254780867

254780867

NADH dehydrogenase subunit N

GeneID in NCBI database:8209882Locus tag:CLIBASIA_03810
Protein GI in NCBI database:254780867Protein Accession:YP_003065280.1
Gene range:+(835727, 837163)Protein Length:478aa
Gene description:NADH dehydrogenase subunit N
COG prediction:[C] NADH:ubiquinone oxidoreductase subunit 2 (chain N)
KEGG prediction:nuoN; NADH dehydrogenase subunit N (EC:1.6.99.5); K00343 NADH dehydrogenase I subunit N [EC:1.6.5.3]
SEED prediction:NADH-ubiquinone oxidoreductase chain N (EC 1.6.5.3)
Pathway involved in KEGG:Oxidative phosphorylation [PATH:las00190]
Subsystem involved in SEED:Respiratory Complex I
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM14 TM-Helix
TOPPRED12 TM-Helix
HMMTOP14 TM-Helix
MEMSAT14 TM-Helix
MEMSAT_SVM14 TM-Helix
PHOBIUS14 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------48
MSPVSFINDLRLCIPEIIIAFGILFLLLMGVFSRRKNAFHLVVFPVCLLSIALFFLLIMPYEGIGLGGAYISDRFSYFIKAILLMSSIIIFIKMFSCIYVKPFSCFEFPVIMLMAVLGMLCMISANDMISFYMSLELQSFALYVLIAMNRKSVFSIEAALKYFVLGAFSSAFLLYGISFIYGFTGCTGFSQIATSLFIGHRSFVLIVGVVLILVGLFFKMALVPFHMWIPDVYEGSPMFMTAFLATIPKFATTMALCRITSVFWPMLSGLLPIFMCVSIGSMVLGSVVAIRQKDLKRLMAYSSIGHAGYALIGFSTGMLGIVAMVRYMVIYLIMMIGFFSCILSLRRKDGNNIQNISDLAGLSRQDIFLTCALTIFLFSLAGIPPFAGFFGKYFLLISAVKREFYVLAIVALLSSVISAYYYLRVISIMWFDQSTECVVVVAKEMRLFIFGSILFVTGYFLIENILNSSIMKIVMSLF
ccHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcc
ccccEEccccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccccccccEEcccccHEEEEHHHHHHcccccccHHHHHHHccccHHcccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccccccccccHHHHcccccEEEEcccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccHcHccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHcHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccHHHHHHEccccccEccccEEEcccccccHccccccccccHEHHHHHHHHHHHccccccccccccccHccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccccccccEEEccccccccEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHc
mspvsfindlrlCIPEIIIAFGILFLLLMGVFSRRKNAFHLVVFPVCLLSIALFFLLIMpyegiglggayiSDRFSYFIKAILLMSSIIIFIKMFSCiyvkpfscfefPVIMLMAVLGMLCMISANDMISFYMSLELQSFALYVLIAMNRKSVFSIEAALKYFVLGAFSSAFLLYGISFIygftgctgfSQIATSLFIGHRSFVLIVGVVLILVGLFFKMalvpfhmwipdvyegspMFMTAFLATIPKFATTMALCRITSVfwpmlsgllpiFMCVSIGSMVLGSVVAIRQKDLKRLMAYSSIGHAGYALIGFSTGMLGIVAMVRYMVIYLIMMIGFFSCILSLRrkdgnniqnisdlaglsrqdIFLTCALTIFLFslagippfagffGKYFLLISAVKREFYVLAIVALLSSVISAYYYLRVISIMWFDQSTECVVVVAKEMRLFIFGSILFVTGYFLIENILNSSIMKIVMSLF
MSPVSFINDLRLCIPEIIIAFGILFLLLMGVFSRRKNAFHLVVFPVCLLSIALFFLLIMPYEGIGLGGAYISDRFSYFIKAILLMSSIIIFIKMFSCIYVKPFSCFEFPVIMLMAVLGMLCMISANDMISFYMSLELQSFALYVLIAMNRKSVFSIEAALKYFVLGAFSSAFLLYGISFIYGFTGCTGFSQIATSLFIGHRSFVLIVGVVLILVGLFFKMALVPFHMWIPDVYEGSPMFMTAFLATIPKFATTMALCRITSVFWPMLSGLLPIFMCVSIGSMVLGSVVAIRQKDLKRLMAYSSIGHAGYALIGFSTGMLGIVAMVRYMVIYLIMMIGFFSCILSLRRKDGNNIQNISDLAGLSRQDIFLTCALTIFLFSLAGIPPFAGFFGKYFLLISAVKREFYVLAIVALLSSVISAYYYLRVISIMWFDQSTECVVVVAKEMRLFIFGSILFVTGYFLIENILNSSIMKIVMSLF
MSPVSFINDLRLCIPEiiiafgilflllMGVFSRRKNAFHLVVFPVCLLSIALFFLLIMPYEGIGLGGAYISDRFSYFIKAillmssiiifikmfsciYVKPFSCFEFPVIMLMAVLGMLCMISANDMISFYMSLELQSFALYVLIAMNRKSVFSIEAALKYFVLGAFSSAFLLYGISFIYGFTGCTGFSQIATSLFIGHRSFvlivgvvlilvglFFKMALVPFHMWIPDVYEGSPMFMTAFLATIPKFATTMALCRITSVFWPMLSGLLPIFMCVSIGSMVLGSVVAIRQKDLKRLMAYSSIGHAGYALIGFSTGMLGIVAMVRYMVIYLIMMIGFFSCILSLRRKDGNNIQNISDLAGLSRQDIFLTCALTIFLFSLAGIPPFAGFFGKYFLLISAVKREFYVLAIVALLSSVISAYYYLRVISIMWFDQSTECVVVVAKEMRLFIFGSILFVTGYFLIENILNSSIMKIVMSLF
***VSFINDLRLCIPEIIIAFGILFLLLMGVFSRRKNAFHLVVFPVCLLSIALFFLLIMPYEGIGLGGAYISDRFSYFIKAILLMSSIIIFIKMFSCIYVKPFSCFEFPVIMLMAVLGMLCMISANDMISFYMSLELQSFALYVLIAMNRKSVFSIEAALKYFVLGAFSSAFLLYGISFIYGFTGCTGFSQIATSLFIGHRSFVLIVGVVLILVGLFFKMALVPFHMWIPDVYEGSPMFMTAFLATIPKFATTMALCRITSVFWPMLSGLLPIFMCVSIGSMVLGSVVAIRQKDLKRLMAYSSIGHAGYALIGFSTGMLGIVAMVRYMVIYLIMMIGFFSCILSLRRKDGNNIQNISDLAGLSRQDIFLTCALTIFLFSLAGIPPFAGFFGKYFLLISAVKREFYVLAIVALLSSVISAYYYLRVISIMWFDQSTECVVVVAKEMRLFIFGSILFVTGYFLIENILNSSIMKIVMSLF
MSPVSFINDLRLCIPEIIIAFGILFLLLMGVFSRRKNAFHLVVFPVCLLSIALFFLLIMPYEGIGLGGAYISDRFSYFIKAILLMSSIIIFIKMFSCIYVKPFSCFEFPVIMLMAVLGMLCMISANDMISFYMSLELQSFALYVLIAMNRKSVFSIEAALKYFVLGAFSSAFLLYGISFIYGFTGCTGFSQIATSLFIGHRSFVLIVGVVLILVGLFFKMALVPFHMWIPDVYEGSPMFMTAFLATIPKFATTMALCRITSVFWPMLSGLLPIFMCVSIGSMVLGSVVAIRQKDLKRLMAYSSIGHAGYALIGFSTGMLGIVAMVRYMVIYLIMMIGFFSCILSLRRKDGNNIQNISDLAGLSRQDIFLTCALTIFLFSLAGIPPFAGFFGKYFLLISAVKREFYVLAIVALLSSVISAYYYLRVISIMWFDQSTECVVVVAKEMRLFIFGSILFVTGYFLIENILNSSIMKIVMSLF
*SPVSFINDLRLCIPEIIIAFGILFLLLMGVFSRRKNAFHLVVFPVCLLSIALFFLLIMPYEGIGLGGAYISDRFSYFIKAILLMSSIIIFIKMFSCIYVKPFSCFEFPVIMLMAVLGMLCMISANDMISFYMSLELQSFALYVLIAMNRKSVFSIEAALKYFVLGAFSSAFLLYGISFIYGFTGCTGFSQIATSLFIGHRSFVLIVGVVLILVGLFFKMALVPFHMWIPDVYEGSPMFMTAFLATIPKFATTMALCRITSVFWPMLSGLLPIFMCVSIGSMVLGSVVAIRQKDLKRLMAYSSIGHAGYALIGFSTGMLGIVAMVRYMVIYLIMMIGFFSCILSLRRKDGNNIQNISDLAGLSRQDIFLTCALTIFLFSLAGIPPFAGFFGKYFLLISAVKREFYVLAIVALLSSVISAYYYLRVISIMWFDQSTECVVVVAKEMRLFIFGSILFVTGYFLIENILNSSIMKIVMSLF
oooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooo
xxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxx
oooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooo
oooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooo
ooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooo
oooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPVSFINDLRLCIPEIIIAFGILFLLLMGVFSRRKNAFHLVVFPVCLLSIALFFLLIMPYEGIGLGGAYISDRFSYFIKAILLMSSIIIFIKMFSCIYVKPFSCFEFPVIMLMAVLGMLCMISANDMISFYMSLELQSFALYVLIAMNRKSVFSIEAALKYFVLGAFSSAFLLYGISFIYGFTGCTGFSQIATSLFIGHRSFVLIVGVVLILVGLFFKMALVPFHMWIPDVYEGSPMFMTAFLATIPKFATTMALCRITSVFWPMLSGLLPIFMCVSIGSMVLGSVVAIRQKDLKRLMAYSSIGHAGYALIGFSTGMLGIVAMVRYMVIYLIMMIGFFSCILSLRRKDGNNIQNISDLAGLSRQDIFLTCALTIFLFSLAGIPPFAGFFGKYFLLISAVKREFYVLAIVALLSSVISAYYYLRVISIMWFDQSTECVVVVAKEMRLFIFGSILFVTGYFLIENILNSSIMKIVMSLF
MSPVSFINDLRLCIPEIIIAFGILFLLLMGVFSRRKNAFHLVVFPVCLLSIALFFLLIMPYEGIGLGGAYISDRFSYFIKAILLMSSIIIFIKMFSCIYVKPFSCFEFPVIMLMAVLGMLCMISANDMISFYMSLELQSFALYVLIAMNRKSVFSIEAALKYFVLGAFSSAFLLYGISFIYGFTGCTGFSQIATSLFIGHRSFVLIVGVVLILVGLFFKMALVPFHMWIPDVYEGSPMFMTAFLATIPKFATTMALCRITSVFWPMLSGLLPIFMCVSIGSMVLGSVVAIRQKDLKRLMAYSSIGHAGYALIGFSTGMLGIVAMVRYMVIYLIMMIGFFSCILSLRRKDGNNIQNISDLAGLSRQDIFLTCALTIFLFSLAGIPPFAGFFGKYFLLISAVKREFYVLAIVALLSSVISAYYYLRVISIMWFDQSTECVVVVAKEMRLFIFGSILFVTGYFLIENILNSSIMKIVMSLF
MSPVSFINDLRLCIPEIIIAFGILFLLLMGVFSRRKNAFHLVVFPVCLLSIALFFLLIMPYEGIGLGGAYISDRFSYFIKAILLMSSIIIFIKMFSCIYVKPFSCFEFPVIMLMAVLGMLCMISANDMISFYMSLELQSFALYVLIAMNRKSVFSIEAALKYFVLGAFSSAFLLYGISFIYGFTGCTGFSQIATSLFIGHRSFVLIVGVVLILVGLFFKMALVPFHMWIPDVYEGSPMFMTAFLATIPKFATTMALCRITSVFWPMLSGLLPIFMCVSIGSMVLGSVVAIRQKDLKRLMAYSSIGHAGYALIGFSTGMLGIVAMVRYMVIYLIMMIGFFSCILSLRRKDGNNIQNISDLAGLSRQDIFLTCALTIFLFSLAGIPPFAGFFGKYFLLISAVKREFYVLAIVALLSSVISAYYYLRVISIMWFDQSTECVVVVAKEMRLFIFGSILFVTGYFLIENILNSSIMKIVMSLF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target478 NADH dehydrogenase subunit N [Candidatus Liberibacter a
254780866499 NADH dehydrogenase subunit M [Candidatus Liberibac 2e-15
254780865 666 NADH dehydrogenase subunit L [Candidatus Liberibac 9e-09
>gi|254780866|ref|YP_003065279.1| NADH dehydrogenase subunit M [Candidatus Liberibacter asiaticus str. psy62] Length = 499 Back     alignment
 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 80/300 (26%), Positives = 142/300 (47%), Gaps = 10/300 (3%)

Query: 127 DMISFYMSLELQSFALYVLIAMNRKSVFSIEAALKYFVLGAFSSAFLLYGISFIYGFTGC 186
           DM+ FY+  E     ++V+I +   S   I AA K+F+   F S F+L+ I  +      
Sbjct: 133 DMLLFYIFFEASLIPMFVIIGVWGGSE-RIYAAYKFFLYTFFGSIFMLFAIVVMCWEKKT 191

Query: 187 TGFSQI-ATSLFIGHRSFVLIVGVVLILVGLFFKMALVPFHMWIPDVYEGSPMFMTAFLA 245
           +    + A S F     + + +           K+ + PFH W+P+ +  +P   + FLA
Sbjct: 192 SSIIDLYAMSKFPFSIQYWMWIA---FFCSFAIKIPMFPFHTWLPNAHVQAPTAGSVFLA 248

Query: 246 TIPKFATTMALCRITSVFWPMLSGLL-PIFMCVSIGSMVLGSVVAIRQKDLKRLMAYSSI 304
            I          R     +P+ S    P+   +S+ +++  S+V++ Q D+K+L+AYSSI
Sbjct: 249 GIMLKMGGYGCIRFLLPLFPLASQYFAPVIFFLSLIAIIYASLVSMVQTDIKKLIAYSSI 308

Query: 305 GHAGYALIGFSTGML-GIVAMVRYMVIYLIMMIGFFSCILSLRRKDGNNIQNISDLAGLS 363
            H GY  IG  +GM  G+   +  M+ + ++    F C+  +   D  + ++I    GL 
Sbjct: 309 AHMGYVTIGIFSGMKSGVEGAMFQMLSHGLVSSALFFCVGVIY--DRLHTRDIFAYGGLV 366

Query: 364 RQDIFLTCALTIFLFSLAGIPPFAGFFGKYFLLISAVKREFYVLAIVALLSSVISAYYYL 423
                    + +F  +  G+P  +GF G+ FL+I +V +    +A++A    V+SA Y L
Sbjct: 367 HNMPRYAVVMMVFTMANMGLPGTSGFIGE-FLVIMSVFQNSNTVAVLASFGVVLSALYSL 425

>gi|254780865|ref|YP_003065278.1| NADH dehydrogenase subunit L [Candidatus Liberibacter asiaticus str. psy62] Length = 666 Back     alignment
 Score = 53.1 bits (126), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 76/315 (24%), Positives = 138/315 (43%), Gaps = 48/315 (15%)

Query: 119 MLCMISANDMISFYMSLELQSFALYVLIAMNRKSVFSIEAALKYFVLGAFSS-------- 170
           ML ++S+++++  +   E    A Y+LI        +I+A++K FV+             
Sbjct: 129 MLVLVSSDNLLQMFFGWEGVGLASYLLIGFWSFKESAIKASMKAFVVNRIGDLGLILAIS 188

Query: 171 --AFLLYGISFIYGFTGCTGFSQIATSLFIG---HRSF------VLIVGVVLILVGLFF- 218
              +L + + F   F   + + +I  S+  G   HRSF      V     + I+  LFF 
Sbjct: 189 AIIYLFHSVDFDAVFQNASHYWKIGNSVSSGMVSHRSFSFFGIDVHPHDSIAIICLLFFL 248

Query: 219 ----KMALVPFHMWIPDVYEG-SPMFMTAFLATIPKFATTMALCRITSVFW--PMLSGLL 271
               K A +  H+W+PD  EG +P+      AT+   A    + R++ +F   P +   +
Sbjct: 249 GAMGKSAQLLLHVWLPDAMEGPTPVSALIHAATMVT-AGVFLVARMSPLFELSPFVLDCI 307

Query: 272 PIFMCVSIGSMVLGSVVAIRQKDLKRLMAYSSIGHAGYALIGFSTGMLG--IVAMVRYMV 329
            +  C+   +    + V + Q D+KR++AYS+    GY  +       G  I  +  +  
Sbjct: 308 TVLGCI---TAFFAATVGLVQHDIKRVIAYSTCSQLGYMFVALGCRAYGASIFHLFTHAF 364

Query: 330 IYLIMMIGFFSCILSLRRKDGNNIQNISDLAGLSRQDIFLTCALTIFLFSLA----GIPP 385
              ++ +G  S I ++  +     Q++  + GL    +  TC + I + +LA    GIP 
Sbjct: 365 FKALLFLGSGSVIHAVAGE-----QDMRRMGGLYPH-LPRTCWMMI-VGTLALTGFGIPE 417

Query: 386 ----FAGFFGKYFLL 396
               F+GFF K  +L
Sbjct: 418 TSIGFSGFFSKDIIL 432

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target478 NADH dehydrogenase subunit N [Candidatus Liberibacter a
315122712479 NADH dehydrogenase subunit N [Candidatus Liberibacter s 1 0.0
150396126480 NADH dehydrogenase subunit N [Sinorhizobium medicae WSM 1 1e-126
307301104480 proton-translocating NADH-quinone oxidoreductase, chain 1 1e-124
15965032480 NADH dehydrogenase subunit N [Sinorhizobium meliloti 10 1 1e-124
307317838480 proton-translocating NADH-quinone oxidoreductase, chain 1 1e-124
159184691480 NADH dehydrogenase subunit N [Agrobacterium tumefaciens 1 1e-120
227821632480 NADH dehydrogenase subunit N [Sinorhizobium fredii NGR2 1 1e-119
325292647480 NADH dehydrogenase I chain N [Agrobacterium sp. H13-3] 1 1e-118
116251480481 NADH dehydrogenase subunit N [Rhizobium leguminosarum b 1 1e-117
241204101481 NADH dehydrogenase subunit N [Rhizobium leguminosarum b 1 1e-117
>gi|315122712|ref|YP_004063201.1| NADH dehydrogenase subunit N [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 479 Back     alignment and organism information
 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/479 (77%), Positives = 424/479 (88%), Gaps = 1/479 (0%)

Query: 1   MSPVSFINDLRLCIPEIIIAFGILFLLLMGVFSRRKNAFHLVVFPVCLLSIALFFLLIMP 60
           M P+S I+D  LCIPEIIIA G LFLLLMGVFSRRKNAFHLVVFPV +LS+AL  L IMP
Sbjct: 1   MIPISCISDFFLCIPEIIIALGSLFLLLMGVFSRRKNAFHLVVFPVIVLSVALISLFIMP 60

Query: 61  YEGIGLGGAYISDRFSYFIKAILLMSSIIIFIKMFSCIYVKPFSCFEFPVIMLMAVLGML 120
           Y+GIGLGGAYISD FSYF K+I+L SSI++FI MFSCI+VKPFSCFEFPV++LMA+LGML
Sbjct: 61  YKGIGLGGAYISDSFSYFAKSIILGSSIMLFIMMFSCIHVKPFSCFEFPVVILMAILGML 120

Query: 121 CMISANDMISFYMSLELQSFALYVLIAMNRKSVFSIEAALKYFVLGAFSSAFLLYGISFI 180
           CMISANDM+SFYM+LELQS ALYV+IAMNR+SVFSIEAALKYFVLGA SSAFLLYG+SFI
Sbjct: 121 CMISANDMMSFYMALELQSLALYVVIAMNRESVFSIEAALKYFVLGAVSSAFLLYGMSFI 180

Query: 181 YGFTGCTGFSQIATSLFIGHRSFVLIVGVVLILVGLFFKMALVPFHMWIPDVYEGSPMFM 240
           YGFTG T FS I TSLF+G++S V+IVGVVLILVGLFFKMALVPFHMWIPDVYEGSPMF+
Sbjct: 181 YGFTGYTDFSHIVTSLFVGYKSSVVIVGVVLILVGLFFKMALVPFHMWIPDVYEGSPMFV 240

Query: 241 TAFLATIPKFATTMALCRITSVFWPMLSGLLPIFMCVSIGSMVLGSVVAIRQKDLKRLMA 300
           TAFLAT+PKFA TMAL RIT VFWPM+  LL IFM VS+GSMVLGS+VAI+Q+DLKRLMA
Sbjct: 241 TAFLATVPKFAITMALYRITIVFWPMIFDLLQIFMLVSVGSMVLGSIVAIKQQDLKRLMA 300

Query: 301 YSSIGHAGYALIGFSTG-MLGIVAMVRYMVIYLIMMIGFFSCILSLRRKDGNNIQNISDL 359
           YSSIGHAGYAL+GFS G +LGI AM+RYM+IYL+MMIGFF+C+LSLRRKDG+NI+NISDL
Sbjct: 301 YSSIGHAGYALLGFSAGTVLGISAMIRYMIIYLVMMIGFFACVLSLRRKDGSNIKNISDL 360

Query: 360 AGLSRQDIFLTCALTIFLFSLAGIPPFAGFFGKYFLLISAVKREFYVLAIVALLSSVISA 419
           +GLS+Q IFLT  LTI LFSLAGIPPFAGF GKYFLL+SAV R+FY+ A++ LLSSV+SA
Sbjct: 361 SGLSKQSIFLTSVLTILLFSLAGIPPFAGFLGKYFLLLSAVNRDFYIFAMIGLLSSVVSA 420

Query: 420 YYYLRVISIMWFDQSTECVVVVAKEMRLFIFGSILFVTGYFLIENILNSSIMKIVMSLF 478
           YYYLR++SIMWF+Q TE +++V K+M   I  S  FV GYFL ENILNS I  IV S+F
Sbjct: 421 YYYLRIVSIMWFNQPTEELILVGKQMSPIIIASTFFVVGYFLFENILNSWITTIVRSMF 479


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150396126|ref|YP_001326593.1| NADH dehydrogenase subunit N [Sinorhizobium medicae WSM419] Length = 480 Back     alignment and organism information
>gi|307301104|ref|ZP_07580873.1| proton-translocating NADH-quinone oxidoreductase, chain N [Sinorhizobium meliloti BL225C] Length = 480 Back     alignment and organism information
>gi|15965032|ref|NP_385385.1| NADH dehydrogenase subunit N [Sinorhizobium meliloti 1021] Length = 480 Back     alignment and organism information
>gi|307317838|ref|ZP_07597276.1| proton-translocating NADH-quinone oxidoreductase, chain N [Sinorhizobium meliloti AK83] Length = 480 Back     alignment and organism information
>gi|159184691|ref|NP_354293.2| NADH dehydrogenase subunit N [Agrobacterium tumefaciens str. C58] Length = 480 Back     alignment and organism information
>gi|227821632|ref|YP_002825602.1| NADH dehydrogenase subunit N [Sinorhizobium fredii NGR234] Length = 480 Back     alignment and organism information
>gi|325292647|ref|YP_004278511.1| NADH dehydrogenase I chain N [Agrobacterium sp. H13-3] Length = 480 Back     alignment and organism information
>gi|116251480|ref|YP_767318.1| NADH dehydrogenase subunit N [Rhizobium leguminosarum bv. viciae 3841] Length = 481 Back     alignment and organism information
>gi|241204101|ref|YP_002975197.1| NADH dehydrogenase subunit N [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 481 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target478 NADH dehydrogenase subunit N [Candidatus Liberibacter a
PRK05777476 PRK05777, PRK05777, NADH:ubiquinone oxidoreductase subu 1e-110
TIGR01770468 TIGR01770, NDH_I_N, proton-translocating NADH-quinone o 1e-82
PRK02504513 PRK02504, PRK02504, NAD(P)H-quinone oxidoreductase subu 9e-70
CHL00049494 CHL00049, ndhB, NADH dehydrogenase subunit 2 1e-67
MTH00199460 MTH00199, ND2, NADH dehydrogenase subunit 2; Provisiona 9e-63
PRK08375487 PRK08375, PRK08375, putative monovalent cation/H+ antip 2e-41
COG0651504 COG0651, HyfB, Formate hydrogenlyase subunit 3/Multisub 7e-30
PRK06277478 PRK06277, PRK06277, hydrogenase subunit F; Validated 9e-22
COG1009 606 COG1009, NuoL, NADH:ubiquinone oxidoreductase subunit 5 3e-21
KOG4845452 KOG4845, KOG4845, KOG4845, NADH dehydrogenase, subunit 2e-16
PRK08676485 PRK08676, PRK08676, hydrogenase membrane subunit; Valid 1e-14
MTH00196365 MTH00196, ND2, NADH dehydrogenase subunit 2; Provisiona 9e-57
KOG4668355 KOG4668, KOG4668, KOG4668, NADH dehydrogenase subunits 1e-24
TIGR00944463 TIGR00944, 2a6301s04, Multicomponent K+:H+antiporter 3e-14
PRK06589489 PRK06589, PRK06589, putative monovalent cation/H+ antip 1e-10
MTH00198607 MTH00198, ND2, NADH dehydrogenase subunit 2; Provisiona 4e-46
PRK08377494 PRK08377, PRK08377, NADH dehydrogenase subunit N; Valid 2e-37
PRK12662492 PRK12662, PRK12662, putative monovalent cation/H+ antip 2e-31
PRK08668 610 PRK08668, PRK08668, NADH dehydrogenase subunit M; Valid 5e-28
PRK12663497 PRK12663, PRK12663, putative monovalent cation/H+ antip 2e-26
MTH00200347 MTH00200, ND2, NADH dehydrogenase subunit 2; Provisiona 5e-25
COG1008497 COG1008, NuoM, NADH:ubiquinone oxidoreductase subunit 4 9e-25
MTH00144328 MTH00144, ND2, NADH dehydrogenase subunit 2; Provisiona 1e-24
MTH00112346 MTH00112, ND2, NADH dehydrogenase subunit 2; Provisiona 9e-23
MTH00041349 MTH00041, ND2, NADH dehydrogenase subunit 2; Validated 3e-22
TIGR01972479 TIGR01972, NDH_I_M, proton-translocating NADH-quinone o 1e-21
PRK12665521 PRK12665, PRK12665, putative monovalent cation/H+ antip 9e-21
PRK12650 962 PRK12650, PRK12650, putative monovalent cation/H+ antip 1e-19
MTH00160335 MTH00160, ND2, NADH dehydrogenase subunit 2; Provisiona 7e-19
MTH00011330 MTH00011, ND2, NADH dehydrogenase subunit 2; Validated 2e-18
PRK12647 761 PRK12647, PRK12647, putative monovalent cation/H+ antip 3e-18
PRK07234470 PRK07234, PRK07234, putative monovalent cation/H+ antip 7e-18
MTH00105347 MTH00105, ND2, NADH dehydrogenase subunit 2; Provisiona 1e-17
PRK07691496 PRK07691, PRK07691, putative monovalent cation/H+ antip 1e-17
PRK12646 800 PRK12646, PRK12646, putative monovalent cation/H+ antip 4e-17
PRK05846497 PRK05846, PRK05846, NADH:ubiquinone oxidoreductase subu 5e-17
PRK06458490 PRK06458, PRK06458, hydrogenase 4 subunit F; Validated 6e-17
MTH00197323 MTH00197, ND2, NADH dehydrogenase subunit 2; Provisiona 2e-16
TIGR00940 793 TIGR00940, 2a6301s01, Tmonovalent cation:proton antipor 5e-16
PRK07363501 PRK07363, PRK07363, NAD(P)H-quinone oxidoreductase subu 9e-16
PRK06473500 PRK06473, PRK06473, NAD(P)H-quinone oxidoreductase subu 2e-15
PRK06591432 PRK06591, PRK06591, putative monovalent cation/H+ antip 2e-14
TIGR01974 617 TIGR01974, NDH_I_L, proton-translocating NADH-quinone o 6e-14
MTH00204485 MTH00204, ND4, NADH dehydrogenase subunit 4; Provisiona 7e-13
PRK06525479 PRK06525, PRK06525, hydrogenase 4 subunit D; Validated 2e-12
MTH00226505 MTH00226, ND4, NADH dehydrogenase subunit 4; Provisiona 2e-11
PRK07376 673 PRK07376, PRK07376, NAD(P)H-quinone oxidoreductase subu 2e-11
TIGR01960 606 TIGR01960, ndhF3_CO2, NAD(P)H dehydrogenase, subunit Nd 3e-08
PRK12668 581 PRK12668, PRK12668, putative monovalent cation/H+ antip 2e-06
PRK06459 585 PRK06459, PRK06459, hydrogenase 4 subunit B; Validated 4e-06
MTH00127459 MTH00127, ND4, NADH dehydrogenase subunit 4; Provisiona 1e-05
MTH00020 610 MTH00020, ND5, NADH dehydrogenase subunit 5; Reviewed 5e-05
pfam00361270 pfam00361, Oxidored_q1, NADH-Ubiquinone/plastoquinone ( 4e-35
MTH00070346 MTH00070, ND2, NADH dehydrogenase subunit 2; Provisiona 1e-19
PRK12645 800 PRK12645, PRK12645, monovalent cation/H+ antiporter sub 6e-14
PRK12649 789 PRK12649, PRK12649, putative monovalent cation/H+ antip 5e-13
PRK12644 965 PRK12644, PRK12644, putative monovalent cation/H+ antip 9e-13
PRK06588 506 PRK06588, PRK06588, putative monovalent cation/H+ antip 7e-06
PRK12667520 PRK12667, PRK12667, putative monovalent cation/H+ antip 6e-35
COG1007475 COG1007, NuoN, NADH:ubiquinone oxidoreductase subunit 2 1e-81
PRK08376521 PRK08376, PRK08376, putative monovalent cation/H+ antip 1e-31
PRK08667 644 PRK08667, PRK08667, hydrogenase membrane subunit; Valid 2e-15
MTH00135347 MTH00135, ND2, NADH dehydrogenase subunit 2; Provisiona 2e-12
PRK06590 624 PRK06590, PRK06590, NADH:ubiquinone oxidoreductase subu 6e-06
PRK12666528 PRK12666, PRK12666, putative monovalent cation/H+ antip 4e-05
PRK07390 613 PRK07390, PRK07390, NAD(P)H-quinone oxidoreductase subu 0.004
MTH00217482 MTH00217, ND4, NADH dehydrogenase subunit 4; Provisiona 2e-11
MTH00032 669 MTH00032, ND5, NADH dehydrogenase subunit 5; Provisiona 4e-06
PRK06521 667 PRK06521, PRK06521, hydrogenase 4 subunit B; Validated 3e-10
PRK02546525 PRK02546, PRK02546, NAD(P)H-quinone oxidoreductase subu 8e-08
MTH00044458 MTH00044, ND4, NADH dehydrogenase subunit 4; Validated 7e-06
CHL00011498 CHL00011, ndhD, NADH dehydrogenase subunit 4 1e-04
MTH00163445 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisiona 2e-09
MTH00205448 MTH00205, ND4, NADH dehydrogenase subunit 4; Provisiona 3e-08
MTH00014452 MTH00014, ND4, NADH dehydrogenase subunit 4; Validated 3e-08
MTH00206450 MTH00206, ND4, NADH dehydrogenase subunit 4; Provisiona 7e-07
PRK12648 948 PRK12648, PRK12648, putative monovalent cation/H+ antip 3e-09
MTH00110459 MTH00110, ND4, NADH dehydrogenase subunit 4; Provisiona 2e-04
MTH00068458 MTH00068, ND4, NADH dehydrogenase subunit 4; Provisiona 0.003
PRK12561504 PRK12561, PRK12561, NAD(P)H-quinone oxidoreductase subu 2e-06
MTH00150417 MTH00150, ND4, NADH dehydrogenase subunit 4; Provisiona 4e-05
CHL00025 741 CHL00025, ndhF, NADH dehydrogenase subunit 5 0.001
MTH00124457 MTH00124, ND4, NADH dehydrogenase subunit 4; Provisiona 8e-04
MTH00210 616 MTH00210, ND5, NADH dehydrogenase subunit 5; Provisiona 0.004
>gnl|CDD|180252 PRK05777, PRK05777, NADH:ubiquinone oxidoreductase subunit N; Provisional Back     alignment and domain information
>gnl|CDD|162524 TIGR01770, NDH_I_N, proton-translocating NADH-quinone oxidoreductase, chain N Back     alignment and domain information
>gnl|CDD|179434 PRK02504, PRK02504, NAD(P)H-quinone oxidoreductase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|176990 CHL00049, ndhB, NADH dehydrogenase subunit 2 Back     alignment and domain information
>gnl|CDD|177245 MTH00199, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|181404 PRK08375, PRK08375, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|30996 COG0651, HyfB, Formate hydrogenlyase subunit 3/Multisubunit Na+/H+ antiporter, MnhD subunit [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|180504 PRK06277, PRK06277, hydrogenase subunit F; Validated Back     alignment and domain information
>gnl|CDD|31213 COG1009, NuoL, NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunit [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|40042 KOG4845, KOG4845, KOG4845, NADH dehydrogenase, subunit 4 [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|181537 PRK08676, PRK08676, hydrogenase membrane subunit; Validated Back     alignment and domain information
>gnl|CDD|177243 MTH00196, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|39867 KOG4668, KOG4668, KOG4668, NADH dehydrogenase subunits 2, 5, and related proteins [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|130019 TIGR00944, 2a6301s04, Multicomponent K+:H+antiporter Back     alignment and domain information
>gnl|CDD|180632 PRK06589, PRK06589, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|164746 MTH00198, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|181406 PRK08377, PRK08377, NADH dehydrogenase subunit N; Validated Back     alignment and domain information
>gnl|CDD|183662 PRK12662, PRK12662, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|181533 PRK08668, PRK08668, NADH dehydrogenase subunit M; Validated Back     alignment and domain information
>gnl|CDD|183663 PRK12663, PRK12663, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|177246 MTH00200, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|31212 COG1008, NuoM, NADH:ubiquinone oxidoreductase subunit 4 (chain M) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|177202 MTH00144, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|177174 MTH00112, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|177116 MTH00041, ND2, NADH dehydrogenase subunit 2; Validated Back     alignment and domain information
>gnl|CDD|162632 TIGR01972, NDH_I_M, proton-translocating NADH-quinone oxidoreductase, chain M Back     alignment and domain information
>gnl|CDD|183665 PRK12665, PRK12665, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|183650 PRK12650, PRK12650, putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|177216 MTH00160, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|164587 MTH00011, ND2, NADH dehydrogenase subunit 2; Validated Back     alignment and domain information
>gnl|CDD|183647 PRK12647, PRK12647, putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|180900 PRK07234, PRK07234, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|177167 MTH00105, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|181085 PRK07691, PRK07691, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|183646 PRK12646, PRK12646, putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|180285 PRK05846, PRK05846, NADH:ubiquinone oxidoreductase subunit M; Reviewed Back     alignment and domain information
>gnl|CDD|180571 PRK06458, PRK06458, hydrogenase 4 subunit F; Validated Back     alignment and domain information
>gnl|CDD|177244 MTH00197, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|162123 TIGR00940, 2a6301s01, Tmonovalent cation:proton antiporter Back     alignment and domain information
>gnl|CDD|180945 PRK07363, PRK07363, NAD(P)H-quinone oxidoreductase subunit M; Validated Back     alignment and domain information
>gnl|CDD|180580 PRK06473, PRK06473, NAD(P)H-quinone oxidoreductase subunit D4; Validated Back     alignment and domain information
>gnl|CDD|180634 PRK06591, PRK06591, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|162634 TIGR01974, NDH_I_L, proton-translocating NADH-quinone oxidoreductase, chain L Back     alignment and domain information
>gnl|CDD|164750 MTH00204, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|180606 PRK06525, PRK06525, hydrogenase 4 subunit D; Validated Back     alignment and domain information
>gnl|CDD|177262 MTH00226, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|180952 PRK07376, PRK07376, NAD(P)H-quinone oxidoreductase subunit F; Validated Back     alignment and domain information
>gnl|CDD|131015 TIGR01960, ndhF3_CO2, NAD(P)H dehydrogenase, subunit NdhF3 family Back     alignment and domain information
>gnl|CDD|183668 PRK12668, PRK12668, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|180572 PRK06459, PRK06459, hydrogenase 4 subunit B; Validated Back     alignment and domain information
>gnl|CDD|177186 MTH00127, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|164593 MTH00020, ND5, NADH dehydrogenase subunit 5; Reviewed Back     alignment and domain information
>gnl|CDD|109421 pfam00361, Oxidored_q1, NADH-Ubiquinone/plastoquinone (complex I), various chains Back     alignment and domain information
>gnl|CDD|177142 MTH00070, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|183645 PRK12645, PRK12645, monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|183649 PRK12649, PRK12649, putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|183644 PRK12644, PRK12644, putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|168619 PRK06588, PRK06588, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|183667 PRK12667, PRK12667, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|31211 COG1007, NuoN, NADH:ubiquinone oxidoreductase subunit 2 (chain N) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|181405 PRK08376, PRK08376, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|181532 PRK08667, PRK08667, hydrogenase membrane subunit; Validated Back     alignment and domain information
>gnl|CDD|177193 MTH00135, ND2, NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>gnl|CDD|180633 PRK06590, PRK06590, NADH:ubiquinone oxidoreductase subunit L; Reviewed Back     alignment and domain information
>gnl|CDD|183666 PRK12666, PRK12666, putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>gnl|CDD|180955 PRK07390, PRK07390, NAD(P)H-quinone oxidoreductase subunit F; Validated Back     alignment and domain information
>gnl|CDD|164762 MTH00217, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|164604 MTH00032, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>gnl|CDD|180602 PRK06521, PRK06521, hydrogenase 4 subunit B; Validated Back     alignment and domain information
>gnl|CDD|179442 PRK02546, PRK02546, NAD(P)H-quinone oxidoreductase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|177119 MTH00044, ND4, NADH dehydrogenase subunit 4; Validated Back     alignment and domain information
>gnl|CDD|176954 CHL00011, ndhD, NADH dehydrogenase subunit 4 Back     alignment and domain information
>gnl|CDD|177219 MTH00163, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|177249 MTH00205, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|164589 MTH00014, ND4, NADH dehydrogenase subunit 4; Validated Back     alignment and domain information
>gnl|CDD|177250 MTH00206, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|183648 PRK12648, PRK12648, putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|177172 MTH00110, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|177140 MTH00068, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|183596 PRK12561, PRK12561, NAD(P)H-quinone oxidoreductase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|177207 MTH00150, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|176967 CHL00025, ndhF, NADH dehydrogenase subunit 5 Back     alignment and domain information
>gnl|CDD|177183 MTH00124, ND4, NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>gnl|CDD|177253 MTH00210, ND5, NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 478 NADH dehydrogenase subunit N [Candidatus Liberibacter a
PRK05777478 NADH dehydrogenase subunit N; Provisional 100.0
PRK02504514 NAD(P)H-quinone oxidoreductase subunit 2; Provisional 100.0
CHL00049498 ndhB NADH dehydrogenase subunit 2 100.0
TIGR01974 691 NDH_I_L proton-translocating NADH-quinone oxidoreductas 100.0
PRK12667517 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK07691498 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK08377493 NADH dehydrogenase subunit N; Validated 100.0
PRK12662491 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK12663497 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK08375481 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
TIGR01770491 NDH_I_N proton-translocating NADH-quinone oxidoreductas 100.0
PRK12645 800 monovalent cation/H+ antiporter subunit A; Reviewed 100.0
PRK06590 619 NADH dehydrogenase subunit L; Reviewed 100.0
COG1007475 NuoN NADH:ubiquinone oxidoreductase subunit 2 (chain N) 100.0
PRK08376513 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK12649 800 putative monovalent cation/H+ antiporter subunit A; Rev 100.0
TIGR00940 809 2a6301s01 monovalent cation:proton antiporter; InterPro 100.0
TIGR01972532 NDH_I_M proton-translocating NADH-quinone oxidoreductas 100.0
MTH00199454 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
PRK12648 950 putative monovalent cation/H+ antiporter subunit A; Rev 100.0
PRK08667 644 hydrogenase membrane subunit; Validated 100.0
PRK12666509 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK12665524 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK07390 615 NAD(P)H-quinone oxidoreductase subunit F; Validated 100.0
PRK06525480 hydrogenase 4 subunit D; Validated 100.0
PRK05846495 NADH dehydrogenase subunit M; Reviewed 100.0
MTH00210 618 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
PRK06589484 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
MTH00020 608 ND5 NADH dehydrogenase subunit 5; Reviewed 100.0
PRK12668 569 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
TIGR00944504 2a6301s04 Multicomponent K+:H+antiporter; InterPro: IPR 100.0
TIGR01960 613 ndhF3_CO2 NAD(P)H dehydrogenase, subunit NdhF3 family; 100.0
PRK08668 616 NADH dehydrogenase subunit M; Validated 100.0
PRK06521 670 hydrogenase 4 subunit B; Validated 100.0
PRK12647 761 putative monovalent cation/H+ antiporter subunit A; Rev 100.0
PRK06458491 hydrogenase 4 subunit F; Validated 100.0
PRK06277479 hydrogenase subunit F; Validated 100.0
PRK12646 800 putative monovalent cation/H+ antiporter subunit A; Rev 100.0
PRK12644 968 putative monovalent cation/H+ antiporter subunit A; Rev 100.0
PRK06473500 NAD(P)H-quinone oxidoreductase subunit D4; Validated 100.0
MTH00204486 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00217482 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
PRK07363499 NAD(P)H-quinone oxidoreductase subunit M; Validated 100.0
PRK02546531 NAD(P)H-quinone oxidoreductase subunit 4; Provisional 100.0
CHL00011500 ndhD NADH dehydrogenase subunit 4 100.0
PRK12650 969 putative monovalent cation/H+ antiporter subunit A; Rev 100.0
COG1009 606 NuoL NADH:ubiquinone oxidoreductase subunit 5 (chain L) 100.0
PRK08676486 hydrogenase membrane subunit; Validated 100.0
PRK12561495 NAD(P)H-quinone oxidoreductase subunit 4; Provisional 100.0
PRK08042 593 formate hydrogenlyase subunit 3; Reviewed 100.0
MTH00014451 ND4 NADH dehydrogenase subunit 4; Validated 100.0
COG0651504 HyfB Formate hydrogenlyase subunit 3/Multisubunit Na+/H 100.0
MTH00114 600 consensus 100.0
MTH00004 604 ND5 NADH dehydrogenase subunit 5; Validated 100.0
MTH00066 598 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00211 595 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00044460 ND4 NADH dehydrogenase subunit 4; Validated 100.0
COG1008497 NuoM NADH:ubiquinone oxidoreductase subunit 4 (chain M) 100.0
MTH00068458 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00137 611 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00124457 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00110459 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00208 631 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00108 602 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00205452 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00127459 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00165 571 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00209 565 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00151 566 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00207 572 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
PRK06459 578 hydrogenase 4 subunit B; Validated 100.0
MTH00095527 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
PRK12664 530 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
MTH00198596 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
KOG4845452 consensus 100.0
PRK07376 667 NAD(P)H-quinone oxidoreductase subunit F; Validated 100.0
CHL00025 738 ndhF NADH dehydrogenase subunit 5 100.0
MTH00163446 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00096476 consensus 100.0
MTH00063519 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
MTH00094409 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00062419 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00032 677 ND5 NADH dehydrogenase subunit 5; Provisional 100.0
PRK06591433 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK07234456 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
MTH00206452 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00150447 ND4 NADH dehydrogenase subunit 4; Provisional 100.0
MTH00196365 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
MTH00011333 ND2 NADH dehydrogenase subunit 2; Validated 100.0
pfam00361270 Oxidored_q1 NADH-Ubiquinone/plastoquinone (complex I), 100.0
MTH00091273 ND2 NADH dehydrogenase subunit 2; Provisional 99.45
MTH00200343 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
MTH00112345 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
MTH00041350 ND2 NADH dehydrogenase subunit 2; Validated 100.0
MTH00070346 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
MTH00105345 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
MTH00135347 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
MTH00144329 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
MTH00197325 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
MTH00160336 ND2 NADH dehydrogenase subunit 2; Provisional 100.0
KOG4668355 consensus 100.0
MTH00059288 ND2 NADH dehydrogenase subunit 2; Provisional 98.22
PRK08168514 NADH dehydrogenase subunit L; Provisional 100.0
PRK08601506 NADH dehydrogenase subunit 5; Validated 100.0
PRK06588 504 putative monovalent cation/H+ antiporter subunit D; Rev 100.0
PRK12663497 putative monovalent cation/H+ antiporter subunit D; Rev 97.03
pfam10125219 NADHdeh_related NADH dehydrogenase I, subunit N related 96.77
COG4078221 Predicted membrane protein [Function unknown] 96.63
pfam0066262 Oxidored_q1_N NADH-Ubiquinone oxidoreductase (complex I 90.47
>PRK05777 NADH dehydrogenase subunit N; Provisional Back     alignment and domain information
>PRK02504 NAD(P)H-quinone oxidoreductase subunit 2; Provisional Back     alignment and domain information
>CHL00049 ndhB NADH dehydrogenase subunit 2 Back     alignment and domain information
>TIGR01974 NDH_I_L proton-translocating NADH-quinone oxidoreductase, chain L; InterPro: IPR003945 NADH-plastoquinone oxidoreductase chain 5 is part of the NADH-ubiquinone oxidoreductase (complex I), which catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane : NADH + ubiquinone = NAD(+) + ubiquinol ; GO: 0008137 NADH dehydrogenase (ubiquinone) activity, 0042773 ATP synthesis coupled electron transport Back     alignment and domain information
>PRK12667 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>PRK07691 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>PRK08377 NADH dehydrogenase subunit N; Validated Back     alignment and domain information
>PRK12662 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>PRK12663 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>PRK08375 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>TIGR01770 NDH_I_N proton-translocating NADH-quinone oxidoreductase, chain N; InterPro: IPR010096 This entry describes the 14th (based on Escherichia coli) structural gene, N, of bacterial and chloroplast energy-transducing NADH (or NADPH) dehydrogenases Back     alignment and domain information
>PRK12645 monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>PRK06590 NADH dehydrogenase subunit L; Reviewed Back     alignment and domain information
>COG1007 NuoN NADH:ubiquinone oxidoreductase subunit 2 (chain N) [Energy production and conversion] Back     alignment and domain information
>PRK08376 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>PRK12649 putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>TIGR00940 2a6301s01 monovalent cation:proton antiporter; InterPro: IPR005663 This family of proteins consists of bacterial multicomponent K+:H+ and Na+:H+ antiporters Back     alignment and domain information
>TIGR01972 NDH_I_M proton-translocating NADH-quinone oxidoreductase, chain M; InterPro: IPR010227 This entry describes the 13th (based on Escherichia coli) structural gene, M, of bacterial NADH dehydrogenase I, as well as chain 4 of the corresponding mitochondrial complex I and of the chloroplast NAD(P)H dehydrogenase complex Back     alignment and domain information
>MTH00199 ND2 NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>PRK12648 putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>PRK08667 hydrogenase membrane subunit; Validated Back     alignment and domain information
>PRK12666 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>PRK12665 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>PRK07390 NAD(P)H-quinone oxidoreductase subunit F; Validated Back     alignment and domain information
>PRK06525 hydrogenase 4 subunit D; Validated Back     alignment and domain information
>PRK05846 NADH dehydrogenase subunit M; Reviewed Back     alignment and domain information
>MTH00210 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>PRK06589 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>MTH00020 ND5 NADH dehydrogenase subunit 5; Reviewed Back     alignment and domain information
>PRK12668 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>TIGR00944 2a6301s04 Multicomponent K+:H+antiporter; InterPro: IPR004775 A group of uncharacterised proteins some of which are similar to various chains of the NADH-ubiquinone/plastoquinone (complex I) Back     alignment and domain information
>TIGR01960 ndhF3_CO2 NAD(P)H dehydrogenase, subunit NdhF3 family; InterPro: IPR010217 This family represents NAD(P)H dehydrogenase subunit 5, or ndhF Back     alignment and domain information
>PRK08668 NADH dehydrogenase subunit M; Validated Back     alignment and domain information
>PRK06521 hydrogenase 4 subunit B; Validated Back     alignment and domain information
>PRK12647 putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>PRK06458 hydrogenase 4 subunit F; Validated Back     alignment and domain information
>PRK06277 hydrogenase subunit F; Validated Back     alignment and domain information
>PRK12646 putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>PRK12644 putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>PRK06473 NAD(P)H-quinone oxidoreductase subunit D4; Validated Back     alignment and domain information
>MTH00204 ND4 NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>MTH00217 ND4 NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>PRK07363 NAD(P)H-quinone oxidoreductase subunit M; Validated Back     alignment and domain information
>PRK02546 NAD(P)H-quinone oxidoreductase subunit 4; Provisional Back     alignment and domain information
>CHL00011 ndhD NADH dehydrogenase subunit 4 Back     alignment and domain information
>PRK12650 putative monovalent cation/H+ antiporter subunit A; Reviewed Back     alignment and domain information
>COG1009 NuoL NADH:ubiquinone oxidoreductase subunit 5 (chain L)/Multisubunit Na+/H+ antiporter, MnhA subunit [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08676 hydrogenase membrane subunit; Validated Back     alignment and domain information
>PRK12561 NAD(P)H-quinone oxidoreductase subunit 4; Provisional Back     alignment and domain information
>PRK08042 formate hydrogenlyase subunit 3; Reviewed Back     alignment and domain information
>MTH00014 ND4 NADH dehydrogenase subunit 4; Validated Back     alignment and domain information
>COG0651 HyfB Formate hydrogenlyase subunit 3/Multisubunit Na+/H+ antiporter, MnhD subunit [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>MTH00114 consensus Back     alignment and domain information
>MTH00004 ND5 NADH dehydrogenase subunit 5; Validated Back     alignment and domain information
>MTH00066 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>MTH00211 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>MTH00044 ND4 NADH dehydrogenase subunit 4; Validated Back     alignment and domain information
>COG1008 NuoM NADH:ubiquinone oxidoreductase subunit 4 (chain M) [Energy production and conversion] Back     alignment and domain information
>MTH00068 ND4 NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>MTH00137 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>MTH00124 ND4 NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>MTH00110 ND4 NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>MTH00208 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>MTH00108 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>MTH00205 ND4 NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>MTH00127 ND4 NADH dehydrogenase subunit 4; Provisional Back     alignment and domain information
>MTH00165 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>MTH00209 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>MTH00151 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>MTH00207 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>PRK06459 hydrogenase 4 subunit B; Validated Back     alignment and domain information
>MTH00095 ND5 NADH dehydrogenase subunit 5; Provisional Back     alignment and domain information
>PRK12664 putative monovalent cation/H+ antiporter subunit D; Reviewed Back     alignment and domain information
>MTH00198 ND2 NADH dehydrogenase subunit 2; Provisional Back     alignment and domain information
>KOG4845 consensus Back     alignment and domain information
>PRK07376 NAD(P)H-quinone oxidoreductase subunit F; Validated Back     alignment and domain information