLYPHLPRTCWMMIVGTLALTGFGIPETSIGFSGFFSKDIILEVAYTSSHFTFVFFLLLFAAFLTSFYSWRLMFLTFFGKMRVDKDISHKIHESPLVMQIPLFILAIGSIFFGFIFHDVFFGSAYSSFWKGALFASSSNNVLERYHEVPLWVEYSSFIAFFVGFFSAFLMYIICPSLPKFLSEKCRFFYCFLQNAWYFDRIYDCLLVRPIVRLATILWKRVDLSIDKYGPGGIVACVRYLSSYSSRLQTGYLDHYAFSMLIGISILVIVMLLQGNI
ccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccccccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHcccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcccc
ccccHHHcccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccccccccHHHHHHcccccHHHHHHHEEEccEEEEEEccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHHcHHHHHHccccccccHHHHHHHHHHHHHHcccccHHHcccccEEccccHHHHHHHHHHHHHHccccHHHccccccccccHHccccccHHHHHHHHHHHHHHHHcHHcccHHHHccccHcccccHHHHHHHHHHHHHHcHHHHHccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccHHHHHHHHEEEcccccccccccccccccHHHHHcccHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHcccccHHHHHcccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEccccccEcccccccHHHEHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccc
MAMIYEVIVFLPLIGAVFSGFFGRLMGKQFADIFTSLLMVIGAFLSWYVFYEIGFGHDVQVVKREIFpwiifdgldipwglridtLSSVMFVVVNSISAVVHIYSIgymhddphrprffsyLSFFTFAMLVLVSSDNLLQMFFGWEGVGLASYLLIGFWSFKESAIKASMKAFVVNRIGDLGLILAISAIIYLFHSVDFDAVFQNASHYWKignsvssgmvshrsfsffgidvhphdSIAIICLLFFLGAMGKSAQLLLHVWlpdamegptpvSALIHAATMVTAGVFLVARmsplfelspfvLDCITVLGCITAFFAATVGLVQHDIKRVIAYSTCSQLGYMFVALGCRAYGASIFHLFTHAFFKALLFLGSGSVIHAVAgeqdmrrmgglyphlprtcWMMIVGTLaltgfgipetsigfsgffsKDIILEVAYTSSHFTFVFFLLLFAAFLTSFYSWRLMFLTFFGKmrvdkdishkihesplvmqiPLFILAIGSIffgfifhdvffgsayssfWKGALFASSSNNVLERYHEVPLWVEYSSFIAFFVGFFSAFLMYIIcpslpkflseKCRFFYCFLQNAWYFDRIYDCLLVRPIVRLATILWKRVDlsidkygpggIVACVRYLSSYSsrlqtgyldhYAFSMLIGISILVIVMLLQGNI
MAMIYEVIVFLPLIGAVFSGFFGRLMGKQFADIFTSLLMVIGAFLSWYVFYEIGFGHDVQVVKREIFPWIIFDGLDIPWGLRIDTLSSVMFVVVNSISAVVHIYSIGYMHDDPHRPRFFSYLSFFTFAMLVLVSSDNLLQMFFGWEGVGLASYLLIGFWSFKESAIKASMKAFVVNRIGDLGLILAISAIIYLFHSVDFDAVFQNASHYWKIGNSVSSGMVSHRSFSFFGIDVHPHDSIAIICLLFFLGAMGKSAQLLLHVWLPDAMEGPTPVSALIHAATMVTAGVFLVARMSPLFELSPFVLDCITVLGCITAFFAATVGLVQHDIKRVIAYSTCSQLGYMFVALGCRAYGASIFHLFTHAFFKALLFLGSGSVIHAVAGEQDMRRMGGLYPHLPRTCWMMIVGTLALTGFGIPETSIGFSGFFSKDIILEVAYTSSHFTFVFFLLLFAAFLTSFYSWRLMFLTFFGKMRVDKDISHKIHESPLVMQIPLFILAIGSIFFGFIFHDVFFGSAYSSFWKGALFASSSNNVLERYHEVPLWVEYSSFIAFFVGFFSAFLMYIICPSLPKFLSEKCRFFYCFLQNAWYFDRIYDCLLVRPIVRLATILWKRVDLSIDKYGPGGIVACVRYLSSYSSRLQTGYLDHYAFSMLIGISILVIVMLLQGNI
MAMIYEVIVFLPLIGAVFSGFFGRLMGKQFADIFTSLLMVIGAFLSWYVFYEIGFGHDVQVVKREIFPWIIFDGLDIPWGLRIDTLSSVMFVVVNSISAVVHIYSIGYMHDDPHRPRFFSYLSFFTFAMLVLVSSDNLLQMFFGWEGVGLASYLLIGFWSFKESAIKASMKAFVVNRIGDLGLILAISAIIYLFHSVDFDAVFQNASHYWKIGNSVSSGMVSHRSFSFFGIDVHPHDSIAIICLLFFLGAMGKSAQLLLHVWLPDAMEGPTPVSALIHAATMVTAGVFLVARMSPLFELSPFVLDCITVLGCITAFFAATVGLVQHDIKRVIAYSTCSQLGYMFVALGCRAYGASIFHLFTHAFFKALLFLGSGSVIHAVAGEQDMRRMGGLYPHLPRTCWMMIVGTLALTGFGIPETSIGFSGFFSKDIILEVAYtsshftfvfflllfaafltsfYSWRLMFLTFFGKMRVDKDISHKIHESPLVMQIPLFILAIGSiffgfifhdvffgSAYSSFWKGALFASSSNNVLERYHEVPLWVEYssfiaffvgffsafLMYIICPSLPKFLSEKCRFFYCFLQNAWYFDRIYDCLLVRPIVRLATILWKRVDLSIDKYGPGGIVACVRYLSSYSSRLQTGYLDHYAFSMLIGISILVIVMLLQGNI
*AMIYEVIVFLPLIGAVFSGFFGRLMGKQFADIFTSLLMVIGAFLSWYVFYEIGFGHDVQVVKREIFPWIIFDGLDIPWGLRIDTLSSVMFVVVNSISAVVHIYSIGYMHDDPHRPRFFSYLSFFTFAMLVLVSSDNLLQMFFGWEGVGLASYLLIGFWSFKESAIKASMKAFVVNRIGDLGLILAISAIIYLFHSVDFDAVFQNASHYWKIGNSVSSGMVSHRSFSFFGIDVHPHDSIAIICLLFFLGAMGKSAQLLLHVWLPDAMEGPTPVSALIHAATMVTAGVFLVARMSPLFELSPFVLDCITVLGCITAFFAATVGLVQHDIKRVIAYSTCSQLGYMFVALGCRAYGASIFHLFTHAFFKALLFLGSGSVIHAVAGEQDMRRMGGLYPHLPRTCWMMIVGTLALTGFGIPETSIGFSGFFSKDIILEVAYTSSHFTFVFFLLLFAAFLTSFYSWRLMFLTFFGKMRVDKD**HKIHESPLVMQIPLFILAIGSIFFGFIFHDVFFGSAYSSFWKGALFASSSNNVLERYHEVPLWVEYSSFIAFFVGFFSAFLMYIICPSLPKFLSEKCRFFYCFLQNAWYFDRIYDCLLVRPIVRLATILWKRVDLSIDKYGPGGIVACVRYLSSYSSRLQTGYLDHYAFSMLIGISILVIVMLLQGNI
MAMIYEVIVFLPLIGAVFSGFFGRLMGKQFADIFTSLLMVIGAFLSWYVFYEIGFGHDVQVVKREIFPWIIFDGLDIPWGLRIDTLSSVMFVVVNSISAVVHIYSIGYMHDDPHRPRFFSYLSFFTFAMLVLVSSDNLLQMFFGWEGVGLASYLLIGFWSFKESAIKASMKAFVVNRIGDLGLILAISAIIYLFHSVDFDAVFQNASHYWKIGNSVSSGMVSHRSFSFFGIDVHPHDSIAIICLLFFLGAMGKSAQLLLHVWLPDAMEGPTPVSALIHAATMVTAGVFLVARMSPLFELSPFVLDCITVLGCITAFFAATVGLVQHDIKRVIAYSTCSQLGYMFVALGCRAYGASIFHLFTHAFFKALLFLGSGSVIHAVAGEQDMRRMGGLYPHLPRTCWMMIVGTLALTGFGIPETSIGFSGFFSKDIILEVAYTSSHFTFVFFLLLFAAFLTSFYSWRLMFLTFFGKMRVDKDISHKIHESPLVMQIPLFILAIGSIFFGFIFHDVFFGSAYSSFWKGALFASSSNNVLERYHEVPLWVEYSSFIAFFVGFFSAFLMYIICPSLPKFLSEKCRFFYCFLQNAWYFDRIYDCLLVRPIVRLATILWKRVDLSIDKYGPGGIVACVRYLSSYSSRLQTGYLDHYAFSMLIGISILVIVMLLQGNI
*AMIYEVIVFLPLIGAVFSGFFGRLMGKQFADIFTSLLMVIGAFLSWYVFYEIGFGHDVQVVKREIFPWIIFDGLDIPWGLRIDTLSSVMFVVVNSISAVVHIYSIGYMHDDPHRPRFFSYLSFFTFAMLVLVSSDNLLQMFFGWEGVGLASYLLIGFWSFKESAIKASMKAFVVNRIGDLGLILAISAIIYLFHSVDFDAVFQNASHYWKIGNSVSSGMVSHRSFSFFGIDVHPHDSIAIICLLFFLGAMGKSAQLLLHVWLPDAMEGPTPVSALIHAATMVTAGVFLVARMSPLFELSPFVLDCITVLGCITAFFAATVGLVQHDIKRVIAYSTCSQLGYMFVALGCRAYGASIFHLFTHAFFKALLFLGSGSVIHAVAGEQDMRRMGGLYPHLPRTCWMMIVGTLALTGFGIPETSIGFSGFFSKDIILEVAYTSSHFTFVFFLLLFAAFLTSFYSWRLMFLTFFGKMRVDKDISHKIHESPLVMQIPLFILAIGSIFFGFIFHDVFFGSAYSSFWKGALFASSSNNVLERYHEVPLWVEYSSFIAFFVGFFSAFLMYIICPSLPKFLSEKCRFFYCFLQNAWYFDRIYDCLLVRPIVRLATILWKRVDLSIDKYGPGGIVACVRYLSSYSSRLQTGYLDHYAFSMLIGISILVIVMLLQGNI
oooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoo
xxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxx
ooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiii
ooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooo
oooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooo
oooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAMIYEVIVFLPLIGAVFSGFFGRLMGKQFADIFTSLLMVIGAFLSWYVFYEIGFGHDVQVVKREIFPWIIFDGLDIPWGLRIDTLSSVMFVVVNSISAVVHIYSIGYMHDDPHRPRFFSYLSFFTFAMLVLVSSDNLLQMFFGWEGVGLASYLLIGFWSFKESAIKASMKAFVVNRIGDLGLILAISAIIYLFHSVDFDAVFQNASHYWKIGNSVSSGMVSHRSFSFFGIDVHPHDSIAIICLLFFLGAMGKSAQLLLHVWLPDAMEGPTPVSALIHAATMVTAGVFLVARMSPLFELSPFVLDCITVLGCITAFFAATVGLVQHDIKRVIAYSTCSQLGYMFVALGCRAYGASIFHLFTHAFFKALLFLGSGSVIHAVAGEQDMRRMGGLYPHLPRTCWMMIVGTLALTGFGIPETSIGFSGFFSKDIILEVAYTSSHFTFVFFLLLFAAFLTSFYSWRLMFLTFFGKMRVDKDISHKIHESPLVMQIPLFILAIGSIFFGFIFHDVFFGSAYSSFWKGALFASSSNNVLERYHEVPLWVEYSSFIAFFVGFFSAFLMYIICPSLPKFLSEKCRFFYCFLQNAWYFDRIYDCLLVRPIVRLATILWKRVDLSIDKYGPGGIVACVRYLSSYSSRLQTGYLDHYAFSMLIGISILVIVMLLQGNI
MAMIYEVIVFLPLIGAVFSGFFGRLMGKQFADIFTSLLMVIGAFLSWYVFYEIGFGHDVQVVKREIFPWIIFDGLDIPWGLRIDTLSSVMFVVVNSISAVVHIYSIGYMHDDPHRPRFFSYLSFFTFAMLVLVSSDNLLQMFFGWEGVGLASYLLIGFWSFKESAIKASMKAFVVNRIGDLGLILAISAIIYLFHSVDFDAVFQNASHYWKIGNSVSSGMVSHRSFSFFGIDVHPHDSIAIICLLFFLGAMGKSAQLLLHVWLPDAMEGPTPVSALIHAATMVTAGVFLVARMSPLFELSPFVLDCITVLGCITAFFAATVGLVQHDIKRVIAYSTCSQLGYMFVALGCRAYGASIFHLFTHAFFKALLFLGSGSVIHAVAGEQDMRRMGGLYPHLPRTCWMMIVGTLALTGFGIPETSIGFSGFFSKDIILEVAYTSSHFTFVFFLLLFAAFLTSFYSWRLMFLTFFGKMRVDKDISHKIHESPLVMQIPLFILAIGSIFFGFIFHDVFFGSAYSSFWKGALFASSSNNVLERYHEVPLWVEYSSFIAFFVGFFSAFLMYIICPSLPKFLSEKCRFFYCFLQNAWYFDRIYDCLLVRPIVRLATILWKRVDLSIDKYGPGGIVACVRYLSSYSSRLQTGYLDHYAFSMLIGISILVIVMLLQGNI
MAMIYEVIVFLPLIGAVFSGFFGRLMGKQFADIFTSLLMVIGAFLSWYVFYEIGFGHDVQVVKREIFPWIIFDGLDIPWGLRIDTLSSVMFVVVNSISAVVHIYSIGYMHDDPHRPRFFSYLSFFTFAMLVLVSSDNLLQMFFGWEGVGLASYLLIGFWSFKESAIKASMKAFVVNRIGDLGLILAISAIIYLFHSVDFDAVFQNASHYWKIGNSVSSGMVSHRSFSFFGIDVHPHDSIAIICLLFFLGAMGKSAQLLLHVWLPDAMEGPTPVSALIHAATMVTAGVFLVARMSPLFELSPFVLDCITVLGCITAFFAATVGLVQHDIKRVIAYSTCSQLGYMFVALGCRAYGASIFHLFTHAFFKALLFLGSGSVIHAVAGEQDMRRMGGLYPHLPRTCWMMIVGTLALTGFGIPETSIGFSGFFSKDIILEVAYTSSHFTFVFFLLLFAAFLTSFYSWRLMFLTFFGKMRVDKDISHKIHESPLVMQIPLFILAIGSIFFGFIFHDVFFGSAYSSFWKGALFASSSNNVLERYHEVPLWVEYSSFIAFFVGFFSAFLMYIICPSLPKFLSEKCRFFYCFLQNAWYFDRIYDCLLVRPIVRLATILWKRVDLSIDKYGPGGIVACVRYLSSYSSRLQTGYLDHYAFSMLIGISILVIVMLLQGNI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target666 NADH dehydrogenase subunit L [Candidatus Liberibacter a
254780866499 NADH dehydrogenase subunit M [Candidatus Liberibac 6e-17
254780867478 NADH dehydrogenase subunit N [Candidatus Liberibac 2e-09
>gi|254780866|ref|YP_003065279.1| NADH dehydrogenase subunit M [Candidatus Liberibacter asiaticus str. psy62] Length = 499 Back     alignment
 Score = 80.9 bits (198), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 126/249 (50%), Gaps = 16/249 (6%)

Query: 260 HVWLPDA-MEGPTPVSALIHAATMVTAGVFLVARMSPLFEL-SPFVLDCITVLGCITAFF 317
           H WLP+A ++ PT  S  +    +   G   +  + PLF L S +    I  L  I   +
Sbjct: 229 HTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIY 288

Query: 318 AATVGLVQHDIKRVIAYSTCSQLGYMFVAL--GCRA-YGASIFHLFTHAFFKALLFLGSG 374
           A+ V +VQ DIK++IAYS+ + +GY+ + +  G ++    ++F + +H    + LF   G
Sbjct: 289 ASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVG 348

Query: 375 SVIHAVAGEQDMRRMGGLYPHLPRTCWMMIVGTLALTGFGIPETSIGFSGFFSKDIILEV 434
            VI+     +D+   GGL  ++PR   +M+V T+A    G+P T    SGF  + +++  
Sbjct: 349 -VIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMA--NMGLPGT----SGFIGEFLVIMS 401

Query: 435 AYTSSHFTFVFFLLLFAAFLTSFYSWRLMFLTFFGKMRVDKDISHKIHESPLVMQIPLFI 494
            + +S+   V  L  F   L++ YS  L     FG  + +K    ++ +  L  +  ++ 
Sbjct: 402 VFQNSNTVAV--LASFGVVLSALYSLWLYRKVVFGVSKCEK--VQQLKDLSLRERCMVYP 457

Query: 495 LAIGSIFFG 503
           +A+ ++FFG
Sbjct: 458 IAVLTVFFG 466

>gi|254780867|ref|YP_003065280.1| NADH dehydrogenase subunit N [Candidatus Liberibacter asiaticus str. psy62] Length = 478 Back     alignment
 Score = 56.2 bits (134), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 81/354 (22%), Positives = 158/354 (44%), Gaps = 49/354 (13%)

Query: 128 AMLVLVSSDNLLQMFFGWEGVGLASYLLIGFWSFKESAIKASMKAFVVNRIGDLGLILAI 187
            ML ++S+++++  +   E    A Y+LI        +I+A++K FV+            
Sbjct: 118 GMLCMISANDMISFYMSLELQSFALYVLIAMNRKSVFSIEAALKYFVLGAFSS------- 170

Query: 188 SAIIYLFHSVDFDAVFQNASHYWKIGNSVSSGMVSHRSFSFFGIDVHPHDSIAIICLLFF 247
               +L + + F   F   + + +I  S+  G   HRSF      V     + I+  LFF
Sbjct: 171 ---AFLLYGISFIYGFTGCTGFSQIATSLFIG---HRSF------VLIVGVVLILVGLFF 218

Query: 248 LGAMGKSAQLLLHVWLPDAMEGPTPVSALIHAATMVT-AGVFLVARMSPLFELSPFVLDC 306
                K A +  H+W+PD  EG +P+      AT+   A    + R++ +F   P +   
Sbjct: 219 -----KMALVPFHMWIPDVYEG-SPMFMTAFLATIPKFATTMALCRITSVFW--PMLSGL 270

Query: 307 ITVLGCI---TAFFAATVGLVQHDIKRVIAYSTCSQLGYMFVALGCRAYGASIFHLFTHA 363
           + +  C+   +    + V + Q D+KR++AYS+    GY  +       G  I  +  + 
Sbjct: 271 LPIFMCVSIGSMVLGSVVAIRQKDLKRLMAYSSIGHAGYALIGFSTGMLG--IVAMVRYM 328

Query: 364 FFKALLFLGSGSVIHAVAGE-----QDMRRMGGLYPH-LPRTCWMMI-VGTLALTGFGIP 416
               ++ +G  S I ++  +     Q++  + GL    +  TC + I + +LA    GIP
Sbjct: 329 VIYLIMMIGFFSCILSLRRKDGNNIQNISDLAGLSRQDIFLTCALTIFLFSLA----GIP 384

Query: 417 ETSIGFSGFFSKDIILEVAYTSSHFTFVFFLLLFAAFLTSFYSWRLMFLTFFGK 470
                F+GFF K  +L ++     F  +  + L ++ ++++Y  R++ + +F +
Sbjct: 385 P----FAGFFGKYFLL-ISAVKREFYVLAIVALLSSVISAYYYLRVISIMWFDQ 433

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target666 NADH dehydrogenase subunit L [Candidatus Liberibacter a
315122714660 NADH dehydrogenase subunit L [Candidatus Liberibacter s 1 0.0
222148286663 NADH dehydrogenase subunit L [Agrobacterium vitis S4] L 1 0.0
15888610665 NADH dehydrogenase subunit L [Agrobacterium tumefaciens 1 0.0
190891298666 NADH-ubiquinone oxidoreductase, chain L [Rhizobium etli 1 0.0
116251478666 NADH dehydrogenase subunit L [Rhizobium leguminosarum b 1 0.0
241204099666 NADH dehydrogenase subunit L [Rhizobium leguminosarum b 1 0.0
325292645665 NADH dehydrogenase I chain L [Agrobacterium sp. H13-3] 1 0.0
327188499666 NADH-ubiquinone oxidoreductase protein, chain L [Rhizob 1 0.0
209548875666 NADH dehydrogenase subunit L [Rhizobium leguminosarum b 1 0.0
15965030664 NADH dehydrogenase subunit L [Sinorhizobium meliloti 10 1 0.0
>gi|315122714|ref|YP_004063203.1| NADH dehydrogenase subunit L [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 660 Back     alignment and organism information
 Score = 1017 bits (2630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/664 (78%), Positives = 575/664 (86%), Gaps = 4/664 (0%)

Query: 3   MIYEVIVFLPLIGAVFSGFFGRLMGKQFADIFTSLLMVIGAFLSWYVFYEIGFGHDVQVV 62
           MIYE IVFLPL+GAV SGFFGRLM ++  +IFTS+LMVI A LSW+VFYE+GF  +  VV
Sbjct: 1   MIYEAIVFLPLVGAVVSGFFGRLMREKLPEIFTSVLMVIVALLSWWVFYEVGFS-NFTVV 59

Query: 63  KREIFPWIIFDGLDIPWGLRIDTLSSVMFVVVNSISAVVHIYSIGYMHDDPHRPRFFSYL 122
           K EIF WI   GLD+ WGLRIDTLSSVMFVV+NSISAVVHIYSIGYMHDDPHR RFFSYL
Sbjct: 60  KYEIFHWIKSSGLDVSWGLRIDTLSSVMFVVINSISAVVHIYSIGYMHDDPHRRRFFSYL 119

Query: 123 SFFTFAMLVLVSSDNLLQMFFGWEGVGLASYLLIGFWSFKESAIKASMKAFVVNRIGDLG 182
           S FTFAMLVLVSSDN LQ+FFGWEGVGLASYLLIGFWSFKESA+KASMKAFVVNRIGD G
Sbjct: 120 SLFTFAMLVLVSSDNFLQIFFGWEGVGLASYLLIGFWSFKESALKASMKAFVVNRIGDCG 179

Query: 183 LILAISAIIYLFHSVDFDAVFQNASHYWKIGNSVSSGMVSHRSFSFFGIDVHPHDSIAII 242
           LILAISAI+YLF SVDFD VF  A+ Y+  GN V +   +H++ + FGI++H HD+IAII
Sbjct: 180 LILAISAIVYLFQSVDFDIVFNKATQYFTHGNLVGT---THKALAPFGIEIHRHDAIAII 236

Query: 243 CLLFFLGAMGKSAQLLLHVWLPDAMEGPTPVSALIHAATMVTAGVFLVARMSPLFELSPF 302
           C L FLGAMGKSAQ LLHVWLPDAMEGPTPVSALIHAATMVTAGVFLVARMSPLFELS  
Sbjct: 237 CFLLFLGAMGKSAQFLLHVWLPDAMEGPTPVSALIHAATMVTAGVFLVARMSPLFELSSV 296

Query: 303 VLDCITVLGCITAFFAATVGLVQHDIKRVIAYSTCSQLGYMFVALGCRAYGASIFHLFTH 362
           VLDCI V+G ITAFFAATVGL QHDIKRVIAYSTCSQLGYMFVALGC AYGA+IFHLFTH
Sbjct: 297 VLDCIVVVGSITAFFAATVGLAQHDIKRVIAYSTCSQLGYMFVALGCGAYGAAIFHLFTH 356

Query: 363 AFFKALLFLGSGSVIHAVAGEQDMRRMGGLYPHLPRTCWMMIVGTLALTGFGIPETSIGF 422
           AFFKALLFLG+GSVIHAV+GEQDMRRMGGLY HLP T  MMI+GTLALTGFG+P+TSIG 
Sbjct: 357 AFFKALLFLGAGSVIHAVSGEQDMRRMGGLYKHLPVTGLMMIIGTLALTGFGLPKTSIGL 416

Query: 423 SGFFSKDIILEVAYTSSHFTFVFFLLLFAAFLTSFYSWRLMFLTFFGKMRVDKDISHKIH 482
           SGFFSKD+ILEVAY SS+    FF LLFAAFLTSFYSWRLMFLTFFGKMRVDK+I  KIH
Sbjct: 417 SGFFSKDVILEVAYMSSNRFIAFFPLLFAAFLTSFYSWRLMFLTFFGKMRVDKNILQKIH 476

Query: 483 ESPLVMQIPLFILAIGSIFFGFIFHDVFFGSAYSSFWKGALFASSSNNVLERYHEVPLWV 542
           ESP+VMQ+PLFILAIGSIFFGF+FH  FFG  YSSFWK A+F SS N +L  +H VPLWV
Sbjct: 477 ESPMVMQMPLFILAIGSIFFGFVFHSFFFGDGYSSFWKEAIFTSSRNKMLGIHHYVPLWV 536

Query: 543 EYSSFIAFFVGFFSAFLMYIICPSLPKFLSEKCRFFYCFLQNAWYFDRIYDCLLVRPIVR 602
           EYSSFIAF  GF  +F+MYI+ PSLPKFLS+K  +FY FL NAWYFDRIYD L VRP +R
Sbjct: 537 EYSSFIAFSAGFVVSFIMYIVFPSLPKFLSKKISYFYYFLHNAWYFDRIYDFLFVRPTIR 596

Query: 603 LATILWKRVDLSIDKYGPGGIVACVRYLSSYSSRLQTGYLDHYAFSMLIGISILVIVMLL 662
           L   LWK +DLSID+YGP G+ ACVRYLS Y+SRLQTGYL HYAF+ML+GISILV+VMLL
Sbjct: 597 LGEWLWKGIDLSIDRYGPNGVAACVRYLSFYASRLQTGYLYHYAFAMLVGISILVLVMLL 656

Query: 663 QGNI 666
           +GNI
Sbjct: 657 KGNI 660


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222148286|ref|YP_002549243.1| NADH dehydrogenase subunit L [Agrobacterium vitis S4] Length = 663 Back     alignment and organism information
>gi|15888610|ref|NP_354291.1| NADH dehydrogenase subunit L [Agrobacterium tumefaciens str. C58] Length = 665 Back     alignment and organism information
>gi|190891298|ref|YP_001977840.1| NADH-ubiquinone oxidoreductase, chain L [Rhizobium etli CIAT 652] Length = 666 Back     alignment and organism information
>gi|116251478|ref|YP_767316.1| NADH dehydrogenase subunit L [Rhizobium leguminosarum bv. viciae 3841] Length = 666 Back     alignment and organism information
>gi|241204099|ref|YP_002975195.1| NADH dehydrogenase subunit L [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 666 Back     alignment and organism information
>gi|325292645|ref|YP_004278509.1| NADH dehydrogenase I chain L [Agrobacterium sp. H13-3] Length = 665 Back     alignment and organism information
>gi|327188499|gb|EGE55713.1| NADH-ubiquinone oxidoreductase protein, chain L [Rhizobium etli CNPAF512] Length = 666 Back     alignment and organism information
>gi|209548875|ref|YP_002280792.1| NADH dehydrogenase subunit L [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 666 Back     alignment and organism information
>gi|15965030|ref|NP_385383.1| NADH dehydrogenase subunit L [Sinorhizobium meliloti 1021] Length = 664 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target666 NADH dehydrogenase subunit L [Candidatus Liberibacter a
PRK06590624 PRK06590, PRK06590, NADH:ubiquinone oxidoreductase subu 0.0
TIGR01974617 TIGR01974, NDH_I_L, proton-translocating NADH-quinone o 0.0
MTH00020610 MTH00020, ND5, NADH dehydrogenase subunit 5; Reviewed 1e-156
PRK07376673 PRK07376, PRK07376, NAD(P)H-quinone oxidoreductase subu 1e-130
COG1009606 COG1009, NuoL, NADH:ubiquinone oxidoreductase subunit 5 1e-129
MTH00032669 MTH00032, ND5, NADH dehydrogenase subunit 5; Provisiona 1e-119
MTH00211597 MTH00211, ND5, NADH dehydrogenase subunit 5; Provisiona 3e-96
PRK07390613 PRK07390, PRK07390, NAD(P)H-quinone oxidoreductase subu 7e-57
TIGR01960606 TIGR01960, ndhF3_CO2, NAD(P)H dehydrogenase, subunit Nd 6e-54
MTH00210616 MTH00210, ND5, NADH dehydrogenase subunit 5; Provisiona 1e-164
CHL00025741 CHL00025, ndhF, NADH dehydrogenase subunit 5 1e-105
PRK12648 948 PRK12648, PRK12648, putative monovalent cation/H+ antip 1e-61
PRK12649 789 PRK12649, PRK12649, putative monovalent cation/H+ antip 1e-60
PRK06525479 PRK06525, PRK06525, hydrogenase 4 subunit D; Validated 1e-56
PRK08375487 PRK08375, PRK08375, putative monovalent cation/H+ antip 3e-41
PRK08376521 PRK08376, PRK08376, putative monovalent cation/H+ antip 2e-40
PRK12667520 PRK12667, PRK12667, putative monovalent cation/H+ antip 2e-40
PRK12668581 PRK12668, PRK12668, putative monovalent cation/H+ antip 7e-33
COG1008497 COG1008, NuoM, NADH:ubiquinone oxidoreductase subunit 4 1e-29
PRK08667644 PRK08667, PRK08667, hydrogenase membrane subunit; Valid 8e-28
TIGR01972479 TIGR01972, NDH_I_M, proton-translocating NADH-quinone o 3e-27
PRK05777476 PRK05777, PRK05777, NADH:ubiquinone oxidoreductase subu 5e-27
PRK08377494 PRK08377, PRK08377, NADH dehydrogenase subunit N; Valid 1e-25
PRK05846497 PRK05846, PRK05846, NADH:ubiquinone oxidoreductase subu 3e-22
PRK07363501 PRK07363, PRK07363, NAD(P)H-quinone oxidoreductase subu 5e-22
PRK07691496 PRK07691, PRK07691, putative monovalent cation/H+ antip 2e-21
PRK06473500 PRK06473, PRK06473, NAD(P)H-quinone oxidoreductase subu 1e-19
PRK12662492 PRK12662, PRK12662, putative monovalent cation/H+ antip 3e-17
PRK02546525 PRK02546, PRK02546, NAD(P)H-quinone oxidoreductase subu 8e-09
MTH00204485 MTH00204, ND4, NADH dehydrogenase subunit 4; Provisiona 8e-07
MTH00004602 MTH00004, ND5, NADH dehydrogenase subunit 5; Validated 9e-99
MTH00066598 MTH00066, ND5, NADH dehydrogenase subunit 5; Provisiona 2e-90
MTH00151565 MTH00151, ND5, NADH dehydrogenase subunit 5; Provisiona 1e-65
MTH00209564 MTH00209, ND5, NADH dehydrogenase subunit 5; Provisiona 2e-64
TIGR00940 793 TIGR00940, 2a6301s01, Tmonovalent cation:proton antipor 2e-58
PRK12644 965 PRK12644, PRK12644, putative monovalent cation/H+ antip 2e-58
PRK12645 800 PRK12645, PRK12645, monovalent cation/H+ antiporter sub 7e-58
MTH00207572 MTH00207, ND5, NADH dehydrogenase subunit 5; Provisiona 2e-53
PRK12646 800 PRK12646, PRK12646, putative monovalent cation/H+ antip 6e-53
PRK12650 962 PRK12650, PRK12650, putative monovalent cation/H+ antip 6e-52
PRK06521667 PRK06521, PRK06521, hydrogenase 4 subunit B; Validated 4e-43
MTH00095527 MTH00095, ND5, NADH dehydrogenase subunit 5; Provisiona 2e-39
PRK06589489 PRK06589, PRK06589, putative monovalent cation/H+ antip 4e-30
PRK06458490 PRK06458, PRK06458, hydrogenase 4 subunit F; Validated 2e-27
COG1007475 COG1007, NuoN, NADH:ubiquinone oxidoreductase subunit 2 2e-24
PRK12663497 PRK12663, PRK12663, putative monovalent cation/H+ antip 7e-20
PRK08676485 PRK08676, PRK08676, hydrogenase membrane subunit; Valid 6e-18
TIGR00944463 TIGR00944, 2a6301s04, Multicomponent K+:H+antiporter 4e-13
PRK06459585 PRK06459, PRK06459, hydrogenase 4 subunit B; Validated 2e-11
MTH00208628 MTH00208, ND5, NADH dehydrogenase subunit 5; Provisiona 2e-97
MTH00108602 MTH00108, ND5, NADH dehydrogenase subunit 5; Provisiona 4e-89
MTH00137611 MTH00137, ND5, NADH dehydrogenase subunit 5; Provisiona 5e-85
KOG4668355 KOG4668, KOG4668, KOG4668, NADH dehydrogenase subunits 1e-46
TIGR01770468 TIGR01770, NDH_I_N, proton-translocating NADH-quinone o 3e-18
CHL00049494 CHL00049, ndhB, NADH dehydrogenase subunit 2 9e-07
MTH00196365 MTH00196, ND2, NADH dehydrogenase subunit 2; Provisiona 1e-06
MTH00165573 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisiona 7e-68
PRK12647 761 PRK12647, PRK12647, putative monovalent cation/H+ antip 4e-58
pfam00361270 pfam00361, Oxidored_q1, NADH-Ubiquinone/plastoquinone ( 3e-51
COG0651504 COG0651, HyfB, Formate hydrogenlyase subunit 3/Multisub 3e-43
PRK08668610 PRK08668, PRK08668, NADH dehydrogenase subunit M; Valid 4e-36
PRK08168516 PRK08168, PRK08168, NADH dehydrogenase subunit L; Provi 2e-35
PRK08601509 PRK08601, PRK08601, NADH dehydrogenase subunit 5; Valid 6e-25
PRK12665521 PRK12665, PRK12665, putative monovalent cation/H+ antip 6e-12
PRK07234470 PRK07234, PRK07234, putative monovalent cation/H+ antip 2e-22
KOG4845452 KOG4845, KOG4845, KOG4845, NADH dehydrogenase, subunit 4e-11
MTH00063522 MTH00063, ND5, NADH dehydrogenase subunit 5; Provisiona 2e-20
PRK08042593 PRK08042, PRK08042, formate hydrogenlyase subunit 3; Re 1e-13
pfam0066262 pfam00662, Oxidored_q1_N, NADH-Ubiquinone oxidoreductas 8e-12
PRK12561504 PRK12561, PRK12561, NAD(P)H-quinone oxidoreductase subu 4e-11
PRK06277478 PRK06277, PRK06277, hydrogenase subunit F; Validated 4e-11
PRK02504513 PRK02504, PRK02504, NAD(P)H-quinone oxidoreductase subu 7e-07
MTH00226505 MTH00226, ND4, NADH dehydrogenase subunit 4; Provisiona 3e-06
MTH00217482 MTH00217, ND4, NADH dehydrogenase subunit 4; Provisiona 0.001
CHL00025741 CHL00025, ndhF, NADH dehydrogenase subunit 5 1e-05
MTH00014452 MTH00014, ND4, NADH dehydrogenase subunit 4; Validated 9e-05
MTH00044458 MTH00044, ND4, NADH dehydrogenase subunit 4; Validated 0.001
>gnl|CDD|180633 PRK06590, PRK06590, NADH:ubiquinone oxidoreductase subunit L; Reviewed Back     alignment and domain information
>gnl|CDD|162634 TIGR01974, NDH_I_L, proton-translocating NADH-quinone oxidoreductase, chain L Back     alignment and domain information
>gnl|CDD|164593 MTH00020, ND5, NADH dehydrogenase subunit 5; Reviewed Back     alignment and domain information
>gnl|CDD|180952 PRK07376, PRK07376, NAD(P)H-quinone oxidoreductase subunit F; Validated Back     alignment and domain information
>gnl|CDD|31213 COG1009, NuoL, NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunit [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|164604 MTH00032, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|177254 MTH00211, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|180955 PRK07390, PRK07390, NAD(P)H-quinone oxidoreductase subunit F; Validated Back     alignment and domain information
>gnl|CDD|131015 TIGR01960, ndhF3_CO2, NAD(P)H dehydrogenase, subunit NdhF3 family Back     alignment and domain information
>gnl|CDD|177253 MTH00210, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|176967 CHL00025, ndhF, NADH dehydrogenase subunit 5 Back     alignment and domain information
>gnl|CDD|183648 PRK12648, PRK12648, putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|183649 PRK12649, PRK12649, putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|180606 PRK06525, PRK06525, hydrogenase 4 subunit D; Validated Back     alignment and domain information
>gnl|CDD|181404 PRK08375, PRK08375, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|181405 PRK08376, PRK08376, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|183667 PRK12667, PRK12667, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|183668 PRK12668, PRK12668, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|31212 COG1008, NuoM, NADH:ubiquinone oxidoreductase subunit 4 (chain M) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|181532 PRK08667, PRK08667, hydrogenase membrane subunit; Validated Back     alignment and domain information
>gnl|CDD|162632 TIGR01972, NDH_I_M, proton-translocating NADH-quinone oxidoreductase, chain M Back     alignment and domain information
>gnl|CDD|180252 PRK05777, PRK05777, NADH:ubiquinone oxidoreductase subunit N; Provisional Back     alignment and domain information
>gnl|CDD|181406 PRK08377, PRK08377, NADH dehydrogenase subunit N; Validated Back     alignment and domain information
>gnl|CDD|180285 PRK05846, PRK05846, NADH:ubiquinone oxidoreductase subunit M; Reviewed Back     alignment and domain information
>gnl|CDD|180945 PRK07363, PRK07363, NAD(P)H-quinone oxidoreductase subunit M; Validated Back     alignment and domain information
>gnl|CDD|181085 PRK07691, PRK07691, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|180580 PRK06473, PRK06473, NAD(P)H-quinone oxidoreductase subunit D4; Validated Back     alignment and domain information
>gnl|CDD|183662 PRK12662, PRK12662, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|179442 PRK02546, PRK02546, NAD(P)H-quinone oxidoreductase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|164750 MTH00204, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|177100 MTH00004, ND5, NADH dehydrogenase subunit 5; Validated Back     alignment and domain information
>gnl|CDD|177138 MTH00066, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|177208 MTH00151, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|177252 MTH00209, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|162123 TIGR00940, 2a6301s01, Tmonovalent cation:proton antiporter Back     alignment and domain information
>gnl|CDD|183644 PRK12644, PRK12644, putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|183645 PRK12645, PRK12645, monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|164753 MTH00207, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|183646 PRK12646, PRK12646, putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|183650 PRK12650, PRK12650, putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|180602 PRK06521, PRK06521, hydrogenase 4 subunit B; Validated Back     alignment and domain information
>gnl|CDD|177158 MTH00095, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|180632 PRK06589, PRK06589, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|180571 PRK06458, PRK06458, hydrogenase 4 subunit F; Validated Back     alignment and domain information
>gnl|CDD|31211 COG1007, NuoN, NADH:ubiquinone oxidoreductase subunit 2 (chain N) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|183663 PRK12663, PRK12663, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|181537 PRK08676, PRK08676, hydrogenase membrane subunit; Validated Back     alignment and domain information
>gnl|CDD|130019 TIGR00944, 2a6301s04, Multicomponent K+:H+antiporter Back     alignment and domain information
>gnl|CDD|180572 PRK06459, PRK06459, hydrogenase 4 subunit B; Validated Back     alignment and domain information
>gnl|CDD|177251 MTH00208, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|177170 MTH00108, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|177195 MTH00137, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|39867 KOG4668, KOG4668, KOG4668, NADH dehydrogenase subunits 2, 5, and related proteins [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162524 TIGR01770, NDH_I_N, proton-translocating NADH-quinone oxidoreductase, chain N Back     alignment and domain information
>gnl|CDD|176990 CHL00049, ndhB, NADH dehydrogenase subunit 2 Back     alignment and domain information
>gnl|CDD|177243 MTH00196, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|177220 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|183647 PRK12647, PRK12647, putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|109421 pfam00361, Oxidored_q1, NADH-Ubiquinone/plastoquinone (complex I), various chains Back     alignment and domain information
>gnl|CDD|30996 COG0651, HyfB, Formate hydrogenlyase subunit 3/Multisubunit Na+/H+ antiporter, MnhD subunit [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|181533 PRK08668, PRK08668, NADH dehydrogenase subunit M; Validated Back     alignment and domain information
>gnl|CDD|181264 PRK08168, PRK08168, NADH dehydrogenase subunit L; Provisional Back     alignment and domain information
>gnl|CDD|181498 PRK08601, PRK08601, NADH dehydrogenase subunit 5; Validated Back     alignment and domain information
>gnl|CDD|183665 PRK12665, PRK12665, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|180900 PRK07234, PRK07234, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|40042 KOG4845, KOG4845, KOG4845, NADH dehydrogenase, subunit 4 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|177135 MTH00063, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|181206 PRK08042, PRK08042, formate hydrogenlyase subunit 3; Reviewed Back     alignment and domain information
>gnl|CDD|109709 pfam00662, Oxidored_q1_N, NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminus Back     alignment and domain information
>gnl|CDD|183596 PRK12561, PRK12561, NAD(P)H-quinone oxidoreductase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|180504 PRK06277, PRK06277, hydrogenase subunit F; Validated Back     alignment and domain information
>gnl|CDD|179434 PRK02504, PRK02504, NAD(P)H-quinone oxidoreductase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|177262 MTH00226, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|164762 MTH00217, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|176967 CHL00025, ndhF, NADH dehydrogenase subunit 5 Back     alignment and domain information
>gnl|CDD|164589 MTH00014, ND4, NADH dehydrogenase subunit 4; Validated Back     alignment and domain information
>gnl|CDD|177119 MTH00044, ND4, NADH dehydrogenase subunit 4; Validated Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 666 NADH dehydrogenase subunit L [Candidatus Liberibacter a
TIGR01974691 NDH_I_L proton-translocating NADH-quinone oxidoreductas 100.0
PRK07376667 NAD(P)H-quinone oxidoreductase subunit F; Validated 100.0
CHL00025738 ndhF NADH dehydrogenase subunit 5 100.0
PRK06590619 NADH dehydrogenase subunit L; Reviewed 100.0
MTH00032677 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
PRK07390615 NAD(P)H-quinone oxidoreductase subunit F; Validated 100.0
MTH00210618 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00020608 ND5 NADH dehydrogenase subunit 5; Reviewed 100.0
COG1009606 NuoL NADH:ubiquinone oxidoreductase subunit 5 (chain L) 100.0
MTH00137611 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00108602 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
PRK12649 800 putative monovalent cation/H+ antiporter subunit A; Rev 100.0
PRK12645 800 monovalent cation/H+ antiporter subunit A; Reviewed 100.0
PRK06521670 hydrogenase 4 subunit B; Validated 100.0
PRK12647 761 putative monovalent cation/H+ antiporter subunit A; Rev 100.0
PRK08668616 NADH dehydrogenase subunit M; Validated 100.0
PRK12648 950 putative monovalent cation/H+ antiporter subunit A; Rev 100.0
PRK08667644 hydrogenase membrane subunit; Validated 100.0
PRK12646 800 putative monovalent cation/H+ antiporter subunit A; Rev 100.0
PRK12644 968 putative monovalent cation/H+ antiporter subunit A; Rev 100.0
TIGR01960613 ndhF3_CO2 NAD(P)H dehydrogenase, subunit NdhF3 family; 100.0
PRK12668569 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
MTH00004604 ND5 NADH dehydrogenase subunit 5; Validated 100.0
MTH00114600 consensus 100.0
MTH00066598 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00211595 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00208631 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
TIGR00940 809 2a6301s01 monovalent cation:proton antiporter; InterPro 100.0
MTH00165571 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00209565 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00207572 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00151566 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
PRK06459578 hydrogenase 4 subunit B; Validated 100.0
PRK12664530 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK12650 969 putative monovalent cation/H+ antiporter subunit A; Rev 100.0
PRK08376513 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK07691498 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK08042593 formate hydrogenlyase subunit 3; Reviewed 100.0
TIGR01972532 NDH_I_M proton-translocating NADH-quinone oxidoreductas 100.0
PRK06589484 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK06525480 hydrogenase 4 subunit D; Validated 100.0
PRK12667517 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK02546531 NAD(P)H-quinone oxidoreductase subunit 4; Provisional 100.0
PRK12662491 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK12663497 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK12665524 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK12561495 NAD(P)H-quinone oxidoreductase subunit 4; Provisional 100.0
PRK07363499 NAD(P)H-quinone oxidoreductase subunit M; Validated 100.0
PRK06473500 NAD(P)H-quinone oxidoreductase subunit D4; Validated 100.0
PRK08375481 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK08377493 NADH dehydrogenase subunit N; Validated 100.0
MTH00204486 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
PRK05846495 NADH dehydrogenase subunit M; Reviewed 100.0
PRK12666509 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
CHL00011500 ndhD NADH dehydrogenase subunit 4 100.0
MTH00217482 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
PRK06458491 hydrogenase 4 subunit F; Validated 100.0
PRK06277479 hydrogenase subunit F; Validated 100.0
COG1008497 NuoM NADH:ubiquinone oxidoreductase subunit 4 (chain M) 100.0
PRK05777478 NADH dehydrogenase subunit N; Provisional 100.0
PRK02504514 NAD(P)H-quinone oxidoreductase subunit 2; Provisional 100.0
COG0651504 HyfB Formate hydrogenlyase subunit 3/Multisubunit Na+/H 100.0
MTH00014451 ND4 NADH dehydrogenase subunit 4; Validated 100.0
MTH00206452 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00110459 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
TIGR00944504 2a6301s04 Multicomponent K+:H+antiporter; InterPro: IPR 100.0
MTH00095527 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
PRK08676486 hydrogenase membrane subunit; Validated 100.0
MTH00096476 consensus 100.0
MTH00044460 ND4 NADH dehydrogenase subunit 4; Validated 100.0
MTH00068458 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
CHL00049498 ndhB NADH dehydrogenase subunit 2 100.0
MTH00124457 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00205452 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00199454 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
TIGR01770491 NDH_I_N proton-translocating NADH-quinone oxidoreductas 100.0
COG1007475 NuoN NADH:ubiquinone oxidoreductase subunit 2 (chain N) 100.0
MTH00063519 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
PRK07234456 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK06591433 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK08168514 NADH dehydrogenase subunit L; Provisional 100.0
MTH00150447 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00127459 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00163446 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00094409 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00062419 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
PRK08601506 NADH dehydrogenase subunit 5; Validated 100.0
MTH00196365 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
MTH00105345 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
MTH00011333 ND2 NADH dehydrogenase subunit 2; Validated 100.0
MTH00160336 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
pfam00361270 Oxidored_q1 NADH-Ubiquinone/plastoquinone (complex I), 100.0
MTH00091273 ND2 NADH dehydrogenase subunit 2; Provisional 98.08
MTH00200343 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
MTH00112345 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
MTH00041350 ND2 NADH dehydrogenase subunit 2; Validated 100.0
MTH00144329 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
KOG4668355 consensus 100.0
MTH00070346 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
MTH00135347 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
MTH00197325 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
MTH00198596 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
KOG4845452 consensus 100.0
PRK06588504 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
pfam06455181 NADH5_C NADH dehydrogenase subunit 5 C-terminus. This f 99.7
pfam0066262 Oxidored_q1_N NADH-Ubiquinone oxidoreductase (complex I 99.32
pfam01010242 Oxidored_q1_C NADH-Ubiquinone oxidoreductase (complex I 99.05
pfam10125219 NADHdeh_related NADH dehydrogenase I, subunit N related 97.5
MTH00059288 ND2 NADH dehydrogenase subunit 2; Provisional 96.72
COG4078221 Predicted membrane protein [Function unknown] 96.32
>TIGR01974 NDH_I_L proton-translocating NADH-quinone oxidoreductase, chain L; InterPro: IPR003945 NADH-plastoquinone oxidoreductase chain 5 is part of the NADH-ubiquinone oxidoreductase (complex I), which catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane : NADH + ubiquinone = NAD(+) + ubiquinol ; GO: 0008137 NADH dehydrogenase (ubiquinone) activity, 0042773 ATP synthesis coupled electron transport Back     alignment and domain information
>PRK07376 NAD(P)H-quinone oxidoreductase subunit F; Validated Back     alignment and domain information
>CHL00025 ndhF NADH dehydrogenase subunit 5 Back     alignment and domain information
>PRK06590 NADH dehydrogenase subunit L; Reviewed Back     alignment and domain information
>MTH00032 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>PRK07390 NAD(P)H-quinone oxidoreductase subunit F; Validated Back     alignment and domain information
>MTH00210 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>MTH00020 ND5 NADH dehydrogenase subunit 5; Reviewed Back     alignment and domain information
>COG1009 NuoL NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunit [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>MTH00137 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>MTH00108 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>PRK12649 putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>PRK12645 monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>PRK06521 hydrogenase 4 subunit B; Validated Back     alignment and domain information
>PRK12647 putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>PRK08668 NADH dehydrogenase subunit M; Validated Back     alignment and domain information
>PRK12648 putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>PRK08667 hydrogenase membrane subunit; Validated Back     alignment and domain information
>PRK12646 putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>PRK12644 putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>TIGR01960 ndhF3_CO2 NAD(P)H dehydrogenase, subunit NdhF3 family; InterPro: IPR010217 This family represents NAD(P)H dehydrogenase subunit 5, or ndhF Back     alignment and domain information
>PRK12668 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>MTH00004 ND5 NADH dehydrogenase subunit 5; Validated Back     alignment and domain information
>MTH00114 consensus Back     alignment and domain information
>MTH00066 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>MTH00211 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>MTH00208 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>TIGR00940 2a6301s01 monovalent cation:proton antiporter; InterPro: IPR005663 This family of proteins consists of bacterial multicomponent K+:H+ and Na+:H+ antiporters Back     alignment and domain information
>MTH00165 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>MTH00209 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>MTH00207 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>MTH00151 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>PRK06459 hydrogenase 4 subunit B; Validated Back     alignment and domain information
>PRK12664 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>PRK12650 putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>PRK08376 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>PRK07691 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>PRK08042 formate hydrogenlyase subunit 3; Reviewed Back     alignment and domain information
>TIGR01972 NDH_I_M proton-translocating NADH-quinone oxidoreductase, chain M; InterPro: IPR010227 This entry describes the 13th (based on Escherichia coli) structural gene, M, of bacterial NADH dehydrogenase I, as well as chain 4 of the corresponding mitochondrial complex I and of the chloroplast NAD(P)H dehydrogenase complex Back     alignment and domain information
>PRK06589 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>PRK06525 hydrogenase 4 subunit D; Validated Back     alignment and domain information
>PRK12667 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>PRK02546 NAD(P)H-quinone oxidoreductase subunit 4; Provisional Back     alignment and domain information
>PRK12662 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>PRK12663 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>PRK12665 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>PRK12561 NAD(P)H-quinone oxidoreductase subunit 4; Provisional Back     alignment and domain information
>PRK07363 NAD(P)H-quinone oxidoreductase subunit M; Validated Back     alignment and domain information