254780866

254780866

NADH dehydrogenase subunit M

GeneID in NCBI database:8209881Locus tag:CLIBASIA_03805
Protein GI in NCBI database:254780866Protein Accession:YP_003065279.1
Gene range:+(834208, 835707)Protein Length:499aa
Gene description:NADH dehydrogenase subunit M
COG prediction:[C] NADH:ubiquinone oxidoreductase subunit 4 (chain M)
KEGG prediction:nuoM; NADH dehydrogenase subunit M (EC:1.6.99.5); K00342 NADH dehydrogenase I subunit M [EC:1.6.5.3]
SEED prediction:NADH-ubiquinone oxidoreductase chain M (EC 1.6.5.3)
Pathway involved in KEGG:Oxidative phosphorylation [PATH:las00190]
Subsystem involved in SEED:Respiratory Complex I
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM14 TM-Helix
TOPPRED13 TM-Helix
HMMTOP14 TM-Helix
MEMSAT14 TM-Helix
MEMSAT_SVM13 TM-Helix
PHOBIUS14 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------50
MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIENYTLKTGYSDSVKG
cccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEccccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccccHHEHHHcccccccHHEEcccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHccccHHHccHHHcccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccHHccHHHHHHHHHHHcHHHHHHHHHHHHHHcccccHHEEHcccccccHHHHHHHHHHHHHHHHHcccccccEEcccccccccccHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
MNLPFLSIVTFLPFLGVFVILFSSylgcgrrsffGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLyamskfpfsIQYWMWIAFFCSFaikipmfpfhtwlpnahvqaptagSVFLAGIMLKMGGYgcirfllplfplasqyfapVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIydrlhtrdifaygglvhnmpRYAVVMMVFTManmglpgtsgfIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFfgiypvpirdtfsvplssiienytlktgysdsvkg
MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKvqqlkdlslrerCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIienytlktgysdsvkg
MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISIllvvlttfltPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIENYTLKTGYSDSVKG
*NLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIENYT***********
MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIENYTLKTGYSDSVKG
MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIENYTLKTGYSDS***
oooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooo
xxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIENYTLKTGYSDSVKG
MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIENYTLKTGYSDSVKG
MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRSSFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLVLESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLSALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPLSSIIENYTLKTGYSDSVKG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target499 NADH dehydrogenase subunit M [Candidatus Liberibacter a
254780867478 NADH dehydrogenase subunit N [Candidatus Liberibac 2e-15
254780865 666 NADH dehydrogenase subunit L [Candidatus Liberibac 3e-15
>gi|254780867|ref|YP_003065280.1| NADH dehydrogenase subunit N [Candidatus Liberibacter asiaticus str. psy62] Length = 478 Back     alignment
 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 80/300 (26%), Positives = 142/300 (47%), Gaps = 10/300 (3%)

Query: 133 DMLLFYIFFEASLIPMFVIIGVWGGSE-RIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKT 191
           DM+ FY+  E     ++V+I +   S   I AA K+F+   F S F+L+ I  +      
Sbjct: 127 DMISFYMSLELQSFALYVLIAMNRKSVFSIEAALKYFVLGAFSSAFLLYGISFIYGFTGC 186

Query: 192 SSIIDLYAMSKFPFSIQYWMWIA---FFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLA 248
           +    + A S F     + + +           K+ + PFH W+P+ +  +P   + FLA
Sbjct: 187 TGFSQI-ATSLFIGHRSFVLIVGVVLILVGLFFKMALVPFHMWIPDVYEGSPMFMTAFLA 245

Query: 249 GIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSI 308
            I          R     +P+ S    P+   +S+ +++  S+V++ Q D+K+L+AYSSI
Sbjct: 246 TIPKFATTMALCRITSVFWPMLSGLL-PIFMCVSIGSMVLGSVVAIRQKDLKRLMAYSSI 304

Query: 309 AHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIY--DRLHTRDIFAYGGLV 366
            H GY  IG  +GM  G+   +  M+ + ++    F C+  +   D  + ++I    GL 
Sbjct: 305 GHAGYALIGFSTGML-GIVAMVRYMVIYLIMMIGFFSCILSLRRKDGNNIQNISDLAGLS 363

Query: 367 HNMPRYAVVMMVFTMANMGLPGTSGFIGE-FLVIMSVFQNSNTVAVLASFGVVLSALYSL 425
                    + +F  +  G+P  +GF G+ FL+I +V +    +A++A    V+SA Y L
Sbjct: 364 RQDIFLTCALTIFLFSLAGIPPFAGFFGKYFLLISAVKREFYVLAIVALLSSVISAYYYL 423

>gi|254780865|ref|YP_003065278.1| NADH dehydrogenase subunit L [Candidatus Liberibacter asiaticus str. psy62] Length = 666 Back     alignment
 Score = 74.7 bits (182), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 126/249 (50%), Gaps = 16/249 (6%)

Query: 229 HTWLPNAHVQAPTAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIY 288
           H WLP+A ++ PT  S  +    +   G   +  + PLF L S +    I  L  I   +
Sbjct: 260 HVWLPDA-MEGPTPVSALIHAATMVTAGVFLVARMSPLFEL-SPFVLDCITVLGCITAFF 317

Query: 289 ASLVSMVQTDIKKLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVG 348
           A+ V +VQ DIK++IAYS+ + +GY+ + +  G ++    ++F + +H    + LF   G
Sbjct: 318 AATVGLVQHDIKRVIAYSTCSQLGYMFVAL--GCRA-YGASIFHLFTHAFFKALLFLGSG 374

Query: 349 -VIYDRLHTRDIFAYGGLVHNMPRYAVVMMVFTMA--NMGLPGTS-GFIGEFL--VIMSV 402
            VI+     +D+   GGL  ++PR   +M+V T+A    G+P TS GF G F   +I+ V
Sbjct: 375 SVIHAVAGEQDMRRMGGLYPHLPRTCWMMIVGTLALTGFGIPETSIGFSGFFSKDIILEV 434

Query: 403 FQNSNTVAVLASFGVVLSALYSLWLYRKV---VFGVSKCEK--VQQLKDLSLRERCMVYP 457
              S+    +    +  + L S + +R +    FG  + +K    ++ +  L  +  ++ 
Sbjct: 435 AYTSSHFTFVFFLLLFAAFLTSFYSWRLMFLTFFGKMRVDKDISHKIHESPLVMQIPLFI 494

Query: 458 IAVLTVFFG 466
           +A+ ++FFG
Sbjct: 495 LAIGSIFFG 503

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target499 NADH dehydrogenase subunit M [Candidatus Liberibacter a
315122713491 NADH dehydrogenase subunit M [Candidatus Liberibacter s 1 0.0
222085589512 NADH-ubiquinone oxidoreductase chain M protein [Agrobac 1 1e-176
327188500503 NADH-ubiquinone oxidoreductase protein, chain M [Rhizob 1 1e-175
190891299503 NADH-ubiquinone oxidoreductase, chain M [Rhizobium etli 1 1e-173
222148287512 NADH dehydrogenase subunit M [Agrobacterium vitis S4] L 1 1e-173
90417831502 NADH dehydrogenase I, M subunit [Aurantimonas manganoxy 1 1e-172
110633388501 NADH dehydrogenase subunit M [Mesorhizobium sp. BNC1] L 1 1e-172
319782994501 proton-translocating NADH-quinone oxidoreductase, chain 1 1e-171
260462244501 proton-translocating NADH-quinone oxidoreductase, chain 1 1e-171
13471394501 NADH dehydrogenase subunit M [Mesorhizobium loti MAFF30 1 1e-171
>gi|315122713|ref|YP_004063202.1| NADH dehydrogenase subunit M [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 491 Back     alignment and organism information
 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/486 (79%), Positives = 448/486 (92%)

Query: 1   MNLPFLSIVTFLPFLGVFVILFSSYLGCGRRSFFGVALGISTINFIFSLFVWSVFDKGRS 60
           M+LPFLSI+TF PF+GV ++  +SYLGC RRSF G+ALG S INF+FSLFVW++F++  S
Sbjct: 1   MDLPFLSIITFTPFIGVLLLFLASYLGCERRSFLGIALGTSIINFVFSLFVWAIFNQNNS 60

Query: 61  SFQMIEYYHWIDYFCSYHLGVDGISILLVVLTTFLTPFCILSSWKSIQENFREYMIAFLV 120
            FQMIEYYHWIDYFC YHLGVDGISILLVVLT FLTPFCILSSW+S+QE F+EYMIAFL+
Sbjct: 61  GFQMIEYYHWIDYFCDYHLGVDGISILLVVLTAFLTPFCILSSWESVQERFKEYMIAFLI 120

Query: 121 LESMVIGAFLSLDMLLFYIFFEASLIPMFVIIGVWGGSERIYAAYKFFLYTFFGSIFMLF 180
           LESM IGAFLSLD++LFYIFFEASLIPMF+IIGVWGG+ER+YAAYKFFLYTFFGS+FML 
Sbjct: 121 LESMTIGAFLSLDIVLFYIFFEASLIPMFIIIGVWGGNERVYAAYKFFLYTFFGSVFMLL 180

Query: 181 AIVVMCWEKKTSSIIDLYAMSKFPFSIQYWMWIAFFCSFAIKIPMFPFHTWLPNAHVQAP 240
           AI+VMCW+KKT+SIIDLYA S FP SIQ W+W+AFF SFAIKIPMFPFHTWLP+AHVQAP
Sbjct: 181 AIMVMCWDKKTTSIIDLYASSSFPMSIQCWLWLAFFISFAIKIPMFPFHTWLPSAHVQAP 240

Query: 241 TAGSVFLAGIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIK 300
           TAGSVFLAGIMLKMGGYGC+RFLLPLFPLAS+YF+P+I  LS+I+IIYASLV+MVQ DIK
Sbjct: 241 TAGSVFLAGIMLKMGGYGCLRFLLPLFPLASKYFSPLILILSVISIIYASLVAMVQRDIK 300

Query: 301 KLIAYSSIAHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIYDRLHTRDIF 360
           KLIAYSSIAHMGYVTIGIFSG++SGVEGAMFQMLSHGLVSSALFF +G++YDRLHTRD++
Sbjct: 301 KLIAYSSIAHMGYVTIGIFSGIRSGVEGAMFQMLSHGLVSSALFFSIGILYDRLHTRDLY 360

Query: 361 AYGGLVHNMPRYAVVMMVFTMANMGLPGTSGFIGEFLVIMSVFQNSNTVAVLASFGVVLS 420
           AYGGLV NMPRYAVVMMVFTMAN+GLPGTSGFIGEFL+I+S F N N +AV ASFGVVLS
Sbjct: 361 AYGGLVRNMPRYAVVMMVFTMANIGLPGTSGFIGEFLIIVSAFFNHNMIAVFASFGVVLS 420

Query: 421 ALYSLWLYRKVVFGVSKCEKVQQLKDLSLRERCMVYPIAVLTVFFGIYPVPIRDTFSVPL 480
           ALYSLW YRK+VFGVS+ E+V+++KDLSLRERC+VYPIAVL VFFGIY +P+ DTF++ +
Sbjct: 421 ALYSLWFYRKIVFGVSEREEVKKIKDLSLRERCIVYPIAVLIVFFGIYTIPVFDTFALTI 480

Query: 481 SSIIEN 486
           SSI++ 
Sbjct: 481 SSIVKT 486


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085589|ref|YP_002544119.1| NADH-ubiquinone oxidoreductase chain M protein [Agrobacterium radiobacter K84] Length = 512 Back     alignment and organism information
>gi|327188500|gb|EGE55714.1| NADH-ubiquinone oxidoreductase protein, chain M [Rhizobium etli CNPAF512] Length = 503 Back     alignment and organism information
>gi|190891299|ref|YP_001977841.1| NADH-ubiquinone oxidoreductase, chain M [Rhizobium etli CIAT 652] Length = 503 Back     alignment and organism information
>gi|222148287|ref|YP_002549244.1| NADH dehydrogenase subunit M [Agrobacterium vitis S4] Length = 512 Back     alignment and organism information
>gi|90417831|ref|ZP_01225743.1| NADH dehydrogenase I, M subunit [Aurantimonas manganoxydans SI85-9A1] Length = 502 Back     alignment and organism information
>gi|110633388|ref|YP_673596.1| NADH dehydrogenase subunit M [Mesorhizobium sp. BNC1] Length = 501 Back     alignment and organism information
>gi|319782994|ref|YP_004142470.1| proton-translocating NADH-quinone oxidoreductase, chain M [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 501 Back     alignment and organism information
>gi|260462244|ref|ZP_05810488.1| proton-translocating NADH-quinone oxidoreductase, chain M [Mesorhizobium opportunistum WSM2075] Length = 501 Back     alignment and organism information
>gi|13471394|ref|NP_102960.1| NADH dehydrogenase subunit M [Mesorhizobium loti MAFF303099] Length = 501 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target499 NADH dehydrogenase subunit M [Candidatus Liberibacter a
PRK05846497 PRK05846, PRK05846, NADH:ubiquinone oxidoreductase subu 1e-177
TIGR01972479 TIGR01972, NDH_I_M, proton-translocating NADH-quinone o 1e-152
MTH00217482 MTH00217, ND4, NADH dehydrogenase subunit 4; Provisiona 1e-115
MTH00204485 MTH00204, ND4, NADH dehydrogenase subunit 4; Provisiona 1e-114
PRK06473500 PRK06473, PRK06473, NAD(P)H-quinone oxidoreductase subu 8e-88
KOG4845452 KOG4845, KOG4845, KOG4845, NADH dehydrogenase, subunit 4e-83
PRK02546525 PRK02546, PRK02546, NAD(P)H-quinone oxidoreductase subu 2e-82
MTH00226505 MTH00226, ND4, NADH dehydrogenase subunit 4; Provisiona 3e-81
PRK07363501 PRK07363, PRK07363, NAD(P)H-quinone oxidoreductase subu 3e-71
PRK08375487 PRK08375, PRK08375, putative monovalent cation/H+ antip 6e-50
COG0651504 COG0651, HyfB, Formate hydrogenlyase subunit 3/Multisub 2e-41
PRK08668 610 PRK08668, PRK08668, NADH dehydrogenase subunit M; Valid 3e-36
PRK12667520 PRK12667, PRK12667, putative monovalent cation/H+ antip 4e-36
PRK05777476 PRK05777, PRK05777, NADH:ubiquinone oxidoreductase subu 2e-32
PRK08376521 PRK08376, PRK08376, putative monovalent cation/H+ antip 2e-32
PRK12662492 PRK12662, PRK12662, putative monovalent cation/H+ antip 2e-31
PRK08676485 PRK08676, PRK08676, hydrogenase membrane subunit; Valid 7e-28
TIGR00940 793 TIGR00940, 2a6301s01, Tmonovalent cation:proton antipor 2e-25
TIGR01974 617 TIGR01974, NDH_I_L, proton-translocating NADH-quinone o 1e-23
COG1008497 COG1008, NuoM, NADH:ubiquinone oxidoreductase subunit 4 1e-143
PRK12561504 PRK12561, PRK12561, NAD(P)H-quinone oxidoreductase subu 4e-90
CHL00011498 CHL00011, ndhD, NADH dehydrogenase subunit 4 8e-78
COG1009 606 COG1009, NuoL, NADH:ubiquinone oxidoreductase subunit 5 5e-37
PRK06525479 PRK06525, PRK06525, hydrogenase 4 subunit D; Validated 3e-29
PRK06590 624 PRK06590, PRK06590, NADH:ubiquinone oxidoreductase subu 9e-19
MTH00032 669 MTH00032, ND5, NADH dehydrogenase subunit 5; Provisiona 4e-14
MTH00150417 MTH00150, ND4, NADH dehydrogenase subunit 4; Provisiona 2e-69
MTH00044458 MTH00044, ND4, NADH dehydrogenase subunit 4; Validated 2e-61
MTH00068458 MTH00068, ND4, NADH dehydrogenase subunit 4; Provisiona 4e-60
MTH00124457 MTH00124, ND4, NADH dehydrogenase subunit 4; Provisiona 2e-59
MTH00014452 MTH00014, ND4, NADH dehydrogenase subunit 4; Validated 5e-55
MTH00127459 MTH00127, ND4, NADH dehydrogenase subunit 4; Provisiona 2e-53
MTH00110459 MTH00110, ND4, NADH dehydrogenase subunit 4; Provisiona 1e-51
TIGR00944463 TIGR00944, 2a6301s04, Multicomponent K+:H+antiporter 4e-26
PRK12665521 PRK12665, PRK12665, putative monovalent cation/H+ antip 8e-25
PRK12646 800 PRK12646, PRK12646, putative monovalent cation/H+ antip 1e-24
PRK06589489 PRK06589, PRK06589, putative monovalent cation/H+ antip 2e-24
PRK12647 761 PRK12647, PRK12647, putative monovalent cation/H+ antip 2e-19
PRK12645 800 PRK12645, PRK12645, monovalent cation/H+ antiporter sub 5e-19
PRK06591432 PRK06591, PRK06591, putative monovalent cation/H+ antip 3e-06
MTH00206450 MTH00206, ND4, NADH dehydrogenase subunit 4; Provisiona 2e-63
PRK12663497 PRK12663, PRK12663, putative monovalent cation/H+ antip 5e-32
COG1007475 COG1007, NuoN, NADH:ubiquinone oxidoreductase subunit 2 2e-31
PRK07691496 PRK07691, PRK07691, putative monovalent cation/H+ antip 3e-28
PRK08377494 PRK08377, PRK08377, NADH dehydrogenase subunit N; Valid 2e-27
TIGR01770468 TIGR01770, NDH_I_N, proton-translocating NADH-quinone o 2e-23
PRK12649 789 PRK12649, PRK12649, putative monovalent cation/H+ antip 8e-23
PRK12668 581 PRK12668, PRK12668, putative monovalent cation/H+ antip 4e-19
PRK06277478 PRK06277, PRK06277, hydrogenase subunit F; Validated 3e-15
MTH00163445 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisiona 2e-60
MTH00205448 MTH00205, ND4, NADH dehydrogenase subunit 4; Provisiona 1e-55
MTH00062417 MTH00062, ND4, NADH dehydrogenase subunit 4; Provisiona 3e-16
pfam00361270 pfam00361, Oxidored_q1, NADH-Ubiquinone/plastoquinone ( 2e-53
MTH00094403 MTH00094, ND4, NADH dehydrogenase subunit 4; Provisiona 2e-32
PRK08667 644 PRK08667, PRK08667, hydrogenase membrane subunit; Valid 7e-31
PRK12644 965 PRK12644, PRK12644, putative monovalent cation/H+ antip 2e-18
TIGR01960 606 TIGR01960, ndhF3_CO2, NAD(P)H dehydrogenase, subunit Nd 2e-12
PRK06459 585 PRK06459, PRK06459, hydrogenase 4 subunit B; Validated 2e-11
KOG4668355 KOG4668, KOG4668, KOG4668, NADH dehydrogenase subunits 1e-08
MTH00066 598 MTH00066, ND5, NADH dehydrogenase subunit 5; Provisiona 4e-08
PRK12664 527 PRK12664, PRK12664, putative monovalent cation/H+ antip 3e-07
MTH00070346 MTH00070, ND2, NADH dehydrogenase subunit 2; Provisiona 1e-06
PRK06521 667 PRK06521, PRK06521, hydrogenase 4 subunit B; Validated 6e-32
PRK06458490 PRK06458, PRK06458, hydrogenase 4 subunit F; Validated 8e-28
PRK08042 593 PRK08042, PRK08042, formate hydrogenlyase subunit 3; Re 7e-19
PRK12648 948 PRK12648, PRK12648, putative monovalent cation/H+ antip 4e-18
MTH00020 610 MTH00020, ND5, NADH dehydrogenase subunit 5; Reviewed 5e-14
PRK02504513 PRK02504, PRK02504, NAD(P)H-quinone oxidoreductase subu 9e-14
PRK12666528 PRK12666, PRK12666, putative monovalent cation/H+ antip 2e-12
CHL00049494 CHL00049, ndhB, NADH dehydrogenase subunit 2 1e-11
MTH00209 564 MTH00209, ND5, NADH dehydrogenase subunit 5; Provisiona 1e-10
MTH00210 616 MTH00210, ND5, NADH dehydrogenase subunit 5; Provisiona 1e-09
PRK07376 673 PRK07376, PRK07376, NAD(P)H-quinone oxidoreductase subu 1e-09
MTH00199460 MTH00199, ND2, NADH dehydrogenase subunit 2; Provisiona 2e-08
MTH00198607 MTH00198, ND2, NADH dehydrogenase subunit 2; Provisiona 5e-07
MTH00151 565 MTH00151, ND5, NADH dehydrogenase subunit 5; Provisiona 2e-06
MTH00208 628 MTH00208, ND5, NADH dehydrogenase subunit 5; Provisiona 2e-05
MTH00004 602 MTH00004, ND5, NADH dehydrogenase subunit 5; Validated 5e-05
MTH00108 602 MTH00108, ND5, NADH dehydrogenase subunit 5; Provisiona 6e-05
MTH00095527 MTH00095, ND5, NADH dehydrogenase subunit 5; Provisiona 6e-05
PRK07234470 PRK07234, PRK07234, putative monovalent cation/H+ antip 2e-25
PRK12650 962 PRK12650, PRK12650, putative monovalent cation/H+ antip 3e-19
MTH00144328 MTH00144, ND2, NADH dehydrogenase subunit 2; Provisiona 6e-13
MTH00196365 MTH00196, ND2, NADH dehydrogenase subunit 2; Provisiona 1e-11
MTH00200347 MTH00200, ND2, NADH dehydrogenase subunit 2; Provisiona 4e-09
MTH00197323 MTH00197, ND2, NADH dehydrogenase subunit 2; Provisiona 5e-08
MTH00011330 MTH00011, ND2, NADH dehydrogenase subunit 2; Validated 4e-07
MTH00211 597 MTH00211, ND5, NADH dehydrogenase subunit 5; Provisiona 4e-14
MTH00041349 MTH00041, ND2, NADH dehydrogenase subunit 2; Validated 2e-09
MTH00207 572 MTH00207, ND5, NADH dehydrogenase subunit 5; Provisiona 8e-12
PRK07390 613 PRK07390, PRK07390, NAD(P)H-quinone oxidoreductase subu 8e-10
MTH00165 573 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisiona 6e-07
PRK08168516 PRK08168, PRK08168, NADH dehydrogenase subunit L; Provi 3e-05
MTH00160335 MTH00160, ND2, NADH dehydrogenase subunit 2; Provisiona 4e-04
PRK08601509 PRK08601, PRK08601, NADH dehydrogenase subunit 5; Valid 0.001
CHL00025 741 CHL00025, ndhF, NADH dehydrogenase subunit 5 4e-04
MTH00112346 MTH00112, ND2, NADH dehydrogenase subunit 2; Provisiona 4e-04
MTH00105347 MTH00105, ND2, NADH dehydrogenase subunit 2; Provisiona 0.002
>gnl|CDD|180285 PRK05846, PRK05846, NADH:ubiquinone oxidoreductase subunit M; Reviewed Back     alignment and domain information
>gnl|CDD|162632 TIGR01972, NDH_I_M, proton-translocating NADH-quinone oxidoreductase, chain M Back     alignment and domain information
>gnl|CDD|164762 MTH00217, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|164750 MTH00204, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|180580 PRK06473, PRK06473, NAD(P)H-quinone oxidoreductase subunit D4; Validated Back     alignment and domain information
>gnl|CDD|40042 KOG4845, KOG4845, KOG4845, NADH dehydrogenase, subunit 4 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|179442 PRK02546, PRK02546, NAD(P)H-quinone oxidoreductase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|177262 MTH00226, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|180945 PRK07363, PRK07363, NAD(P)H-quinone oxidoreductase subunit M; Validated Back     alignment and domain information
>gnl|CDD|181404 PRK08375, PRK08375, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|30996 COG0651, HyfB, Formate hydrogenlyase subunit 3/Multisubunit Na+/H+ antiporter, MnhD subunit [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|181533 PRK08668, PRK08668, NADH dehydrogenase subunit M; Validated Back     alignment and domain information
>gnl|CDD|183667 PRK12667, PRK12667, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|180252 PRK05777, PRK05777, NADH:ubiquinone oxidoreductase subunit N; Provisional Back     alignment and domain information
>gnl|CDD|181405 PRK08376, PRK08376, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|183662 PRK12662, PRK12662, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|181537 PRK08676, PRK08676, hydrogenase membrane subunit; Validated Back     alignment and domain information
>gnl|CDD|162123 TIGR00940, 2a6301s01, Tmonovalent cation:proton antiporter Back     alignment and domain information
>gnl|CDD|162634 TIGR01974, NDH_I_L, proton-translocating NADH-quinone oxidoreductase, chain L Back     alignment and domain information
>gnl|CDD|31212 COG1008, NuoM, NADH:ubiquinone oxidoreductase subunit 4 (chain M) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|183596 PRK12561, PRK12561, NAD(P)H-quinone oxidoreductase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|176954 CHL00011, ndhD, NADH dehydrogenase subunit 4 Back     alignment and domain information
>gnl|CDD|31213 COG1009, NuoL, NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunit [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|180606 PRK06525, PRK06525, hydrogenase 4 subunit D; Validated Back     alignment and domain information
>gnl|CDD|180633 PRK06590, PRK06590, NADH:ubiquinone oxidoreductase subunit L; Reviewed Back     alignment and domain information
>gnl|CDD|164604 MTH00032, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|177207 MTH00150, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|177119 MTH00044, ND4, NADH dehydrogenase subunit 4; Validated Back     alignment and domain information
>gnl|CDD|177140 MTH00068, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|177183 MTH00124, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|164589 MTH00014, ND4, NADH dehydrogenase subunit 4; Validated Back     alignment and domain information
>gnl|CDD|177186 MTH00127, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|177172 MTH00110, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|130019 TIGR00944, 2a6301s04, Multicomponent K+:H+antiporter Back     alignment and domain information
>gnl|CDD|183665 PRK12665, PRK12665, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|183646 PRK12646, PRK12646, putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|180632 PRK06589, PRK06589, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|183647 PRK12647, PRK12647, putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|183645 PRK12645, PRK12645, monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|180634 PRK06591, PRK06591, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|177250 MTH00206, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|183663 PRK12663, PRK12663, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|31211 COG1007, NuoN, NADH:ubiquinone oxidoreductase subunit 2 (chain N) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|181085 PRK07691, PRK07691, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|181406 PRK08377, PRK08377, NADH dehydrogenase subunit N; Validated Back     alignment and domain information
>gnl|CDD|162524 TIGR01770, NDH_I_N, proton-translocating NADH-quinone oxidoreductase, chain N Back     alignment and domain information
>gnl|CDD|183649 PRK12649, PRK12649, putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|183668 PRK12668, PRK12668, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|180504 PRK06277, PRK06277, hydrogenase subunit F; Validated Back     alignment and domain information
>gnl|CDD|177219 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|177249 MTH00205, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|177134 MTH00062, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|109421 pfam00361, Oxidored_q1, NADH-Ubiquinone/plastoquinone (complex I), various chains Back     alignment and domain information
>gnl|CDD|177157 MTH00094, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|181532 PRK08667, PRK08667, hydrogenase membrane subunit; Validated Back     alignment and domain information
>gnl|CDD|183644 PRK12644, PRK12644, putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|131015 TIGR01960, ndhF3_CO2, NAD(P)H dehydrogenase, subunit NdhF3 family Back     alignment and domain information
>gnl|CDD|180572 PRK06459, PRK06459, hydrogenase 4 subunit B; Validated Back     alignment and domain information
>gnl|CDD|39867 KOG4668, KOG4668, KOG4668, NADH dehydrogenase subunits 2, 5, and related proteins [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|177138 MTH00066, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|183664 PRK12664, PRK12664, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|177142 MTH00070, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|180602 PRK06521, PRK06521, hydrogenase 4 subunit B; Validated Back     alignment and domain information
>gnl|CDD|180571 PRK06458, PRK06458, hydrogenase 4 subunit F; Validated Back     alignment and domain information
>gnl|CDD|181206 PRK08042, PRK08042, formate hydrogenlyase subunit 3; Reviewed Back     alignment and domain information
>gnl|CDD|183648 PRK12648, PRK12648, putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|164593 MTH00020, ND5, NADH dehydrogenase subunit 5; Reviewed Back     alignment and domain information
>gnl|CDD|179434 PRK02504, PRK02504, NAD(P)H-quinone oxidoreductase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|183666 PRK12666, PRK12666, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|176990 CHL00049, ndhB, NADH dehydrogenase subunit 2 Back     alignment and domain information
>gnl|CDD|177252 MTH00209, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|177253 MTH00210, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|180952 PRK07376, PRK07376, NAD(P)H-quinone oxidoreductase subunit F; Validated Back     alignment and domain information
>gnl|CDD|177245 MTH00199, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|164746 MTH00198, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|177208 MTH00151, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|177251 MTH00208, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|177100 MTH00004, ND5, NADH dehydrogenase subunit 5; Validated Back     alignment and domain information
>gnl|CDD|177170 MTH00108, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|177158 MTH00095, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|180900 PRK07234, PRK07234, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|183650 PRK12650, PRK12650, putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|177202 MTH00144, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|177243 MTH00196, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|177246 MTH00200, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|177244 MTH00197, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|164587 MTH00011, ND2, NADH dehydrogenase subunit 2; Validated Back     alignment and domain information
>gnl|CDD|177254 MTH00211, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|177116 MTH00041, ND2, NADH dehydrogenase subunit 2; Validated Back     alignment and domain information
>gnl|CDD|164753 MTH00207, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|180955 PRK07390, PRK07390, NAD(P)H-quinone oxidoreductase subunit F; Validated Back     alignment and domain information
>gnl|CDD|177220 MTH00165, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|181264 PRK08168, PRK08168, NADH dehydrogenase subunit L; Provisional Back     alignment and domain information
>gnl|CDD|177216 MTH00160, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|181498 PRK08601, PRK08601, NADH dehydrogenase subunit 5; Validated Back     alignment and domain information
>gnl|CDD|176967 CHL00025, ndhF, NADH dehydrogenase subunit 5 Back     alignment and domain information
>gnl|CDD|177174 MTH00112, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|177167 MTH00105, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 499 NADH dehydrogenase subunit M [Candidatus Liberibacter a
TIGR01972532 NDH_I_M proton-translocating NADH-quinone oxidoreductas 100.0
PRK05846495 NADH dehydrogenase subunit M; Reviewed 100.0
PRK02546531 NAD(P)H-quinone oxidoreductase subunit 4; Provisional 100.0
CHL00011500 ndhD NADH dehydrogenase subunit 4 100.0
COG1008497 NuoM NADH:ubiquinone oxidoreductase subunit 4 (chain M) 100.0
PRK06473500 NAD(P)H-quinone oxidoreductase subunit D4; Validated 100.0
PRK07691498 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK07363499 NAD(P)H-quinone oxidoreductase subunit M; Validated 100.0
PRK12663497 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
MTH00204486 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
PRK12561495 NAD(P)H-quinone oxidoreductase subunit 4; Provisional 100.0
MTH00217482 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
PRK08376513 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK12667517 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK08377493 NADH dehydrogenase subunit N; Validated 100.0
TIGR01974 691 NDH_I_L proton-translocating NADH-quinone oxidoreductas 100.0
PRK12662491 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK12665524 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK12666509 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK06521 670 hydrogenase 4 subunit B; Validated 100.0
PRK08668 616 NADH dehydrogenase subunit M; Validated 100.0
PRK08375481 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK12645 800 monovalent cation/H+ antiporter subunit A; Reviewed 100.0
PRK12649 800 putative monovalent cation/H+ antiporter subunit A; Rev 100.0
PRK12648 950 putative monovalent cation/H+ antiporter subunit A; Rev 100.0
PRK06590 619 NADH dehydrogenase subunit L; Reviewed 100.0
PRK06525480 hydrogenase 4 subunit D; Validated 100.0
PRK06458491 hydrogenase 4 subunit F; Validated 100.0
PRK08667 644 hydrogenase membrane subunit; Validated 100.0
PRK12644 968 putative monovalent cation/H+ antiporter subunit A; Rev 100.0
PRK12646 800 putative monovalent cation/H+ antiporter subunit A; Rev 100.0
PRK05777478 NADH dehydrogenase subunit N; Provisional 100.0
PRK12650 969 putative monovalent cation/H+ antiporter subunit A; Rev 100.0
PRK07390 615 NAD(P)H-quinone oxidoreductase subunit F; Validated 100.0
PRK07376 667 NAD(P)H-quinone oxidoreductase subunit F; Validated 100.0
TIGR00940 809 2a6301s01 monovalent cation:proton antiporter; InterPro 100.0
PRK06277479 hydrogenase subunit F; Validated 100.0
PRK08676486 hydrogenase membrane subunit; Validated 100.0
CHL00025 738 ndhF NADH dehydrogenase subunit 5 100.0
COG1009 606 NuoL NADH:ubiquinone oxidoreductase subunit 5 (chain L) 100.0
PRK06589484 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
MTH00210 618 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00020 608 ND5 NADH dehydrogenase subunit 5; Reviewed 100.0
PRK02504514 NAD(P)H-quinone oxidoreductase subunit 2; Provisional 100.0
MTH00032 677 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
PRK12668 569 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
MTH00014451 ND4 NADH dehydrogenase subunit 4; Validated 100.0
CHL00049498 ndhB NADH dehydrogenase subunit 2 100.0
MTH00206452 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
COG0651504 HyfB Formate hydrogenlyase subunit 3/Multisubunit Na+/H 100.0
PRK07234456 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
TIGR00944504 2a6301s04 Multicomponent K+:H+antiporter; InterPro: IPR 100.0
TIGR01960 613 ndhF3_CO2 NAD(P)H dehydrogenase, subunit NdhF3 family; 100.0
KOG4845452 consensus 100.0
PRK12647 761 putative monovalent cation/H+ antiporter subunit A; Rev 100.0
PRK08042 593 formate hydrogenlyase subunit 3; Reviewed 100.0
MTH00044460 ND4 NADH dehydrogenase subunit 4; Validated 100.0
MTH00068458 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00150447 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00110459 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00124457 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00066 598 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00004 604 ND5 NADH dehydrogenase subunit 5; Validated 100.0
MTH00114 600 consensus 100.0
MTH00127459 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00211 595 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
TIGR01770491 NDH_I_N proton-translocating NADH-quinone oxidoreductas 100.0
MTH00199454 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
MTH00205452 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00137 611 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
COG1007475 NuoN NADH:ubiquinone oxidoreductase subunit 2 (chain N) 100.0
MTH00163446 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00208 631 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00108 602 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00165 571 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00151566 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00209 565 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00207 572 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
PRK06459 578 hydrogenase 4 subunit B; Validated 100.0
PRK12664530 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
MTH00095527 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00096476 consensus 100.0
PRK06591433 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
MTH00196365 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
MTH00112345 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
MTH00198596 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
MTH00070346 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
MTH00105345 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
MTH00011333 ND2 NADH dehydrogenase subunit 2; Validated 100.0
MTH00135347 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
MTH00160336 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
pfam00361270 Oxidored_q1 NADH-Ubiquinone/plastoquinone (complex I), 100.0
MTH00091273 ND2 NADH dehydrogenase subunit 2; Provisional 99.31
MTH00094409 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00063519 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00062419 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
PRK06588504 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
MTH00200343 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
MTH00041350 ND2 NADH dehydrogenase subunit 2; Validated 100.0
MTH00144329 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
MTH00197325 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
KOG4668355 consensus 100.0
MTH00059288 ND2 NADH dehydrogenase subunit 2; Provisional 98.01
PRK08168514 NADH dehydrogenase subunit L; Provisional 100.0
PRK08601506 NADH dehydrogenase subunit 5; Validated 100.0
pfam10125219 NADHdeh_related NADH dehydrogenase I, subunit N related 98.46
COG4078221 Predicted membrane protein [Function unknown] 98.13
pfam0066262 Oxidored_q1_N NADH-Ubiquinone oxidoreductase (complex I 97.59
>TIGR01972 NDH_I_M proton-translocating NADH-quinone oxidoreductase, chain M; InterPro: IPR010227 This entry describes the 13th (based on Escherichia coli) structural gene, M, of bacterial NADH dehydrogenase I, as well as chain 4 of the corresponding mitochondrial complex I and of the chloroplast NAD(P)H dehydrogenase complex Back     alignment and domain information
>PRK05846 NADH dehydrogenase subunit M; Reviewed Back     alignment and domain information
>PRK02546 NAD(P)H-quinone oxidoreductase subunit 4; Provisional Back     alignment and domain information
>CHL00011 ndhD NADH dehydrogenase subunit 4 Back     alignment and domain information
>COG1008 NuoM NADH:ubiquinone oxidoreductase subunit 4 (chain M) [Energy production and conversion] Back     alignment and domain information
>PRK06473 NAD(P)H-quinone oxidoreductase subunit D4; Validated Back     alignment and domain information
>PRK07691 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>PRK07363 NAD(P)H-quinone oxidoreductase subunit M; Validated Back     alignment and domain information
>PRK12663 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>MTH00204 ND4 NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>PRK12561 NAD(P)H-quinone oxidoreductase subunit 4; Provisional Back     alignment and domain information
>MTH00217 ND4 NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>PRK08376 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>PRK12667 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>PRK08377 NADH dehydrogenase subunit N; Validated Back     alignment and domain information
>TIGR01974 NDH_I_L proton-translocating NADH-quinone oxidoreductase, chain L; InterPro: IPR003945 NADH-plastoquinone oxidoreductase chain 5 is part of the NADH-ubiquinone oxidoreductase (complex I), which catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane : NADH + ubiquinone = NAD(+) + ubiquinol ; GO: 0008137 NADH dehydrogenase (ubiquinone) activity, 0042773 ATP synthesis coupled electron transport Back     alignment and domain information
>PRK12662 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>PRK12665 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>PRK12666 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>PRK06521 hydrogenase 4 subunit B; Validated Back     alignment and domain information
>PRK08668 NADH dehydrogenase subunit M; Validated Back     alignment and domain information
>PRK08375 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>PRK12645 monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>PRK12649 putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>PRK12648 putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>PRK06590 NADH dehydrogenase subunit L; Reviewed Back     alignment and domain information
>PRK06525 hydrogenase 4 subunit D; Validated Back     alignment and domain information
>PRK06458 hydrogenase 4 subunit F; Validated Back     alignment and domain information
>PRK08667 hydrogenase membrane subunit; Validated Back     alignment and domain information
>PRK12644 putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>PRK12646 putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>PRK05777 NADH dehydrogenase subunit N; Provisional Back     alignment and domain information
>PRK12650 putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>PRK07390 NAD(P)H-quinone oxidoreductase subunit F; Validated Back     alignment and domain information
>PRK07376 NAD(P)H-quinone oxidoreductase subunit F; Validated Back     alignment and domain information
>TIGR00940 2a6301s01 monovalent cation:proton antiporter; InterPro: IPR005663 This family of proteins consists of bacterial multicomponent K+:H+ and Na+:H+ antiporters Back     alignment and domain information
>PRK06277 hydrogenase subunit F; Validated Back     alignment and domain information
>PRK08676 hydrogenase membrane subunit; Validated Back     alignment and domain information
>CHL00025 ndhF NADH dehydrogenase subunit 5 Back     alignment and domain information
>COG1009 NuoL NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunit [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK06589 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>MTH00210 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>MTH00020 ND5 NADH dehydrogenase subunit 5; Reviewed Back     alignment and domain information
>PRK02504 NAD(P)H-quinone oxidoreductase subunit 2; Provisional Back     alignment and domain information
>MTH00032 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>PRK12668 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>MTH00014 ND4 NADH dehydrogenase subunit 4; Validated Back     alignment and domain information
>CHL00049 ndhB NADH dehydrogenase subunit 2 Back     alignment and domain information
>MTH00206 ND4 NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>COG0651 HyfB Formate hydrogenlyase subunit 3/Multisubunit Na+/H+ antiporter, MnhD subunit [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07234 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>TIGR00944 2a6301s04 Multicomponent K+:H+antiporter; InterPro: IPR004775 A group of uncharacterised proteins some of which are similar to various chains of the NADH-ubiquinone/plastoquinone (complex I) Back     alignment and domain information
>TIGR01960 ndhF3_CO2 NAD(P)H dehydrogenase, subunit NdhF3 family; InterPro: IPR010217 This family represents NAD(P)H dehydrogenase subunit 5, or ndhF Back     alignment and domain information
>KOG4845 consensus Back     alignment and domain information
>PRK12647 putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>PRK08042 formate hydrogenlyase subunit 3; Reviewed Back     alignment and domain information
>MTH00044 ND4 NADH dehydrogenase subunit 4; Validated Back     alignment and domain information
>MTH00068 ND4 NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>MTH00150 ND4 NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>MTH00110 ND4 NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>MTH00124 ND4 NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>MTH00066 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information