peg_789

peg_789

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:+(841921, 842352)Protein Length:143aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM3 TM-Helix
TOPPRED3 TM-Helix
HMMTOP3 TM-Helix
MEMSAT3 TM-Helix
MEMSAT_SVM3 TM-Helix
PHOBIUS4 TM-Helix
SignalP_HMMyes
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MFVILALIVLVAALNIISSLVMLVQERRRDIAILRTMGARISSIMSIFFMIGAFIGIAGTGMGMIVGILISCNVEAIRKFFLHTLGVVIFDTEAYLLTELPSKISWVEVSWIISMALALSLLATIFPSWKASRIDPVKVLRGE
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccc
cHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHccccccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHcHHHHHccccHHHHHccc
MFVILALIVLVAALNIISSLVMLVQERRRDIAILRTMGARISSIMSIFFMIGAFIGIAGTGMGMIVGILISCNVEAIRKFFLHTLGVVIFDTEAYLltelpskisWVEVSWIISMALALSLLATifpswkasridpvkvlrge
MFVILALIVLVAALNIISSLVMLVQERRRDIAILRTMGARISSIMSIFFMIGAFIGIAGTGMGMIVGILISCNVEAIRKFFLHTLGVVIFDTEAYLLTELPSKISWVEVSWIISMALALSLLATifpswkasridpvkvlrge
MFvilalivlvaalniiSSLVMLVQERRRDIAILRTMGarissimsiffmigafigiagtgmgmivgiLISCNVEAIRKFFLHTLGVVIFDTEAYLLTELPSKISWVEVswiismalalsllatiFPSWKASRIDPVKVLRGE
MFVILALIVLVAALNIISSLVMLVQERRRDIAILRTMGARISSIMSIFFMIGAFIGIAGTGMGMIVGILISCNVEAIRKFFLHTLGVVIFDTEAYLLTELPSKISWVEVSWIISMALALSLLATIFPSWKASRIDPVKVLRG*
MFVILALIVLVAALNIISSLVMLVQERRRDIAILRTMGARISSIMSIFFMIGAFIGIAGTGMGMIVGILISCNVEAIRKFFLHTLGVVIFDTEAYLLTELPSKISWVEVSWIISMALALSLLATIFPSWKASRIDPVKVLRGE
MFVILALIVLVAALNIISSLVMLVQERRRDIAILRTMGARISSIMSIFFMIGAFIGIAGTGMGMIVGILISCNVEAIRKFFLHTLGVVIFDTEAYLLTELPSKISWVEVSWIISMALALSLLATIFPSWKASRIDPVKVLRGE
oooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
HHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxx
oooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
ooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
oooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFVILALIVLVAALNIISSLVMLVQERRRDIAILRTMGARISSIMSIFFMIGAFIGIAGTGMGMIVGILISCNVEAIRKFFLHTLGVVIFDTEAYLLTELPSKISWVEVSWIISMALALSLLATIFPSWKASRIDPVKVLRGE
MFVILALIVLVAALNIISSLVMLVQERRRDIAILRTMGARISSIMSIFFMIGAFIGIAGTGMGMIVGILISCNVEAIRKFFLHTLGVVIFDTEAYLLTELPSKISWVEVSWIISMALALSLLATIFPSWKASRIDPVKVLRGE
MFVILALIVLVAALNIISSLVMLVQERRRDIAILRTMGARISSIMSIFFMIGAFIGIAGTGMGMIVGILISCNVEAIRKFFLHTLGVVIFDTEAYLLTELPSKISWVEVSWIISMALALSLLATIFPSWKASRIDPVKVLRGE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target143
315122708416 lipoprotein releasing system, transmembrane protein, Lo 1 1e-60
227821638436 ABC transporter, membrane spanning protein [Sinorhizobi 1 7e-39
209548883434 lipoprotein releasing system, transmembrane protein, Lo 1 2e-38
15965040408 hypothetical protein SMc01935 [Sinorhizobium meliloti 1 1 2e-38
319783001428 lipoprotein releasing system, transmembrane protein, Lo 1 2e-38
307301112437 lipoprotein releasing system, transmembrane protein, Lo 1 2e-38
241204107434 lipoprotein releasing system, transmembrane protein, Lo 1 3e-38
218682656421 lipoprotein releasing system, transmembrane protein, Lo 1 4e-38
218661192344 lipoprotein ABC transporter, permease protein [Rhizobiu 1 4e-38
260462252428 lipoprotein releasing system, transmembrane protein, Lo 1 5e-38
>gi|315122708|ref|YP_004063197.1| lipoprotein releasing system, transmembrane protein, LolC/E family [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 416 Back     alignment and organism information
 Score =  235 bits (600), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 132/143 (92%)

Query: 1   MFVILALIVLVAALNIISSLVMLVQERRRDIAILRTMGARISSIMSIFFMIGAFIGIAGT 60
           MFVILALIVLVA+LNIIS LVMLV+E+RRDIAILRTMGARISSIM+IFFMIGAFIGI+GT
Sbjct: 274 MFVILALIVLVASLNIISGLVMLVKEKRRDIAILRTMGARISSIMAIFFMIGAFIGISGT 333

Query: 61  GMGMIVGILISCNVEAIRKFFLHTLGVVIFDTEAYLLTELPSKISWVEVSWIISMALALS 120
             G+I+GILIS NVE IR+FFL+  GVVIFDTEAYLLTELPSKISW+EVSWI++M + LS
Sbjct: 334 CAGVIIGILISVNVEVIRQFFLNAFGVVIFDTEAYLLTELPSKISWIEVSWIVAMTVFLS 393

Query: 121 LLATIFPSWKASRIDPVKVLRGE 143
           LLATIFPSWKASRIDPVK LR E
Sbjct: 394 LLATIFPSWKASRIDPVKALRYE 416


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227821638|ref|YP_002825608.1| ABC transporter, membrane spanning protein [Sinorhizobium fredii NGR234] Length = 436 Back     alignment and organism information
>gi|209548883|ref|YP_002280800.1| lipoprotein releasing system, transmembrane protein, LolC/E family [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 434 Back     alignment and organism information
>gi|15965040|ref|NP_385393.1| hypothetical protein SMc01935 [Sinorhizobium meliloti 1021] Length = 408 Back     alignment and organism information
>gi|319783001|ref|YP_004142477.1| lipoprotein releasing system, transmembrane protein, LolC/E family [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 428 Back     alignment and organism information
>gi|307301112|ref|ZP_07580881.1| lipoprotein releasing system, transmembrane protein, LolC/E family [Sinorhizobium meliloti BL225C] Length = 437 Back     alignment and organism information
>gi|241204107|ref|YP_002975203.1| lipoprotein releasing system, transmembrane protein, LolC/E family [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 434 Back     alignment and organism information
>gi|218682656|ref|ZP_03530257.1| lipoprotein releasing system, transmembrane protein, LolC/E family [Rhizobium etli CIAT 894] Length = 421 Back     alignment and organism information
>gi|218661192|ref|ZP_03517122.1| lipoprotein ABC transporter, permease protein [Rhizobium etli IE4771] Length = 344 Back     alignment and organism information
>gi|260462252|ref|ZP_05810496.1| lipoprotein releasing system, transmembrane protein, LolC/E family [Mesorhizobium opportunistum WSM2075] Length = 428 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target143
TIGR02212411 TIGR02212, lolCE, lipoprotein releasing system, transme 6e-43
PRK11146412 PRK11146, PRK11146, outer membrane-specific lipoprotein 7e-25
TIGR02213411 TIGR02213, lolE_release, lipoprotein releasing system, 6e-24
PRK10814399 PRK10814, PRK10814, outer membrane-specific lipoprotein 2e-21
pfam02687174 pfam02687, FtsX, Predicted permease 3e-06
TIGR03434803 TIGR03434, ADOP, Acidobacterial duplicated orphan perme 2e-04
COG0577419 COG0577, SalY, ABC-type antimicrobial peptide transport 0.002
COG4591408 COG4591, LolE, ABC-type transport system, involved in l 4e-32
>gnl|CDD|162764 TIGR02212, lolCE, lipoprotein releasing system, transmembrane protein, LolC/E family Back     alignment and domain information
>gnl|CDD|182995 PRK11146, PRK11146, outer membrane-specific lipoprotein transporter subunit LolE; Provisional Back     alignment and domain information
>gnl|CDD|131268 TIGR02213, lolE_release, lipoprotein releasing system, transmembrane protein LolE Back     alignment and domain information
>gnl|CDD|182753 PRK10814, PRK10814, outer membrane-specific lipoprotein transporter subunit LolC; Provisional Back     alignment and domain information
>gnl|CDD|145704 pfam02687, FtsX, Predicted permease Back     alignment and domain information
>gnl|CDD|163262 TIGR03434, ADOP, Acidobacterial duplicated orphan permease Back     alignment and domain information
>gnl|CDD|30922 COG0577, SalY, ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|34229 COG4591, LolE, ABC-type transport system, involved in lipoprotein release, permease component [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 143
TIGR02212414 lolCE lipoprotein releasing system, transmembrane prote 100.0
PRK11146412 outer membrane-specific lipoprotein transporter subunit 100.0
TIGR02213416 lolE_release lipoprotein releasing system, transmembran 100.0
COG4591408 LolE ABC-type transport system, involved in lipoprotein 100.0
PRK10535648 macrolide transporter ATP-binding /permease protein; Pr 99.98
PRK10814396 outer membrane-specific lipoprotein transporter subunit 99.98
TIGR03434803 ADOP Acidobacterial duplicated orphan permease. Members 99.93
TIGR03434 803 ADOP Acidobacterial duplicated orphan permease. Members 99.9
COG0577419 SalY ABC-type antimicrobial peptide transport system, p 99.86
pfam02687174 FtsX Predicted permease. This is a family of predicted 99.81
PRK11026309 ftsX cell division protein FtsX; Provisional 99.51
TIGR01185381 devC DevC protein; InterPro: IPR005891 ABC transporters 99.19
COG3127 829 Predicted ABC-type transport system involved in lysopho 99.15
TIGR00439314 ftsX putative protein insertion permease FtsX; InterPro 98.94
COG3127829 Predicted ABC-type transport system involved in lysopho 98.73
COG2177297 FtsX Cell division protein [Cell division and chromosom 99.19
COG0795 364 Predicted permeases [General function prediction only] 92.08
pfam03739 353 YjgP_YjgQ Predicted permease YjgP/YjgQ family. Members 90.81
>TIGR02212 lolCE lipoprotein releasing system, transmembrane protein, LolC/E family; InterPro: IPR011925 This entry describes the LolC protein, and its paralog LolE found in some species Back     alignment and domain information
>PRK11146 outer membrane-specific lipoprotein transporter subunit LolE; Provisional Back     alignment and domain information
>TIGR02213 lolE_release lipoprotein releasing system, transmembrane protein LolE; InterPro: IPR011926 This protein is part of an unusual ABC transporter complex that releases lipoproteins from the periplasmic side of the bacterial inner membrane, rather than transport any substrate across the inner membrane Back     alignment and domain information
>COG4591 LolE ABC-type transport system, involved in lipoprotein release, permease component [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>PRK10814 outer membrane-specific lipoprotein transporter subunit LolC; Provisional Back     alignment and domain information
>TIGR03434 ADOP Acidobacterial duplicated orphan permease Back     alignment and domain information
>TIGR03434 ADOP Acidobacterial duplicated orphan permease Back     alignment and domain information
>COG0577 SalY ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms] Back     alignment and domain information
>pfam02687 FtsX Predicted permease Back     alignment and domain information
>PRK11026 ftsX cell division protein FtsX; Provisional Back     alignment and domain information
>TIGR01185 devC DevC protein; InterPro: IPR005891 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG3127 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, permease component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR00439 ftsX putative protein insertion permease FtsX; InterPro: IPR004513 FtsX is an integral membrane protein encoded in the same operon as signal recognition particle docking protein FtsY and FtsE Back     alignment and domain information
>COG3127 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, permease component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG2177 FtsX Cell division protein [Cell division and chromosome partitioning] Back     alignment and domain information
>COG0795 Predicted permeases [General function prediction only] Back     alignment and domain information
>pfam03739 YjgP_YjgQ Predicted permease YjgP/YjgQ family Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00