254780871

254780871

lipoprotein-releasing system ATP-binding protein lolD

GeneID in NCBI database:8209886Locus tag:CLIBASIA_03840
Protein GI in NCBI database:254780871Protein Accession:YP_003065284.1
Gene range:+(842362, 843045)Protein Length:227aa
Gene description:lipoprotein-releasing system ATP-binding protein lolD
COG prediction:[V] ABC-type antimicrobial peptide transport system, ATPase component
KEGG prediction:lipoprotein-releasing system ATP-binding protein LolD; K09810 lipoprotein-releasing system ATP-binding protein [EC:3.6.3.-]
SEED prediction:Lipoprotein releasing system ATP-binding protein LolD
Pathway involved in KEGG:ABC transporters [PATH:las02010]
Subsystem involved in SEED:Lipoprotein sorting system
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------
MDSAEVLLLQNVKHSYRQVGKPFPVLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNVIIANQLCNKLSDDKKSFLRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQRAMDLLSYMDMSQYANRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILKYLVVRSGLAALIATHNHDLASQMDRQITIRDGMIADL
ccccccEEEEEEEEEEccccccEEEEEcccEEEccccEEEEEccccccHHHHHHHHHcccccccEEEEEccEEcccccHHHHHHHHHccEEEEEccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHccccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHcEEEEEEccEEEEc
ccccccEEEEEEEEEEEEccEEEEEEEEEEEEEccccEEEEEccccccHHHHHHHHcccccccEEEEEEccEEcccccHHHHHHHHHHcEEEccHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHccccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHHccEEEEEEccHHHHHHHccEEEEEccEEEEc
MDSAEVLLLQNVKHsyrqvgkpfpvleNVHLSLKKGEIVAlvspsgtgksTILHIAgllevpdqgnVIIANQLCNKlsddkksflrcskIGFVYQEHRLLMDfsvieniifpqiiagiNHKTAYQRAMDLLSYMDMSqyanrrssdisggEQQRVAICRAIANkpliiladeptgnldlkTAQQVFSILKYLVVRSGLAALIATHNHDLASQMDRQITIRDGMIADL
MDSAEVLLLQNVkhsyrqvgkpfpVLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNVIIANQLCNKLSDDKKSFLRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQRAMDLLSYMDMSQYANRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILKYLVVRSGLAALIAThnhdlasqmdrqITIRDGMIADL
MDSAEVLLLQNVKHSYRQVGKPFPVLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNVIIANQLCNKLSDDKKSFLRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQRAMDLLSYMDMSQYANRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILKYLVVRSGLAALIATHNHDLASQMDRQITIRDGMIADL
**SAEVLLLQNVKHSYRQVGKPFPVLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNVIIANQLCNKLSDDKKSFLRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINH**A**RAMDLLSYMDMSQYANRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILKYLVVRSGLAALIATHNHDLASQMDRQITIRDGMIADL
MDSAEVLLLQNVKHSYRQVGKPFPVLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNVIIANQLCNKLSDDKKSFLRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQRAMDLLSYMDMSQYAN**********QQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILKYLVVRSGLAALIATHNHDLASQMDRQITIRDGMIADL
***AEVLLLQNVKHSYRQVGKPFPVLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNVIIANQLCNKLSDDKKSFLRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQRAMDLLSYMDMSQYANRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILKYLVVRSGLAALIATHNHDLASQMDRQITIRDGMIADL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSAEVLLLQNVKHSYRQVGKPFPVLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNVIIANQLCNKLSDDKKSFLRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQRAMDLLSYMDMSQYANRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILKYLVVRSGLAALIATHNHDLASQMDRQITIRDGMIADL
MDSAEVLLLQNVKHSYRQVGKPFPVLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNVIIANQLCNKLSDDKKSFLRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQRAMDLLSYMDMSQYANRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILKYLVVRSGLAALIATHNHDLASQMDRQITIRDGMIADL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target227 lipoprotein-releasing system ATP-binding protein lolD [
254780596 438 ABC transporter nucleotide binding/ATPase protein 1e-19
254780173257 ABC transporter related protein [Candidatus Liberi 2e-19
254780744262 ABC transporter nucleotide binding/ATPase protein 1e-17
254780538280 ABC transporter, nucleotide binding/ATPase protein 7e-17
254780559234 thiamine transporter ATP-binding subunit [Candidat 8e-17
254780917596 ABC transporter, nucleotide binding/ATPase protein 4e-16
254780139257 putative ATP-binding component of ABC transporter 8e-14
254780340348 proline/glycine betaine ABC transporter, ATP-bindi 9e-13
254780718240 putative high-affinity zinc uptake system ATP-bind 1e-12
254780704254 ABC transporter, nucleotide binding/ATPase protein 1e-11
254780273539 putative ABC transporter ATP-binding protein [Cand 1e-10
254780273 539 putative ABC transporter ATP-binding protein [Cand 1e-09
254780193528 lipid A ABC exporter family, fused ATPase and inne 1e-10
254781123 610 putative ABC transporter, ATP-binding protein [Can 1e-10
254781123 610 putative ABC transporter, ATP-binding protein [Can 3e-08
254780576597 ABC transporter related protein [Candidatus Liberi 1e-09
255764467565 Type I secretion system ATPase, PrtD [Candidatus L 1e-08
254780184959 excinuclease ABC subunit A [Candidatus Liberibacte 8e-05
254781060249 ABC transporter, nucleotide binding/ATPase protein 0.037
>gi|254780596|ref|YP_003065009.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 438 Back     alignment
 Score = 88.2 bits (217), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 66/216 (30%), Positives = 110/216 (50%), Gaps = 15/216 (6%)

Query: 6   VLLLQNVKHSY--RQVGKPFPVLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPD 63
           +L +Q++  S+  +++     VL+ V+ ++  GEIV L+  SG+GKST+L I   L  P 
Sbjct: 11  LLEIQDICQSFSLKKISGNLLVLDKVNFNVSSGEIVGLLGRSGSGKSTLLRIIAGLVSPS 70

Query: 64  QGNVIIANQLCNKLSDDKKSFLRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTA 123
            G V+   +   K+ D  K       I  V+Q   L    +V+EN+       GI+ +  
Sbjct: 71  SGQVLFKGK---KIKDPPKD------ISVVFQTFALFPWLTVLENVELGLKAKGIDKEER 121

Query: 124 YQRAMDLLSYMDMSQYANRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQ 183
            +RA+  +  + +  + +  +++ISGG  QRV   RA    P ++L DEP   LD+ TA+
Sbjct: 122 RKRALSAIDLIGLDGFESAHTTEISGGMLQRVGFARAFVVFPSLLLMDEPFSALDVLTAE 181

Query: 184 QVFSILKYLVVRSGL---AALIATHNHDLASQM-DR 215
            + + L  L +   L   + L+ THN + A  M DR
Sbjct: 182 NLRTDLIDLWIEGRLPIESMLMVTHNIEEAVLMCDR 217

>gi|254780173|ref|YP_003064586.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Back     alignment
 Score = 87.0 bits (214), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 68/207 (32%), Positives = 113/207 (54%), Gaps = 7/207 (3%)

Query: 23  FPVLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNVIIANQLCNKLSDDKK 82
           F  L +++L++ +GE V +  PSG+GKST++     +E    G +II N +   L+DD +
Sbjct: 30  FHALRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIII-NGI--PLNDDIR 86

Query: 83  SFLRCSK-IGFVYQEHRLLMDFSVIENIIF-PQIIAGINHKTAYQRAMDLLSYMDMSQYA 140
           +     + +G V+Q   L  + SV+EN    P  +  +  K A + AM  L+ + ++  +
Sbjct: 87  NIHEVRRDVGMVFQHFNLFSNLSVLENCTLGPIWVRKMPKKDAEELAMHYLNKVKIADKS 146

Query: 141 NRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILKYLVVRSGLAA 200
           +R SS +SGGE QR AI R++  +P I+L DEPT  LD +  ++V  I+  L    G+  
Sbjct: 147 HRSSSLLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPEMVKEVLDIMIEL-AEEGMTM 205

Query: 201 LIATHNHDLASQM-DRQITIRDGMIAD 226
           +  TH    A Q+ DR + +  G I +
Sbjct: 206 VCVTHEMGFARQVADRVVFMDQGQIVE 232

>gi|254780744|ref|YP_003065157.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Back     alignment
 Score = 81.3 bits (199), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/199 (27%), Positives = 104/199 (52%), Gaps = 5/199 (2%)

Query: 25  VLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNVIIANQLCNKLSDDKKSF 84
           V++ V L +K GEIV L+ P+G GK+T  ++   L   D G++ I      K+   +++ 
Sbjct: 40  VVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKMPMYRRAR 99

Query: 85  LRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQRAMDLLSYMDMSQYANRRS 144
           L    I ++ QE  +    +V ENI+    +   + K  +++   LL   +++++ +  +
Sbjct: 100 L---GISYLPQEASIFRGLTVEENILAVLEVYEKDKKKRHEKLDSLLKEFNITKWRHVLA 156

Query: 145 SDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILKYLVVRSGLAALIAT 204
             +SGG+++R+ I R++ + P  IL DEP   +D      +  +++ L  R G+  LI  
Sbjct: 157 PLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASR-GIGILITD 215

Query: 205 HN-HDLASQMDRQITIRDG 222
           HN H++ + +DR   I  G
Sbjct: 216 HNVHEILTLIDRAYIIHAG 234

>gi|254780538|ref|YP_003064951.1| ABC transporter, nucleotide binding/ATPase protein (iron) [Candidatus Liberibacter asiaticus str. psy62] Length = 280 Back     alignment
 Score = 79.0 bits (193), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 59/211 (27%), Positives = 112/211 (53%), Gaps = 17/211 (8%)

Query: 23  FPVLENVHLSLKKGEIVALVSPSGTGKSTILH-IAGLLEVPDQGNVIIANQLCNKLSDDK 81
           +  LE+V+L + +  I AL+  +G GKST+   I GL+ + D+G++ I NQ         
Sbjct: 25  YCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPL-DKGSISIFNQTV------- 76

Query: 82  KSFLRCSKIGFVYQEHRLLMDFSV-IENIIFPQIIAGINHKTA-----YQRAMDLLSYMD 135
           ++ L+   I ++ Q   +   F + +E+++       +N +       Y+   + L  + 
Sbjct: 77  ENALKADLIAYIPQTESIDWTFPILVEDVVMMGRYKHMNWRRVASNNDYRIVTEALENVG 136

Query: 136 MSQYANRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILKYLVVR 195
           MS    R+  ++S G+Q+RV + RA+A K  +I+ DEP   +D KT +++  +LK L + 
Sbjct: 137 MSSMRQRQIGELSIGQQKRVFLARALAQKSQVIIMDEPFAAIDFKTEREMIFLLKSL-LN 195

Query: 196 SGLAALIATHN-HDLASQMDRQITIRDGMIA 225
             +  L++THN + + S  DR I ++  ++A
Sbjct: 196 EDIMILVSTHNINSIPSFCDRTIFLKKTVLA 226

>gi|254780559|ref|YP_003064972.1| thiamine transporter ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 234 Back     alignment
 Score = 78.6 bits (192), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 99/200 (49%), Gaps = 17/200 (8%)

Query: 31  LSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNVIIANQLCNKLSDDKKSFLRCSKI 90
             + K E + ++ PSG GKST+L +    + P +G++ +  Q   + S  K+       +
Sbjct: 20  FQVNKAERIVILGPSGAGKSTLLSLMAGFKYPTRGSIFLNGQNHTRSSPSKRP------L 73

Query: 91  GFVYQEHRLLMDFSVIENI---IFPQIIAGINHKTAYQRAM--DLLSYMDMSQYANRRSS 145
             ++QE+ L    +V +NI   I P +   ++H   YQ A    +L  + +  + NR  S
Sbjct: 74  SILFQENNLFSHLTVWQNIALGIAPNL--RLDH---YQHAQVKQMLEKVFLEDFFNRFPS 128

Query: 146 DISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILKYLVVRSGLAALIATH 205
            +SGG++QRVA+ R +  +  I+L DEP    D     ++  +LK +     L  L+ +H
Sbjct: 129 QMSGGQRQRVALARCLIRQKPILLLDEPFAVFDPALRHEILGLLKQVCDERQLTLLMISH 188

Query: 206 NHDLASQM-DRQITIRDGMI 224
           N + + Q+  R I I  G I
Sbjct: 189 NLEDSMQIATRFIVIAGGQI 208

>gi|254780917|ref|YP_003065330.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 596 Back     alignment
 Score = 76.3 bits (186), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 110/224 (49%), Gaps = 15/224 (6%)

Query: 8   LLQNVKHSYRQVGKPFPVLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNV 67
           + ++V  SY+Q     PVL  ++L  K G++ ALV PSG+GKSTI+++   +  P  G++
Sbjct: 354 VFRDVFFSYKQ---GHPVLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSI 410

Query: 68  IIANQLCNKLSDDKKSFLRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQRA 127
            I       + D   S LR  +I +V Q+  L  + +V  NI+  + +A         ++
Sbjct: 411 EIDGI---NIRDITFSSLR-ERISYVGQDVFLFSN-TVRYNILIGRPMATEEEMIEIAKS 465

Query: 128 MDLLSY-MDMSQ----YANRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTA 182
            +   + M + Q    Y     S++SGG++QR+AI RA+     I++ DE T  LD  T 
Sbjct: 466 ANAHDFIMSLPQGYDTYVGENGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTE 525

Query: 183 QQVFSILKYLVVRSGLAALIATHNHDLASQMDRQITIRDGMIAD 226
             V   L  L+   G   ++  H      + D  I I DG +++
Sbjct: 526 NLVRQALSRLM--QGRTTIVIAHRISTIIEADHIIFIEDGKVSE 567

>gi|254780139|ref|YP_003064552.1| putative ATP-binding component of ABC transporter [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Back     alignment
 Score = 68.6 bits (166), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 104/211 (49%), Gaps = 28/211 (13%)

Query: 35  KGEIVALVSPSGTGKSTILH-IAGLLEVPD-QGNVIIANQLCNKLSDDKKSFLRCSKIGF 92
           +GEI+ ++  SGTGKS ++  I GL  +P   G V +  +  N L+  K++F   +K+G 
Sbjct: 38  RGEILGVIGSSGTGKSILMRGILGL--IPRVSGEVKVLGEHLN-LAKGKQNFAFSAKLGV 94

Query: 93  VYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQRAMDLLSYMDMS---------QYANRR 143
           ++Q   L    +V ENI  P        K       DL+ ++  +         + AN  
Sbjct: 95  LFQHGALFSSMTVQENISMPI-------KEHLNLPADLIEHIVHTKIAIVGLPPETANLM 147

Query: 144 SSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILKYLVVRSGLAALIA 203
              +SGG  +RV++ RA+A  P ++  DEPT  LD   A++   +L  L    GL+  + 
Sbjct: 148 PFQLSGGMIKRVSLARALAIDPDLLFLDEPTSGLDPIAAEEFDKLLIKLRHSLGLSVYMI 207

Query: 204 THN-HDLASQMDRQITI------RDGMIADL 227
           TH+ ++L S  +R   I      ++G I+D+
Sbjct: 208 THDLNNLISTCNRVAVIQKKGIMKEGTISDI 238

>gi|254780340|ref|YP_003064753.1| proline/glycine betaine ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Back     alignment
 Score = 65.1 bits (157), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 96/198 (48%), Gaps = 6/198 (3%)

Query: 30  HLSLKKGEIVALVSPSGTGKSTILH-IAGLLEVPDQGNVIIANQ--LCNKLSDDKKSF-- 84
           +L +KKGEI+ L+  SG GKST+L  I GL  V  +G V++       N  + D      
Sbjct: 49  NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVV-RGEVLVDTDKGFVNPYAADANVLRK 107

Query: 85  LRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQRAMDLLSYMDMSQYANRRS 144
           LR   +  V+Q+  LL   +V  N+        I       R  + L  ++++++A+ + 
Sbjct: 108 LRMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPDVERKSRVAEHLEIVNLTKWADCKI 167

Query: 145 SDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILKYLVVRSGLAALIAT 204
           + +SGG +QRV   RA A    I+L DEP  +LD     ++   L  L  +     +  +
Sbjct: 168 NMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLKKTIVFVS 227

Query: 205 HNHDLASQMDRQITIRDG 222
           H+ + A ++  +I I +G
Sbjct: 228 HDINEAFRLGNRIAIMEG 245

>gi|254780718|ref|YP_003065131.1| putative high-affinity zinc uptake system ATP-binding component of ABC transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 240 Back     alignment
 Score = 64.7 bits (156), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 98/203 (48%), Gaps = 27/203 (13%)

Query: 23  FPVLENVHLSLKKGEIVALVSPSGTGKSTILH-IAGLLEVPDQGNVIIANQLCNKLSDDK 81
           + +L++++ ++K  EIV L+ P+G+GKSTI   I G+++ P  G+V    QL        
Sbjct: 23  YKILQDINFTIKPNEIVTLIGPNGSGKSTIAKLITGIIK-PTIGSVKRHPQLI------- 74

Query: 82  KSFLRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQR--AMDLLSYMDMSQY 139
                   +G+V Q+         IEN +   ++  +       R   + +L  +++   
Sbjct: 75  --------VGYVPQK-------VTIENTLPLSLMRFMTLSMPSSRDDVLQILDRVNLIGK 119

Query: 140 ANRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILKYLVVRSGLA 199
            NR   D+SGGE QR  + +A+  KP +++ DEP   +D      ++ ++  +   +G  
Sbjct: 120 YNRNIKDLSGGEFQRALLAKALLRKPNLLVLDEPLQGIDFPGELSLYELITSVRQSTGCG 179

Query: 200 ALIATHN-HDLASQMDRQITIRD 221
            L+ +HN H + +  D  I + +
Sbjct: 180 ILLISHNLHMVMASTDTVICLNN 202

>gi|254780704|ref|YP_003065117.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 254 Back     alignment
 Score = 61.6 bits (148), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 98/202 (48%), Gaps = 16/202 (7%)

Query: 26  LENVHLSLKKGEIVALVSPSGTGKSTILHIAGLL-EVPDQ----GNVIIANQLCNKLSDD 80
           L +++L + +  + AL+ PSG GKST L     + E  D     G +I+  +   + S D
Sbjct: 22  LFDINLKIPQNSVTALIGPSGCGKSTFLRCLNRMNETIDNCVFTGEIILDGKNIYQSSVD 81

Query: 81  KKSFLRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQRAMDLLSYMDMSQYA 140
               LR +++G V+Q        S+ +N+ +   I G+ +  A    +  +S    S + 
Sbjct: 82  VVR-LR-ARVGMVFQRPNPFPK-SIYDNVAYGPRIHGLGNNKADIDQIVEMSLKKASLFN 138

Query: 141 NRR------SSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILKYLVV 194
             +      +S +SGG+QQRV I RA+A  P +IL DEP   LD      V  ++  L  
Sbjct: 139 EVKDRLFHDASLLSGGQQQRVCIARALAVNPEVILMDEPCSALDPIATASVEELIHEL-- 196

Query: 195 RSGLAALIATHNHDLASQMDRQ 216
           R  L  +I TH+   A+++ ++
Sbjct: 197 RESLTIVIVTHSMQQAARVSQR 218

>gi|254780273|ref|YP_003064686.1| putative ABC transporter ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 539 Back     alignment
 Score = 58.5 bits (140), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 71/158 (44%), Gaps = 17/158 (10%)

Query: 25  VLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNVIIANQLCNKLSDDKKSF 84
           +++N+   L  G IV ++ P+G GK+T+  +    E PD G + +   +C    D  +  
Sbjct: 332 LIDNLSFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPDSGTIHVGETVCLSYVDQSRDS 391

Query: 85  LRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQRAM-DLLSYMDMSQYANRR 143
           L   K              +V E+I     I  +N      RA     ++    Q   +R
Sbjct: 392 LEAEK--------------TVWEDISGGDDIVKLNGHEINSRAYCSAFNFKGGDQ--QQR 435

Query: 144 SSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKT 181
              +SGG++ RV + + + +   +IL DEPT +LD +T
Sbjct: 436 IGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTET 473

>gi|254780273|ref|YP_003064686.1| putative ABC transporter ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 539 Back     alignment
 Score = 55.1 bits (131), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/218 (27%), Positives = 97/218 (44%), Gaps = 62/218 (28%)

Query: 25  VLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNVIIANQLCNKLSDDKKSF 84
           VL++++LS      + ++ P+G GKSTIL I   ++    G   +A              
Sbjct: 21  VLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGIDKEYNGEAWLATGFT---------- 70

Query: 85  LRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTA----YQRAMDLLSYMDMSQYA 140
                +G++ QE +L +  +V ENII      G+ HK A    Y   M  ++Y + ++  
Sbjct: 71  -----VGYLPQEPQLDLSKTVKENII-----EGVAHKQAILDRYNELM--MNYSEKTEEE 118

Query: 141 NRRSSDI--------------------------------SGGEQQRVAICRAIANKPLII 168
             +  DI                                SGGE++RVA+C+ + + P ++
Sbjct: 119 IAKLQDIIDSKGLWDLETEVQVAIESLHCPADGLNITSLSGGEKRRVALCKLLLSSPDLL 178

Query: 169 LADEPTGNLDLKTAQQVFSILKYLVVRSGLAALIATHN 206
           L DEPT +LD   A+ +  + KYL   SG A L+ TH+
Sbjct: 179 LLDEPTNHLD---AETIAWMEKYLREYSG-AVLMVTHD 212

>gi|254780193|ref|YP_003064606.1| lipid A ABC exporter family, fused ATPase and inner membrane subunits [Candidatus Liberibacter asiaticus str. psy62] Length = 528 Back     alignment
 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 104/229 (45%), Gaps = 30/229 (13%)

Query: 15  SYRQVGKPFP------VLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNVI 68
           S+R V   +P      +L+NV+ +++ GE +ALV  SG GK++I  +      P  G+V 
Sbjct: 289 SFRSVSFVYPGKSKRSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSGSVE 348

Query: 69  IANQLCNKLS-DDKKSFLRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQ-- 125
           I       LS ++ + F     I +V Q H +++  SV +NI       G  H T  +  
Sbjct: 349 IEGIDLRLLSLEEIRRF-----IAWVPQ-HPIMIAASVYDNIAI-----GCPHATRKEIQ 397

Query: 126 ------RAMDLLSYMD--MSQYANRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNL 177
                 +A + +  ++          +  +S G+ QR+AI RAI     I+L DE    L
Sbjct: 398 NAAMLAQAHEFIGCLENGYDTILGDGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSAL 457

Query: 178 DLKTAQQVFSILKYLVVRSGLAALIATHNHDLASQMDRQITIRDGMIAD 226
           D++  Q+++ +L+    R G   + A+H        D    + D +I +
Sbjct: 458 DIENEQKIWKVLREQ--RRGRTTIFASHRLSAIQDADMVFVLHDQVIVE 504

>gi|254781123|ref|YP_003065536.1| putative ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 610 Back     alignment
 Score = 58.2 bits (139), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/157 (29%), Positives = 78/157 (49%), Gaps = 21/157 (13%)

Query: 25  VLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNVIIANQLCNKLSDDKKSF 84
           +L++V LS+K  E + LV  +G+GKST+L IA  +  P  GNV + +             
Sbjct: 20  LLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNVFLHS------------- 66

Query: 85  LRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQRAMDLLSYMDMSQYANRRS 144
              S++G++ Q    L  FS I   I   I   I    A      LL   ++ +    R 
Sbjct: 67  --SSRLGYLEQNPD-LSHFSTISQYIDDTIKDTIE---APYSPYSLLKKFNLRE--QDRI 118

Query: 145 SDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKT 181
            ++S G+ + VA+ + + ++P I++ DEPT +LD +T
Sbjct: 119 ENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRT 155

>gi|254781123|ref|YP_003065536.1| putative ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 610 Back     alignment
 Score = 50.1 bits (118), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 86/194 (44%), Gaps = 21/194 (10%)

Query: 25  VLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNVIIANQLCNKLSDDKKSF 84
           V+++  L +  GE + +V P+G GK+T+L +      PD G + +   L     D K+  
Sbjct: 299 VVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITLGTNLKIATIDQKRED 358

Query: 85  LRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQRAMDLLSYMDMSQYANRRS 144
           +   K    Y      +  S  ++++   +     H   Y +  D L + D    A+   
Sbjct: 359 IDPDKSLASY------LTGSSGDSLM---VRGESRHVAGYIK--DFLFHPDQ---AHSLM 404

Query: 145 SDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILKYLVVRSGLAALIAT 204
             +SGGE+ R  + R +A     ++ DEPT +LD +T       L+  + +     LI +
Sbjct: 405 KHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFET----LDFLERTITQLQGTILIVS 460

Query: 205 HNHDLASQMDRQIT 218
           H+ D    +DR +T
Sbjct: 461 HDRDF---LDRTVT 471

>gi|254780576|ref|YP_003064989.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 597 Back     alignment
 Score = 55.1 bits (131), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 94/225 (41%), Gaps = 15/225 (6%)

Query: 7   LLLQNVKHSYRQVGKPFPVLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGN 66
           ++  NV  SY      F   + +   +   +  AL+  SG GKST+  +   L     G 
Sbjct: 357 IVFNNVSFSYNHHNCIF---KGISFEIAPSKKTALIGESGVGKSTVAKLLYRLYDIKGGI 413

Query: 67  VIIANQLCNKLSDDKKSFLRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQR 126
           + I  Q   K++ +    LR + IG + Q+  L  D ++  NI++    A      A   
Sbjct: 414 ITIDGQDIKKITKES---LRQT-IGIIPQDTILFND-TLRYNILYGNPNASDQELCAAVE 468

Query: 127 AMDLLSYM-----DMSQYANRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKT 181
              L S++             R   +SGGE+QRV+I RAI   P II+ DE T +LD+ T
Sbjct: 469 VAQLKSFIMKLPNGYDTVVGERGLKLSGGEKQRVSIARAILKNPPIIIFDEATSSLDIIT 528

Query: 182 AQQVFSILKYLVVRSGLAALIATHNHDLASQMDRQITIRDGMIAD 226
            + + + L  L        L+  H     +  D  I    G + +
Sbjct: 529 ERHIQTALATL--SKNRTTLVIAHRLSTITDADNIIVFDQGTVVE 571

>gi|255764467|ref|YP_003064798.2| Type I secretion system ATPase, PrtD [Candidatus Liberibacter asiaticus str. psy62] Length = 565 Back     alignment
 Score = 51.6 bits (122), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 81/170 (47%), Gaps = 10/170 (5%)

Query: 25  VLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNVIIANQLCNKLSDDKKSF 84
           + +N+  ++ +G    +  PSG GKS  L     L   ++G +   ++  ++   +K S 
Sbjct: 347 ICQNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGLLTLEKGTISFGDRQISRDFIEKFS- 405

Query: 85  LRCSKIGFVYQEHRLLMDFSVIENIIFP--QIIAGINHKTAYQRAM--DLLSYMDMSQYA 140
              ++IG++ Q H  L   S+ ENII    Q    I  KTA       D+LS  +  Q  
Sbjct: 406 ---AQIGYLSQ-HCSLFPISITENIILSHDQNSLHIAQKTAKIVGCHEDILSLKNGYQ-T 460

Query: 141 NRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTAQQVFSILK 190
              S +I     Q++ + R IAN P I+L DEP  +LD +     +++LK
Sbjct: 461 TYCSDEIPYNIVQKIRLSRIIANNPAILLMDEPLYHLDNEAKNNFYTLLK 510

>gi|254780184|ref|YP_003064597.1| excinuclease ABC subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 959 Back     alignment
 Score = 38.9 bits (89), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 59/118 (50%), Gaps = 9/118 (7%)

Query: 100 LMDFSVIENIIFPQIIAGINHKTAYQRAMDLLSYMDMSQYANRRSSDISGGEQQRVAICR 159
           ++  +V E++ F   I  I++K    + + L  Y+ + Q AN     +SGGE QRV + +
Sbjct: 804 VLSMTVDESLDFFAAIPTIHNKLTTLKEVGL-GYIKIGQSAN----TLSGGESQRVKLAK 858

Query: 160 AIANKP---LIILADEPTGNLDLKTAQQVFSILKYLVVRSGLAALIATHNHDLASQMD 214
            ++ +     + + DEPT  L      ++ +IL  LV R G + ++  HN ++    D
Sbjct: 859 ELSKQATGNTLYILDEPTTGLHYHDIAKLLNILHTLVDR-GNSIIVIEHNLEVIKTAD 915

>gi|254781060|ref|YP_003065473.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 249 Back     alignment
 Score = 30.0 bits (66), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 10/31 (32%), Positives = 24/31 (77%)

Query: 25 VLENVHLSLKKGEIVALVSPSGTGKSTILHI 55
          ++  ++L ++  E+VA++ P+G+GKST+ ++
Sbjct: 18 IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYL 48

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target227 lipoprotein-releasing system ATP-binding protein lolD [
315122707228 lipoprotein-releasing system ATP-binding protein lolD [ 1 3e-96
254718931227 Lipoprotein-releasing system ATP-binding protein lolD [ 1 2e-68
163843097227 lipoprotein-releasing system ATP-binding protein lolD [ 1 2e-68
239831706227 Lipoprotein-releasing system ATP-binding protein lolD [ 1 3e-68
13471385242 ATP-binding protein of ABC transporter [Mesorhizobium l 1 5e-68
47605919226 RecName: Full=Lipoprotein-releasing system ATP-binding 1 8e-68
153009731227 ABC transporter-like protein [Ochrobactrum anthropi ATC 1 1e-67
23501711227 lipoprotein releasing system ATP-binding protein LolD [ 1 2e-67
256060934227 Lipoprotein-releasing system ATP-binding protein lolD [ 1 2e-67
260566614227 lipoprotein-releasing system ATP-binding protein lolD [ 1 3e-67
>gi|315122707|ref|YP_004063196.1| lipoprotein-releasing system ATP-binding protein lolD [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 228 Back     alignment and organism information
 Score =  355 bits (910), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 180/224 (80%), Positives = 202/224 (90%)

Query: 1   MDSAEVLLLQNVKHSYRQVGKPFPVLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLE 60
           + + EVLLLQN+KHSY QVGK FPVLENVHLSLKKGE+VALVSPSGTGKSTILHIAGLLE
Sbjct: 2   LSNTEVLLLQNIKHSYYQVGKYFPVLENVHLSLKKGEMVALVSPSGTGKSTILHIAGLLE 61

Query: 61  VPDQGNVIIANQLCNKLSDDKKSFLRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINH 120
            PD+G++II +Q CN+LSD+KK+FLRC+KIGFVYQ HRLL DFSVIENII PQIIAG++H
Sbjct: 62  NPDKGDIIIDSQSCNQLSDEKKAFLRCTKIGFVYQAHRLLTDFSVIENIIIPQIIAGVDH 121

Query: 121 KTAYQRAMDLLSYMDMSQYANRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLK 180
            TA+QRAM++L YM M+ YANR SSDISGGEQQRVAICRA+ANKPLIILADEPTGNLD K
Sbjct: 122 NTAHQRAMEILDYMGMAPYANRNSSDISGGEQQRVAICRAVANKPLIILADEPTGNLDPK 181

Query: 181 TAQQVFSILKYLVVRSGLAALIATHNHDLASQMDRQITIRDGMI 224
           TAQ+VF  LK LV R GLA L+ATHNHDLASQMDRQITI+DGMI
Sbjct: 182 TAQRVFGFLKDLVARFGLATLVATHNHDLASQMDRQITIKDGMI 225


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|254718931|ref|ZP_05180742.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella sp. 83/13] Length = 227 Back     alignment and organism information
>gi|163843097|ref|YP_001627501.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella suis ATCC 23445] Length = 227 Back     alignment and organism information
>gi|239831706|ref|ZP_04680035.1| Lipoprotein-releasing system ATP-binding protein lolD [Ochrobactrum intermedium LMG 3301] Length = 227 Back     alignment and organism information
>gi|13471385|ref|NP_102951.1| ATP-binding protein of ABC transporter [Mesorhizobium loti MAFF303099] Length = 242 Back     alignment and organism information
>gi|47605919|sp|Q98KS7|LOLD_RHILO RecName: Full=Lipoprotein-releasing system ATP-binding protein LolD Length = 226 Back     alignment and organism information
>gi|153009731|ref|YP_001370946.1| ABC transporter-like protein [Ochrobactrum anthropi ATCC 49188] Length = 227 Back     alignment and organism information
>gi|23501711|ref|NP_697838.1| lipoprotein releasing system ATP-binding protein LolD [Brucella suis 1330] Length = 227 Back     alignment and organism information
>gi|256060934|ref|ZP_05451092.1| Lipoprotein-releasing system ATP-binding protein lolD [Brucella neotomae 5K33] Length = 227 Back     alignment and organism information
>gi|260566614|ref|ZP_05837084.1| lipoprotein-releasing system ATP-binding protein lolD [Brucella suis bv. 4 str. 40] Length = 227 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target227 lipoprotein-releasing system ATP-binding protein lolD [
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide transport 5e-61
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, 1e-56
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-binding sub 1e-53
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell divisi 3e-47
COG4181228 COG4181, COG4181, Predicted ABC-type transport system i 6e-45
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein FtsE 1e-43
TIGR00960216 TIGR00960, 3a0501s02, Type II (General) Secretory Pathw 4e-43
PRK10535 648 PRK10535, PRK10535, macrolide transporter ATP-binding / 7e-41
cd03256241 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosp 1e-40
cd03292214 cd03292, ABC_FtsE_transporter, FtsE is a hydrophilic nu 2e-40
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin export 9e-40
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are 1e-39
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport syst 1e-38
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate transp 2e-38
cd03258233 cd03258, ABC_MetN_methionine_transporter, MetN (also kn 6e-38
COG1135 339 COG1135, AbcC, ABC-type metal ion transport system, ATP 9e-38
cd03262213 cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the 1e-37
COG3842 352 COG3842, PotA, ABC-type spermidine/putrescine transport 2e-37
cd03259213 cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and So 2e-37
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-b 5e-37
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate t 6e-37
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC c 6e-36
COG1131293 COG1131, CcmA, ABC-type multidrug transport system, ATP 1e-35
COG3839 338 COG3839, MalK, ABC-type sugar transport systems, ATPase 2e-35
cd03257228 cd03257, ABC_NikE_OppD_transporters, The ABC transporte 4e-35
COG1123 539 COG1123, COG1123, ATPase components of various ABC-type 3e-34
cd03300232 cd03300, ABC_PotA_N, PotA is an ABC-type transporter an 7e-34
cd03229178 cd03229, ABC_Class3, This class is comprised of all BPD 4e-33
COG1123539 COG1123, COG1123, ATPase components of various ABC-type 1e-32
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-bindin 1e-32
PRK11124242 PRK11124, artP, arginine transporter ATP-binding subuni 1e-32
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding su 2e-32
COG1118 345 COG1118, CysA, ABC-type sulfate/molybdate transport sys 3e-32
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores tra 3e-32
COG4161242 COG4161, ArtP, ABC-type arginine transport system, ATPa 4e-32
PRK11153 343 PRK11153, metN, DL-methionine transporter ATP-binding s 9e-32
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, ATPase 1e-31
COG1129 500 COG1129, MglA, ABC-type sugar transport system, ATPase 7e-31
cd03296239 cd03296, ABC_CysA_sulfate_importer, Part of the ABC tra 1e-30
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Provisi 1e-30
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel t 4e-30
PRK09452 375 PRK09452, potA, putrescine/spermidine ABC transporter A 7e-30
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-binding p 1e-29
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain of th 2e-29
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding ca 2e-29
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel t 3e-29
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine transp 6e-29
cd03218232 cd03218, ABC_YhbG, The ABC transporters belonging to th 7e-29
TIGR02314 343 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP- 7e-29
COG1127263 COG1127, Ttg2A, ABC-type transport system involved in r 1e-28
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-bind 1e-28
COG4525259 COG4525, TauB, ABC-type taurine transport system, ATPas 4e-28
cd03294269 cd03294, ABC_Pro_Gly_Bertaine, This family comprises th 5e-28
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase 7e-28
cd03260227 cd03260, ABC_PstB_phosphate_transporter, Phosphate upta 2e-27
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC tra 2e-27
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transport 3e-27
COG4598256 COG4598, HisP, ABC-type histidine transport system, ATP 4e-27
cd03266218 cd03266, ABC_NatA_sodium_exporter, NatA is the ATPase c 7e-27
cd03299235 cd03299, ABC_ModC_like, Archeal protein closely related 1e-26
TIGR01186 363 TIGR01186, proV, glycine betaine/L-proline transport AT 1e-26
cd03235213 cd03235, ABC_Metallic_Cations, ABC component of the met 2e-26
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, OpuCA is a the ATP b 2e-26
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding subunit; 2e-26
cd03263220 cd03263, ABC_subfamily_A, The ABCA subfamily mediates t 3e-26
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transporter 4e-26
cd03228171 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Pr 6e-26
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, CydD sub 7e-26
COG4175 386 COG4175, ProV, ABC-type proline/glycine betaine transpo 1e-25
COG4172 534 COG4172, COG4172, ABC-type uncharacterized transport sy 1e-25
COG4619223 COG4619, COG4619, ABC-type uncharacterized transport sy 1e-25
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPase co 2e-25
TIGR03269 520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase 3e-25
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid trans 5e-25
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ModC is an AB 6e-25
cd03230173 cd03230, ABC_DR_subfamily_A, This family of ATP-binding 6e-25
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport system 8e-25
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid trans 1e-24
TIGR03265 353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC 1e-24
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding su 2e-24
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding subunit 4e-24
cd03265220 cd03265, ABC_DrrA, DrrA is the ATP-binding protein comp 5e-24
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporte 6e-24
cd03224222 cd03224, ABC_TM1139_LivF_branched, LivF (TM1139) is par 9e-24
PRK10851 353 PRK10851, PRK10851, sulfate/thiosulfate transporter sub 1e-23
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system p 2e-23
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate ester t 2e-23
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC 5e-23
cd03219236 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC 7e-23
PRK11607 377 PRK11607, potG, putrescine transporter ATP-binding subu 1e-22
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transport sy 2e-22
KOG0055 1228 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter 2e-22
COG4988559 COG4988, CydD, ABC-type transport system involved in cy 3e-22
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-binding s 3e-22
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding subunit; 3e-22
PRK11432 351 PRK11432, fbpC, ferric transporter ATP-binding subunit; 4e-22
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding subunit; 4e-22
cd03269210 cd03269, ABC_putative_ATPase, This subfamily is involve 7e-22
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/ornithine 9e-22
COG4778235 COG4778, PhnL, ABC-type phosphonate transport system, A 1e-21
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding subunit; 1e-21
PRK09536 402 PRK09536, btuD, corrinoid ABC transporter ATPase; Revie 1e-21
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP-bindi 2e-21
cd00267157 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transpo 4e-21
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding protein 4e-21
COG1132567 COG1132, MdlB, ABC-type multidrug transport system, ATP 5e-21
TIGR03258 362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport 9e-21
COG4987573 COG4987, CydC, ABC-type transport system involved in cy 1e-20
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding subunit; 1e-20
KOG00551228 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter 2e-20
cd03267236 cd03267, ABC_NatA_like, Similar in sequence to NatA, th 2e-20
TIGR03797686 TIGR03797, NHPM_micro_ABC2, NHPM bacteriocin system ABC 2e-20
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC transporte 2e-20
cd03251234 cd03251, ABCC_MsbA, MsbA is an essential ABC transporte 3e-20
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multidrug t 5e-20
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding subu 6e-20
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit; Pro 6e-20
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding prote 7e-20
COG4608268 COG4608, AppF, ABC-type oligopeptide transport system, 8e-20
cd03254229 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP 9e-20
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding subunit; 9e-20
cd03253236 cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transpor 1e-19
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, ATPa 1e-19
KOG0056790 KOG0056, KOG0056, KOG0056, Heavy metal exporter HMT1, A 1e-19
KOG0057591 KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster e 1e-19
PRK11247257 PRK11247, ssuB, aliphatic sulfonates transport ATP-bind 1e-19
KOG0058716 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superf 2e-19
COG0488 530 COG0488, Uup, ATPase components of ABC transporters wit 3e-19
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding subu 3e-19
COG4604252 COG4604, CeuD, ABC-type enterochelin transport system, 4e-19
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding subunit; 4e-19
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, MTABC3 (also known as AB 5e-19
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding subunit; 5e-19
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, The BcrA subfamily 6e-19
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP- 6e-19
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-bindin 7e-19
PRK10070 400 PRK10070, PRK10070, glycine betaine transporter ATP-bin 7e-19
cd03245220 cd03245, ABCC_bacteriocin_exporters, ABC-type bacterioc 9e-19
COG4172534 COG4172, COG4172, ABC-type uncharacterized transport sy 1e-18
COG4107258 COG4107, PhnK, ABC-type phosphonate transport system, A 1e-18
cd03234226 cd03234, ABCG_White, The White subfamily represents ABC 1e-18
COG4559259 COG4559, COG4559, ABC-type hemin transport system, ATPa 1e-18
cd03246173 cd03246, ABCC_Protease_Secretion, This family represent 1e-18
KOG0061 613 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily 1e-18
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding subunit; 1e-18
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding subunit; 1e-18
TIGR02142 354 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-bi 1e-18
COG1117253 COG1117, PstB, ABC-type phosphate transport system, ATP 2e-18
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding subunit 2e-18
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter NodI; Pr 2e-18
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transporter 2e-18
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system p 2e-18
PRK11022326 PRK11022, dppD, dipeptide transporter ATP-binding subun 3e-18
COG4136213 COG4136, COG4136, ABC-type uncharacterized transport sy 4e-18
cd03216163 cd03216, ABC_Carb_Monos_I, This family represents the d 5e-18
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC trans 5e-18
COG1119257 COG1119, ModF, ABC-type molybdenum transport system, AT 7e-18
cd03252237 cd03252, ABCC_Hemolysin, The ABC-transporter hemolysin 8e-18
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion system ATP 9e-18
TIGR02868529 TIGR02868, CydC, thiol reductant ABC exporter, CydC sub 9e-18
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Famil 9e-18
COG5265497 COG5265, ATM1, ABC-type transport system involved in Fe 1e-17
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding subunit; 1e-17
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system protein Ph 1e-17
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding subunit; 1e-17
KOG0059 885 KOG0059, KOG0059, KOG0059, Lipid exporter ABCA1 and rel 2e-17
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ABC-type thiami 2e-17
PRK11288 501 PRK11288, araG, L-arabinose transporter ATP-binding pro 2e-17
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protein Ccm 2e-17
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion system ABC 2e-17
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transpor 2e-17
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding 2e-17
PRK13536340 PRK13536, PRK13536, nodulation factor exporter subunit 2e-17
cd03248226 cd03248, ABCC_TAP, TAP, the Transporter Associated with 3e-17
COG4586325 COG4586, COG4586, ABC-type uncharacterized transport sy 3e-17
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP-bindi 4e-17
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding subunit; 5e-17
COG4152300 COG4152, COG4152, ABC-type uncharacterized transport sy 6e-17
PRK15134 529 PRK15134, PRK15134, microcin C ABC transporter ATP-bind 6e-17
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding subuni 7e-17
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding subunit; 1e-16
PRK10261 623 PRK10261, PRK10261, glutathione transporter ATP-binding 2e-16
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter family nod 3e-16
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP-bindi 3e-16
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding subunit; 6e-16
cd03213194 cd03213, ABCG_EPDR, ABCG transporters are involved in e 9e-16
COG0488530 COG0488, Uup, ATPase components of ABC transporters wit 1e-15
cd03250204 cd03250, ABCC_MRP_domain1, Domain 1 of the ABC subfamil 1e-15
TIGR03796710 TIGR03796, NHPM_micro_ABC1, NHPM bacteriocin system ABC 1e-15
cd03215182 cd03215, ABC_Carb_Monos_II, This family represents doma 2e-15
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein 2e-15
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP-bindi 2e-15
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding subunit; 3e-15
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-binding p 3e-15
COG1129500 COG1129, MglA, ABC-type sugar transport system, ATPase 5e-15
COG3845501 COG3845, COG3845, ABC-type uncharacterized transport sy 5e-15
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP-bindi 5e-15
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding subunit; 5e-15
KOG0054 1381 KOG0054, KOG0054, KOG0054, Multidrug resistance-associa 6e-15
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-bin 6e-15
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport syste 7e-15
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP-bindi 7e-15
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP-bind 9e-15
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase 1e-14
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP-bindi 1e-14
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion system ABC 1e-14
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding subunit; 1e-14
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-binding p 1e-14
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-bind 1e-14
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC transporte 1e-14
cd03247178 cd03247, ABCC_cytochrome_bd, The CYD subfamily implicat 2e-14
COG4170330 COG4170, SapD, ABC-type antimicrobial peptide transport 2e-14
PRK15439 510 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-b 2e-14
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding prote 2e-14
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC transporte 3e-14
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phosphate 4e-14
cd03220224 cd03220, ABC_KpsT_Wzt, ABC_KpsT_Wzt The KpsT/Wzt ABC tr 4e-14
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-binding 4e-14
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-binding p 4e-14
COG2401593 COG2401, COG2401, ABC-type ATPase fused to a predicted 5e-14
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP-bindi 6e-14
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP-bind 8e-14
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP-bindi 9e-14
PRK13549 506 PRK13549, PRK13549, xylose transporter ATP-binding subu 9e-14
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding prote 9e-14
COG4133209 COG4133, CcmA, ABC-type transport system involved in cy 1e-13
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transporter A 1e-13
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-b 1e-13
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP-bindi 2e-13
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP-bindi 2e-13
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transp 3e-13
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP-bindi 4e-13
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP-bindi 4e-13
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding subunit; 5e-13
PRK10982 491 PRK10982, PRK10982, galactose/methyl galaxtoside transp 5e-13
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport system in 6e-13
TIGR00955 617 TIGR00955, 3a01204, The Eye Pigment Precursor Transport 6e-13
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport syste 8e-13
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC transp 1e-12
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP-bindi 1e-12
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP-bindi 1e-12
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family member; Pr 2e-12
PLN03232 1495 PLN03232, PLN03232, ABC transporter C family member; Pr 2e-12
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP-bindi 2e-12
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP-bindi 2e-12
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP-bindi 2e-12
COG0396251 COG0396, SufC, ABC-type transport system involved in Fe 3e-12
KOG0065 1391 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance 4e-12
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic 4e-12
cd03231201 cd03231, ABC_CcmA_heme_exporter, CcmA, the ATP-binding 5e-12
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/perme 5e-12
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP-bindi 6e-12
TIGR02633 500 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding 8e-12
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transporter A 9e-12
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP-bindi 1e-11
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-binding p 1e-11
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATPase domai 2e-11
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibitor ( 2e-11
cd03221144 cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3 2e-11
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-binding p 2e-11
COG4178604 COG4178, COG4178, ABC-type uncharacterized transport sy 3e-11
cd03290218 cd03290, ABCC_SUR1_N, The SUR domain 1 3e-11
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATPase; 3e-11
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-binding p 3e-11
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP-bindi 4e-11
PRK11308327 PRK11308, dppF, dipeptide transporter ATP-binding subun 4e-11
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP-bindi 4e-11
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP-bindi 5e-11
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP-bindi 5e-11
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP-bindi 6e-11
cd03232192 cd03232, ABC_PDR_domain2, The pleiotropic drug resistan 7e-11
PRK15093330 PRK15093, PRK15093, antimicrobial peptide ABC transport 7e-11
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP-bindi 8e-11
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter ATP-bi 9e-11
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding subunit; 9e-11
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transport sy 2e-10
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide transport 5e-10
cd03233202 cd03233, ABC_PDR_domain1, The pleiotropic drug resistan 6e-10
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP-bindi 6e-10
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-binding p 7e-10
PRK10418254 PRK10418, nikD, nickel transporter ATP-binding protein 7e-10
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP-bindi 8e-10
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protein Ccm 9e-10
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP-bindi 1e-09
PRK15079331 PRK15079, PRK15079, oligopeptide ABC transporter ATP-bi 1e-09
cd03223166 cd03223, ABCD_peroxisomal_ALDP, Peroxisomal ATP-binding 2e-09
TIGR00957 1522 TIGR00957, MRP_assoc_pro, multi drug resistance-associa 2e-09
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase; Pro 5e-09
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-binding p 5e-09
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter ATP-b 8e-09
PRK14263261 PRK14263, PRK14263, phosphate ABC transporter ATP-bindi 9e-09
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-binding p 2e-08
PRK09473330 PRK09473, oppD, oligopeptide transporter ATP-binding co 3e-08
cd03236255 cd03236, ABC_RNaseL_inhibitor_domain1, The ATPase domai 4e-08
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP-bindi 4e-08
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provisional 5e-08
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit; Pro 6e-08
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 6e-08
COG1245 591 COG1245, COG1245, Predicted ATPase, RNase L inhibitor ( 7e-08
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) F 1e-07
COG4615546 COG4615, PvdE, ABC-type siderophore export system, fuse 2e-07
PLN03073718 PLN03073, PLN03073, ABC transporter F family; Provision 2e-07
TIGR01194555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter 6e-07
KOG2355291 KOG2355, KOG2355, KOG2355, Predicted ABC-type transport 8e-07
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP-bindi 8e-07
KOG0065 1391 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance 1e-06
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-binding pr 1e-06
KOG0062582 KOG0062, KOG0062, KOG0062, ATPase component of ABC tran 3e-06
cd03238176 cd03238, ABC_UvrA, The excision repair protein UvrA; Nu 4e-06
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC transp 5e-06
KOG0063592 KOG0063, KOG0063, KOG0063, RNAse L inhibitor, ABC super 6e-06
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system, ATP 6e-06
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; Valid 1e-05
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC system AT 1e-05
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein (mdr1) 1e-05
KOG0064728 KOG0064, KOG0064, KOG0064, Peroxisomal long-chain acyl- 2e-05
cd03369207 cd03369, ABCC_NFT1, Domain 2 of NFT1 (New full-length M 2e-05
PRK15439510 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-b 2e-05
PRK13541195 PRK13541, PRK13541, cytochrome c biogenesis protein Ccm 2e-05
cd03271261 cd03271, ABC_UvrA_II, The excision repair protein UvrA 3e-05
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protein Ccm 4e-05
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protein Ccm 8e-05
PRK10982491 PRK10982, PRK10982, galactose/methyl galaxtoside transp 9e-05
PRK10636 638 PRK10636, PRK10636, putative ABC transporter ATP-bindin 2e-04
cd03279213 cd03279, ABC_sbcCD, SbcCD and other Mre11/Rad50 (MR) co 5e-04
PRK10636 638 PRK10636, PRK10636, putative ABC transporter ATP-bindin 5e-04
cd03289275 cd03289, ABCC_CFTR2, The CFTR subfamily domain 2 7e-04
smart00382148 smart00382, AAA, ATPases associated with a variety of c 9e-04
cd03270226 cd03270, ABC_UvrA_I, The excision repair protein UvrA d 0.002
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 0.003
cd03255218 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is compris 2e-64
TIGR01187 325 TIGR01187, potA, spermidine/putrescine ABC transporter 4e-26
COG4148 352 COG4148, ModC, ABC-type molybdate transport system, ATP 6e-20
PRK11000 369 PRK11000, PRK11000, maltose/maltodextrin transporter AT 1e-21
TIGR03415 382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP 6e-18
PRK11650 356 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-bi 1e-16
PRK11144 352 PRK11144, modC, molybdate transporter ATP-binding prote 4e-15
PRK09700 510 PRK09700, PRK09700, D-allose transporter ATP-binding pr 2e-14
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-bindin 4e-14
PRK10762 501 PRK10762, PRK10762, D-ribose transporter ATP binding pr 6e-14
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-binding 5e-13
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding protein 2e-12
KOG0927 614 KOG0927, KOG0927, KOG0927, Predicted transporter (ABC s 1e-11
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transpor 2e-11
PLN03211 659 PLN03211, PLN03211, ABC transporter G-25; Provisional 3e-11
cd03244221 cd03244, ABCC_MRP_domain2, Domain 2 of the ABC subfamil 6e-11
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associated AB 7e-11
TIGR03719 552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, 1e-10
PRK11819 556 PRK11819, PRK11819, putative ABC transporter ATP-bindin 3e-10
cd03291282 cd03291, ABCC_CFTR1, The CFTR subfamily domain 1 1e-09
KOG0927614 KOG0927, KOG0927, KOG0927, Predicted transporter (ABC s 2e-09
PRK11147 635 PRK11147, PRK11147, ABC transporter ATPase component; R 4e-09
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmembrane 4e-08
KOG0063 592 KOG0063, KOG0063, KOG0063, RNAse L inhibitor, ABC super 1e-07
KOG0066 807 KOG0066, KOG0066, KOG0066, eIF2-interacting protein ABC 1e-07
KOG0066807 KOG0066, KOG0066, KOG0066, eIF2-interacting protein ABC 1e-07
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, 1e-07
KOG0062 582 KOG0062, KOG0062, KOG0062, ATPase component of ABC tran 3e-07
PRK13409 590 PRK13409, PRK13409, putative ATPase RIL; Provisional 6e-07
PRK15064530 PRK15064, PRK15064, ABC transporter ATP-binding protein 1e-06
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-b 2e-06
KOG00541381 KOG0054, KOG0054, KOG0054, Multidrug resistance-associa 3e-06
PRK10762501 PRK10762, PRK10762, D-ribose transporter ATP binding pr 3e-05
PRK10790592 PRK10790, PRK10790, putative multidrug transporter memb 3e-05
PRK11819556 PRK11819, PRK11819, putative ABC transporter ATP-bindin 6e-05
PRK15064 530 PRK15064, PRK15064, ABC transporter ATP-binding protein 6e-05
PRK10789569 PRK10789, PRK10789, putative multidrug transporter memb 6e-05
KOG0060659 KOG0060, KOG0060, KOG0060, Long-chain acyl-CoA transpor 2e-04
PRK13545 549 PRK13545, tagH, teichoic acids export protein ATP-bindi 0.001
pfam00005119 pfam00005, ABC_tran, ABC transporter 1e-17
cd03222177 cd03222, ABC_RNaseL_inhibitor, The ABC ATPase RNase L i 9e-05
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA repli 9e-04
TIGR00630924 TIGR00630, uvra, excinuclease ABC, A subunit 0.003
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein (mdr1) 9e-05
PLN03073 718 PLN03073, PLN03073, ABC transporter F family; Provision 2e-04
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein (mdr1) 2e-04
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) F 4e-04
cd01122271 cd01122, GP4d_helicase, GP4d_helicase is a homohexameri 4e-04
cd03227162 cd03227, ABC_Class2, ABC-type Class 2 contains systems 5e-04
TIGR00954659 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Transpor 0.003
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-binding pro 0.004
>gnl|CDD|31331 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|32710 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|33919 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|130034 TIGR00960, 3a0501s02, Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|73015 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>gnl|CDD|73051 cd03292, ABC_FtsE_transporter, FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>gnl|CDD|163352 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|73052 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>gnl|CDD|31323 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|33436 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|73017 cd03258, ABC_MetN_methionine_transporter, MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>gnl|CDD|31330 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|73021 cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>gnl|CDD|33633 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|73018 cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|31313 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|72984 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>gnl|CDD|31326 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|33631 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|73016 cd03257, ABC_NikE_OppD_transporters, The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>gnl|CDD|31320 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|73059 cd03300, ABC_PotA_N, PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>gnl|CDD|72988 cd03229, ABC_Class3, This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>gnl|CDD|31320 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|31315 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31317 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|33907 COG4161, ArtP, ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183001 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|31319 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31325 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|73055 cd03296, ABC_CysA_sulfate_importer, Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>gnl|CDD|182829 PRK10908, PRK10908, cell division protein FtsE; Provisional Back     alignment and domain information
>gnl|CDD|30793 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|181868 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|73060 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|73020 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>gnl|CDD|31321 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31322 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|72977 cd03218, ABC_YhbG, The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|31324 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|34177 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|73053 cd03294, ABC_Pro_Gly_Bertaine, This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>gnl|CDD|31318 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|73019 cd03260, ABC_PstB_phosphate_transporter, Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|72973 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>gnl|CDD|34233 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|73025 cd03266, ABC_NatA_sodium_exporter, NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>gnl|CDD|73058 cd03299, ABC_ModC_like, Archeal protein closely related to ModC Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|72994 cd03235, ABC_Metallic_Cations, ABC component of the metal-type transporters Back     alignment and domain information
>gnl|CDD|73054 cd03295, ABC_OpuCA_Osmoprotection, OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|73022 cd03263, ABC_subfamily_A, The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|72987 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>gnl|CDD|163042 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|33915 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|33913 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|34242 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|34199 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|30760 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|73056 cd03297, ABC_ModC_molybdenum_transporter, ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>gnl|CDD|72989 cd03230, ABC_DR_subfamily_A, This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>gnl|CDD|31332 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|30759 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|163196 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|163576 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|73024 cd03265, ABC_DrrA, DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>gnl|CDD|32455 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|72983 cd03224, ABC_TM1139_LivF_branched, LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|72985 cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>gnl|CDD|72978 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>gnl|CDD|183226 PRK11607, potG, putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|33636 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|35278 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|34593 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|184197 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183133 PRK11432, fbpC, ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|73028 cd03269, ABC_putative_ATPase, This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|34390 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|169949 PRK09536, btuD, corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|184591 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|72971 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>gnl|CDD|182444 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|31327 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|34592 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|35278 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|73026 cd03267, ABC_NatA_like, Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>gnl|CDD|163509 TIGR03797, NHPM_micro_ABC2, NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|73010 cd03251, ABCC_MsbA, MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>gnl|CDD|73023 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184133 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|73178 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|73013 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|73012 cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>gnl|CDD|33632 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|35279 KOG0056, KOG0056, KOG0056, Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|35280 KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|35281 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|30834 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|184193 PRK13633, PRK13633, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|34235 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184194 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|73008 cd03249, ABC_MTABC3_MDL1_MDL2, MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>gnl|CDD|184206 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|73027 cd03268, ABC_BcrA_bacitracin_resist, The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>gnl|CDD|130045 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|73004 cd03245, ABCC_bacteriocin_exporters, ABC-type bacteriocin exporters Back     alignment and domain information
>gnl|CDD|33913 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|33864 COG4107, PhnK, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|72993 cd03234, ABCG_White, The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>gnl|CDD|34201 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|73005 cd03246, ABCC_Protease_Secretion, This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>gnl|CDD|35284 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184204 PRK13645, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|31314 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|184124 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|162807 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>gnl|CDD|182906 PRK11022, dppD, dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|33892 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|72975 cd03216, ABC_Carb_Monos_I, This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>gnl|CDD|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|31316 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|73011 cd03252, ABCC_Hemolysin, The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>gnl|CDD|163239 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|163051 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|162132 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|34862 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>gnl|CDD|184201 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|35282 KOG0059, KOG0059, KOG0059, Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism, General function prediction only] Back     alignment and domain information
>gnl|CDD|73057 cd03298, ABC_ThiQ_thiamine_transporter, ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184126 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|162558 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184123 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>gnl|CDD|73007 cd03248, ABCC_TAP, TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>gnl|CDD|34224 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|33903 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|185088 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184192 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>gnl|CDD|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|72972 cd03213, ABCG_EPDR, ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>gnl|CDD|30834 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|73009 cd03250, ABCC_MRP_domain1, Domain 1 of the ABC subfamily C Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHPM_micro_ABC1, NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|72974 cd03215, ABC_Carb_Monos_II, This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>gnl|CDD|162243 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|172734 PRK14246, PRK14246, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|31325 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|33636 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|172761 PRK14273, PRK14273, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|35277 KOG0054, KOG0054, KOG0054, Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|31298 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|185016 PRK15056, PRK15056, manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|172747 PRK14259, PRK14259, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|162555 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|139715 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|183003 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|73006 cd03247, ABCC_cytochrome_bd, The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>gnl|CDD|33911 COG4170, SapD, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183014 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|31329 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|72979 cd03220, ABC_KpsT_Wzt, ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>gnl|CDD|182342 PRK10261, PRK10261, glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184588 PRK14243, PRK14243, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|32537 COG2401, COG2401, ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|185088 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>gnl|CDD|172762 PRK14274, PRK14274, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131817 TIGR02770, nickel_nikD, nickel import ATP-binding protein NikD Back     alignment and domain information
>gnl|CDD|33889 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|183080 PRK11300, livG, leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|163250 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information