254780889

254780889

inosine 5'-monophosphate dehydrogenase

GeneID in NCBI database:8209909Locus tag:CLIBASIA_03930
Protein GI in NCBI database:254780889Protein Accession:YP_003065302.1
Gene range:+(864881, 866362)Protein Length:493aa
Gene description:inosine 5'-monophosphate dehydrogenase
COG prediction:[F] IMP dehydrogenase/GMP reductase
KEGG prediction:quaB; inosine 5'-monophosphate dehydrogenase (EC:1.1.1.205); K00088 IMP dehydrogenase [EC:1.1.1.205]
SEED prediction:Inosine-monophosphate dehydrogenase (EC 1.1.1.205)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
Subsystem involved in SEED:Purine conversions
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490---
MARIIENNVGGVALTFDDVLLRPEFSNVLPRDIDISTRIAKDFTLNLPIMSAAMDQVTDSRLAIAMAQAGGLGVIHRNFSPSEQVAQVHQVKKFESGMVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDVRFASNAQQAVGELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIERSQLNPNATKDSKGRLRVAAAVSVAKDIADRVGPLFDVNVDLVVVDTAHGHSQKVLDAVVQIKKNFPSLLVMAGNIATAEGALALIDAGADIIKVGIGPGSICTTRVVTGVGCPQLSAIMSVVEVAERAGVAIVADGGIRFSGDIAKAIAAGSACVMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAMERGSSARYSQDGVTDVLKLVPEGIEGRVPYKGPIASVLHQMSGGLKSSMGYVGASNIEEFQKKANFIRVSVAGLRESHVHDVKITRESPNYSETI
ccccccccccccccccHHEEEccccccccHHHcEEEEEEcccEEEEccEEEcHHHHHHHHHHHHHHHHccccEEccccccHHHHHHHHHcccHHHcccccccEEEcccccHHHHHHHHHHccccEEEEEccccccEEEEEEHHHHHccccccccHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEccccEEEEEEEcHHHHHHccccHHHHHHHcccccccccccccHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHcccccEEEEEEEcHHHHHHHHHccccEEEEEcccccccccHHHcccccccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHccccEEEEccHHHHcccccccEEEEccEEHHHHccccccHHHcccccEEEcccccccHHHccccccEEEEcccccHHHHHHHHHHHHHHHHHHcccccHHHHHHccEEEEEcHHHccccccccEEEEEccccccccc
ccHHHHcccHHcccccccEEEcccccccccccccccHHHHcccccccHHHHHccccccHHHHHHHHHHccccEEEEccccHHHHHHHHHHHccccccEEEccccccccHHHHHHHHHHHHccccccEEEccccccEEEEEEcccEEEcccccccHHHHccccccEccccccHHHHHHHHHHcccEEEEEEcccccEEEEEEEHHHHHHHHcccccHcccccEEEEEEccccccHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHccccEEEEEcccccEcEEEEEEcccHHHHHHHHHHHHHHHHccccEEEcccEEEccHHHHHHHHcccEEEEEcHccccccccccEEEEEccEEEEEcccccHHHHccccccHHHccccccHHccccccccccccccccHHHHHHHHHHHHHHcccccccHcHHHHHHcccEEEEccccccccccccEEEEcccccccccc
MARIIennvggvaltfddvllrpefsnvlprdidistriakdftlnlpimsaaMDQVTDSRLAIAMAQAGGlgvihrnfspseqvAQVHQVKKFesgmvvnpvtispYATLADALALMKKYsisgipvvesdvgkLVGILTNRDVRFASNAQQAVGELMTRNLITVKKTVNLENAKALLHQHRIEKLLvvdddgccigLITVKdiersqlnpnatkdskgRLRVAAAVSVAKDIadrvgplfdvNVDLVVVDTAHGHSQKVLDAVVQIKKNFPSLLVMAGNIATAEGALALIDAGADIikvgigpgsicttrvvtgvgcpqLSAIMSVVEVAERAGVAivadggirfSGDIAKAIAAGSACVMIGsllagtdespgdiflyqgrsfksyrgmGSVAAMErgssarysqdgvTDVLKLvpegiegrvpykgpiaSVLHQMSgglkssmgyvgasNIEEFQKKANFIRVSVAglreshvhdvkitrespnyseti
mariiennvggvaltfddvllrpefsnvlprdidistriAKDFTLNLPIMSAAMDQVTDSRLAIAMAQAGGLGVIHRNFSPSEQVAQVHQVKKFESGMVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDVRFASNAQQAVGELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLItvkdiersqlnpnatkdskgrlRVAAAVSVAKdiadrvgplFDVNVDLVVVDTAHGHSQKVLDAVVQIKKNFPSLLVMAGNIATAEGALALIDAGADIIKVGIGPGSICTTRVVTGVGCPQLSAIMSVVEVAERAGVAIVADGGIRFSGDIAKAIAAGSACVMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAMERgssarysqdgVTDVLKLVPEGIEGRVPYKGPIASVLHQMSGGLKSSMGYVGASNIEEFQKKANFIRVSVAglreshvhdvkitrespnyseti
MARIIENNVGGVALTFDDVLLRPEFSNVLPRDIDISTRIAKDFTLNLPIMSAAMDQVTDSRLAIAMAQAGGLGVIHRNFSPSEQVAQVHQVKKFESGMVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDVRFASNAQQAVGELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIERSQLNPNATKDSKGRLRVAAAVSVAKDIADRVGPLFdvnvdlvvvdTAHGHSQKVLDAVVQIKKNFPSLLVMAGNIATAEgalalidagadiiKVGIGPGSICTTRVVTGVGCPQLSAIMSVVEVAERAGVAIVADGGIRFSGDIAKAIAAGSACVMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAMERGSSARYSQDGVTDVLKLVPEGIEGRVPYKGPIASVLHQMSGGLKSSMGYVGASNIEEFQKKANFIRVSVAGLRESHVHDVKITRESPNYSETI
*******NVGGVALTFDDVLLRPEFSNVLPRDIDISTRIAKDFTLNLPIMSAAMDQVTDSRLAIAMAQAGGLGVIHRNFSPSEQVAQVHQVKKFESGMVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDVRFASNAQQAVGELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIERSQLNPNATKDSKGRLRVAAAVSVAKDIADRVGPLFDVNVDLVVVDTAHGHSQKVLDAVVQIKKNFPSLLVMAGNIATAEGALALIDAGADIIKVGIGPGSICTTRVVTGVGCPQLSAIMSVVEVAERAGVAIVADGGIRFSGDIAKAIAAGSACVMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAMERGSSARYSQDGVTDVLKLVPEGIEGRVPYKGPIASVLHQMSGGLKSSMGYVGASNIEEFQKKANFIRVSVAGLRESHVHDVKITRE*PN*****
MARIIENNVGGVALTFDDVLLRPEFSNVLPRDIDISTRIAKDFTLNLPIMSAAMDQVTDSRLAIAMAQAGGLGVIHRNFSPSEQVAQVHQVKKFESGMVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDVRFASNAQQAVGELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIERSQLNPNATKDSKGRLRVAAAVSVAKDIADRVGPLFDVNVDLVVVDTAHGHSQKVLDAVVQIKKNFPSLLVMAGNIATAEGALALIDAGADIIKVGIGPGSICTTRVVTGVGCPQLSAIMSVVEVAERAGVAIVADGGIRFSGDIAKAIAAGSACVMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAMERGSSARYSQDGVTDVLKLVPEGIEGRVPYKGPIASVLHQMSGGLKSSMGYVGASNIEEFQKKANFIRVSVAGLRESHVHDVKITRESPNYSETI
*ARIIENNVGGVALTFDDVLLRPEFSNVLPRDIDISTRIAKDFTLNLPIMSAAMDQVTDSRLAIAMAQAGGLGVIHRNFSPSEQVAQVHQVKKFESGMVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDVRFASNAQQAVGELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIERSQLNPNATKDSKGRLRVAAAVSVAKDIADRVGPLFDVNVDLVVVDTAHGHSQKVLDAVVQIKKNFPSLLVMAGNIATAEGALALIDAGADIIKVGIGPGSICTTRVVTGVGCPQLSAIMSVVEVAERAGVAIVADGGIRFSGDIAKAIAAGSACVMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAMERGSSARYSQDGVTDVLKLVPEGIEGRVPYKGPIASVLHQMSGGLKSSMGYVGASNIEEFQKKANFIRVSVAGLRESHVHDVKITRES*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARIIENNVGGVALTFDDVLLRPEFSNVLPRDIDISTRIAKDFTLNLPIMSAAMDQVTDSRLAIAMAQAGGLGVIHRNFSPSEQVAQVHQVKKFESGMVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDVRFASNAQQAVGELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIERSQLNPNATKDSKGRLRVAAAVSVAKDIADRVGPLFDVNVDLVVVDTAHGHSQKVLDAVVQIKKNFPSLLVMAGNIATAEGALALIDAGADIIKVGIGPGSICTTRVVTGVGCPQLSAIMSVVEVAERAGVAIVADGGIRFSGDIAKAIAAGSACVMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAMERGSSARYSQDGVTDVLKLVPEGIEGRVPYKGPIASVLHQMSGGLKSSMGYVGASNIEEFQKKANFIRVSVAGLRESHVHDVKITRESPNYSETI
MARIIENNVGGVALTFDDVLLRPEFSNVLPRDIDISTRIAKDFTLNLPIMSAAMDQVTDSRLAIAMAQAGGLGVIHRNFSPSEQVAQVHQVKKFESGMVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDVRFASNAQQAVGELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIERSQLNPNATKDSKGRLRVAAAVSVAKDIADRVGPLFDVNVDLVVVDTAHGHSQKVLDAVVQIKKNFPSLLVMAGNIATAEGALALIDAGADIIKVGIGPGSICTTRVVTGVGCPQLSAIMSVVEVAERAGVAIVADGGIRFSGDIAKAIAAGSACVMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAMERGSSARYSQDGVTDVLKLVPEGIEGRVPYKGPIASVLHQMSGGLKSSMGYVGASNIEEFQKKANFIRVSVAGLRESHVHDVKITRESPNYSETI
MARIIENNVGGVALTFDDVLLRPEFSNVLPRDIDISTRIAKDFTLNLPIMSAAMDQVTDSRLAIAMAQAGGLGVIHRNFSPSEQVAQVHQVKKFESGMVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDVRFASNAQQAVGELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIERSQLNPNATKDSKGRLRVAAAVSVAKDIADRVGPLFDVNVDLVVVDTAHGHSQKVLDAVVQIKKNFPSLLVMAGNIATAEGALALIDAGADIIKVGIGPGSICTTRVVTGVGCPQLSAIMSVVEVAERAGVAIVADGGIRFSGDIAKAIAAGSACVMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAMERGSSARYSQDGVTDVLKLVPEGIEGRVPYKGPIASVLHQMSGGLKSSMGYVGASNIEEFQKKANFIRVSVAGLRESHVHDVKITRESPNYSETI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target493 inosine 5'-monophosphate dehydrogenase [Candidatus Libe
255764505341 polysialic acid capsule expression protein [Candid 3e-04
254780426320 hemolysin protein [Candidatus Liberibacter asiatic 0.001
>gi|255764505|ref|YP_003065248.2| polysialic acid capsule expression protein [Candidatus Liberibacter asiaticus str. psy62] Length = 341 Back     alignment
 Score = 38.1 bits (87), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 75/174 (43%), Gaps = 25/174 (14%)

Query: 48  PIMSAAMDQVTDSRLAIAMAQAGGLGVIHRNFSPSEQVAQVHQVKKF-----------ES 96
           P  SA M       LAIA+ ++       RNFS ++    +H   K             S
Sbjct: 175 PTTSAIMQLAIGDALAIALLES-------RNFSENDFYV-LHPGGKLGTLFVCASDVMHS 226

Query: 97  GMVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDV--RFASNAQQ- 153
           G  +  V I     L DA+ ++ +     + VV+    KL GI+T  D+   F  +    
Sbjct: 227 GDSIPLVKIG--CPLIDAITILSEKRFGCVAVVDEG-QKLKGIITEGDIFRNFHKDLNTL 283

Query: 154 AVGELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIER 207
           +V ++M +N   + +   L  A  LL QH I  L+VVDD    IG++   D+ R
Sbjct: 284 SVEDVMIKNPKVILEDTLLTVAMQLLRQHNISVLMVVDDCQKAIGIVHFLDLLR 337

>gi|254780426|ref|YP_003064839.1| hemolysin protein [Candidatus Liberibacter asiaticus str. psy62] Length = 320 Back     alignment
 Score = 35.8 bits (81), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 69/140 (49%), Gaps = 14/140 (10%)

Query: 109 ATLADALALMKKYSISGIPVVESDVGKLVGILTNRDV------RFAS------NAQQAVG 156
           AT+ +A+ + +KY  S +PV ++ +    G++  RDV       +A       N Q +  
Sbjct: 106 ATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSES 165

Query: 157 ELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIERSQLNPNATK 216
            L+ +N++ V  ++ + +    + + RI   LV+D+ G   GL++ +DI  S L  + T 
Sbjct: 166 NLI-KNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDI-VSVLMRDITS 223

Query: 217 DSKGRLRVAAAVSVAKDIAD 236
           +   +  + +AVS    I D
Sbjct: 224 EHHSKKSMISAVSDNTFIVD 243

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target493 inosine 5'-monophosphate dehydrogenase [Candidatus Libe
315122694496 inosine 5'-monophosphate dehydrogenase [Candidatus Libe 1 0.0
13476895500 inosine 5'-monophosphate dehydrogenase [Mesorhizobium l 1 0.0
116250620494 inosine 5'-monophosphate dehydrogenase [Rhizobium legum 1 0.0
260466886500 inosine-5'-monophosphate dehydrogenase [Mesorhizobium o 1 0.0
319784200500 inosine-5'-monophosphate dehydrogenase [Mesorhizobium c 1 0.0
150395604500 inosine 5'-monophosphate dehydrogenase [Sinorhizobium m 1 0.0
86356440494 inositol-5-monophosphate dehydrogenase [Rhizobium etli 1 0.0
153010375497 inositol-5-monophosphate dehydrogenase [Ochrobactrum an 1 0.0
241203226494 inosine 5'-monophosphate dehydrogenase [Rhizobium legum 1 0.0
327191166494 inositol-5-monophosphate dehydrogenase [Rhizobium etli 1 0.0
>gi|315122694|ref|YP_004063183.1| inosine 5'-monophosphate dehydrogenase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 496 Back     alignment and organism information
 Score =  826 bits (2133), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/495 (86%), Positives = 463/495 (93%), Gaps = 3/495 (0%)

Query: 1   MARIIENNVGGVALTFDDVLLRPEFSNVLPRDIDISTRIAKDFTLNLPIMSAAMDQVTDS 60
           MARIIENN+G +ALTFDDVLLRPEFS+VLP DIDIST+IAKDF LNLPI+SAAMDQVTDS
Sbjct: 1   MARIIENNIGDMALTFDDVLLRPEFSDVLPGDIDISTQIAKDFKLNLPIISAAMDQVTDS 60

Query: 61  RLAIAMAQAGGLGVIHRNFSPSEQVAQVHQVKKFESGMVVNPVTISPYATLADALALMKK 120
           RLAIAMAQAGGLGVIHRN SP EQV+QVHQVKKFESGMVVNPVTISP +TL DAL LMK 
Sbjct: 61  RLAIAMAQAGGLGVIHRNLSPCEQVSQVHQVKKFESGMVVNPVTISPCSTLEDALFLMKN 120

Query: 121 YSISGIPVVESDV---GKLVGILTNRDVRFASNAQQAVGELMTRNLITVKKTVNLENAKA 177
            SISGIPVVES+    GKLVGILTNRDVRFAS+ QQ VGELMTR+LITVKK ++LE AKA
Sbjct: 121 NSISGIPVVESNTCYPGKLVGILTNRDVRFASDTQQRVGELMTRDLITVKKEISLEEAKA 180

Query: 178 LLHQHRIEKLLVVDDDGCCIGLITVKDIERSQLNPNATKDSKGRLRVAAAVSVAKDIADR 237
           LLH++RIEKLLVVDDD CCIGLITVKDIERS+LNP+ATKDSKGRLRVAAAVSV KDI +R
Sbjct: 181 LLHKYRIEKLLVVDDDNCCIGLITVKDIERSRLNPHATKDSKGRLRVAAAVSVGKDIENR 240

Query: 238 VGPLFDVNVDLVVVDTAHGHSQKVLDAVVQIKKNFPSLLVMAGNIATAEGALALIDAGAD 297
           VGPL DV VDL+VVDTAHGHSQKVLDAV +IKKNFPS+LVMAGN+AT+EGALALIDAG+D
Sbjct: 241 VGPLVDVGVDLLVVDTAHGHSQKVLDAVKKIKKNFPSVLVMAGNVATSEGALALIDAGSD 300

Query: 298 IIKVGIGPGSICTTRVVTGVGCPQLSAIMSVVEVAERAGVAIVADGGIRFSGDIAKAIAA 357
           IIKVGIGPGSICTTR+VTGVGCPQLSAIMS V VAERAGVA++ADGGIRFSGDIAKAIAA
Sbjct: 301 IIKVGIGPGSICTTRIVTGVGCPQLSAIMSAVAVAERAGVAVIADGGIRFSGDIAKAIAA 360

Query: 358 GSACVMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAMERGSSARYSQDGVTDVLKL 417
           GSA VMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAM  GS+ARYSQDGVTDVLKL
Sbjct: 361 GSAAVMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAMVHGSAARYSQDGVTDVLKL 420

Query: 418 VPEGIEGRVPYKGPIASVLHQMSGGLKSSMGYVGASNIEEFQKKANFIRVSVAGLRESHV 477
           VPEGIE RVPYKGP+ASVLHQM+GGLKSSMGYVGA++I++FQKKANFIR+S AG+RESHV
Sbjct: 421 VPEGIEARVPYKGPVASVLHQMAGGLKSSMGYVGAADIKKFQKKANFIRISAAGVRESHV 480

Query: 478 HDVKITRESPNYSET 492
           HDVKITRESPNY ET
Sbjct: 481 HDVKITRESPNYFET 495


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|13476895|ref|NP_108464.1| inosine 5'-monophosphate dehydrogenase [Mesorhizobium loti MAFF303099] Length = 500 Back     alignment and organism information
>gi|116250620|ref|YP_766458.1| inosine 5'-monophosphate dehydrogenase [Rhizobium leguminosarum bv. viciae 3841] Length = 494 Back     alignment and organism information
>gi|260466886|ref|ZP_05813070.1| inosine-5'-monophosphate dehydrogenase [Mesorhizobium opportunistum WSM2075] Length = 500 Back     alignment and organism information
>gi|319784200|ref|YP_004143676.1| inosine-5'-monophosphate dehydrogenase [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 500 Back     alignment and organism information
>gi|150395604|ref|YP_001326071.1| inosine 5'-monophosphate dehydrogenase [Sinorhizobium medicae WSM419] Length = 500 Back     alignment and organism information
>gi|86356440|ref|YP_468332.1| inositol-5-monophosphate dehydrogenase [Rhizobium etli CFN 42] Length = 494 Back     alignment and organism information
>gi|153010375|ref|YP_001371589.1| inositol-5-monophosphate dehydrogenase [Ochrobactrum anthropi ATCC 49188] Length = 497 Back     alignment and organism information
>gi|241203226|ref|YP_002974322.1| inosine 5'-monophosphate dehydrogenase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 494 Back     alignment and organism information
>gi|327191166|gb|EGE58210.1| inositol-5-monophosphate dehydrogenase [Rhizobium etli CNPAF512] Length = 494 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target493 inosine 5'-monophosphate dehydrogenase [Candidatus Libe
PRK05567486 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogen 0.0
PTZ00314495 PTZ00314, PTZ00314, inosine-5'-monophosphate dehydrogen 1e-143
KOG2550503 KOG2550, KOG2550, KOG2550, IMP dehydrogenase/GMP reduct 1e-107
PLN02274505 PLN02274, PLN02274, inosine-5'-monophosphate dehydrogen 1e-97
PRK07807479 PRK07807, PRK07807, inosine 5-monophosphate dehydrogena 4e-86
PRK07107502 PRK07107, PRK07107, inosine 5-monophosphate dehydrogena 4e-79
TIGR01303475 TIGR01303, IMP_DH_rel_1, IMP dehydrogenase family prote 2e-75
pfam00478467 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase dom 0.0
TIGR01302450 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehyd 1e-175
cd00381325 cd00381, IMPDH, IMPDH: The catalytic domain of the inos 2e-92
PRK06843404 PRK06843, PRK06843, inosine 5-monophosphate dehydrogena 5e-85
TIGR01305343 TIGR01305, GMP_reduct_1, guanosine monophosphate reduct 2e-48
PRK05458326 PRK05458, PRK05458, guanosine 5'-monophosphate oxidored 3e-43
TIGR01306321 TIGR01306, GMP_reduct_2, guanosine monophosphate reduct 6e-37
PRK08649368 PRK08649, PRK08649, inosine 5-monophosphate dehydrogena 1e-28
PRK05096346 PRK05096, PRK05096, guanosine 5'-monophosphate oxidored 4e-54
COG0516170 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nucleot 8e-32
cd04601110 cd04601, CBS_pair_IMPDH, This cd contains two tandem re 3e-37
cd04602114 cd04602, CBS_pair_IMPDH_2, This cd contains two tandem 6e-20
cd04599105 cd04599, CBS_pair_GGDEF_assoc2, This cd contains two ta 5e-18
cd04585122 cd04585, CBS_pair_ACT_assoc2, This cd contains two tand 1e-17
cd04584121 cd04584, CBS_pair_ACT_assoc, This cd contains two tande 4e-17
cd04611111 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contain 5e-16
cd02205113 cd02205, CBS_pair, The CBS domain, named after human CB 1e-15
COG0517117 COG0517, COG0517, FOG: CBS domain [General function pre 4e-15
cd04622113 cd04622, CBS_pair_9, The CBS domain, named after human 5e-15
cd04631125 cd04631, CBS_pair_18, The CBS domain, named after human 5e-14
cd04800111 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd con 3e-13
cd04623113 cd04623, CBS_pair_10, The CBS domain, named after human 5e-13
cd04588110 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd con 6e-13
cd04803122 cd04803, CBS_pair_15, The CBS domain, named after human 1e-12
cd04638106 cd04638, CBS_pair_25, The CBS domain, named after human 4e-12
COG2524294 COG2524, COG2524, Predicted transcriptional regulator, 5e-12
cd04605110 cd04605, CBS_pair_MET2_assoc, This cd contains two tand 1e-11
cd04620115 cd04620, CBS_pair_7, The CBS domain, named after human 1e-11
cd04624112 cd04624, CBS_pair_11, The CBS domain, named after human 2e-11
cd04604114 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two 2e-11
cd04612111 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains 2e-11
cd04583109 cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains tw 3e-11
cd04595110 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd contains 3e-11
cd04637122 cd04637, CBS_pair_24, The CBS domain, named after human 7e-11
cd04634143 cd04634, CBS_pair_21, The CBS domain, named after human 4e-10
cd04633121 cd04633, CBS_pair_20, The CBS domain, named after human 1e-09
cd04590111 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two 1e-09
cd04607113 cd04607, CBS_pair_NTP_transferase_assoc, This cd contai 2e-09
cd04642126 cd04642, CBS_pair_29, The CBS domain, named after human 3e-09
cd04630114 cd04630, CBS_pair_17, The CBS domain, named after human 4e-09
cd04600124 cd04600, CBS_pair_HPP_assoc, This cd contains two tande 4e-09
cd04606109 cd04606, CBS_pair_Mg_transporter, This cd contains two 4e-09
cd04629114 cd04629, CBS_pair_16, The CBS domain, named after human 4e-09
cd04596108 cd04596, CBS_pair_DRTGG_assoc, This cd contains two tan 4e-09
cd04586135 cd04586, CBS_pair_BON_assoc, This cd contains two tande 6e-09
cd04610107 cd04610, CBS_pair_ParBc_assoc, This cd contains two tan 7e-09
cd04609110 cd04609, CBS_pair_PALP_assoc2, This cd contains two tan 8e-09
cd04587113 cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd cont 8e-09
cd04615113 cd04615, CBS_pair_2, The CBS domain, named after human 2e-08
cd04802112 cd04802, CBS_pair_3, The CBS domain, named after human 3e-08
cd04632128 cd04632, CBS_pair_19, The CBS domain, named after human 6e-08
cd04582106 cd04582, CBS_pair_ABC_OpuCA_assoc, This cd contains two 2e-07
cd04636132 cd04636, CBS_pair_23, The CBS domain, named after human 3e-07
KOG1764381 KOG1764, KOG1764, KOG1764, 5'-AMP-activated protein kin 8e-07
COG1253429 COG1253, TlyC, Hemolysins and related proteins containi 1e-06
cd04801114 cd04801, CBS_pair_M50_like, This cd contains two tandem 1e-06
cd04635122 cd04635, CBS_pair_22, The CBS domain, named after human 2e-06
COG3620187 COG3620, COG3620, Predicted transcriptional regulator w 2e-06
cd04627123 cd04627, CBS_pair_14, The CBS domain, named after human 2e-06
cd04643116 cd04643, CBS_pair_30, The CBS domain, named after human 7e-06
COG4109432 COG4109, COG4109, Predicted transcriptional regulator c 8e-06
COG3448382 COG3448, COG3448, CBS-domain-containing membrane protei 9e-06
cd04613114 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains 1e-05
cd04639111 cd04639, CBS_pair_26, The CBS domain, named after human 1e-05
cd04621135 cd04621, CBS_pair_8, The CBS domain, named after human 1e-05
cd04589111 cd04589, CBS_pair_CAP-ED_DUF294_assoc_bac, This cd cont 2e-05
cd04626111 cd04626, CBS_pair_13, The CBS domain, named after human 2e-05
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transport AT 2e-05
TIGR01137454 TIGR01137, cysta_beta, cystathionine beta-synthase 2e-05
cd04641120 cd04641, CBS_pair_28, The CBS domain, named after human 3e-05
cd04594104 cd04594, CBS_pair_EriC_assoc_archaea, This cd contains 4e-05
KOG1764381 KOG1764, KOG1764, KOG1764, 5'-AMP-activated protein kin 2e-04
PRK11543321 PRK11543, gutQ, D-arabinose 5-phosphate isomerase; Prov 2e-04
cd04598119 cd04598, CBS_pair_GGDEF_assoc, This cd contains two tan 5e-04
cd0461496 cd04614, CBS_pair_1, The CBS domain, named after human 0.001
cd00381325 cd00381, IMPDH, IMPDH: The catalytic domain of the inos 9e-26
PRK06843404 PRK06843, PRK06843, inosine 5-monophosphate dehydrogena 6e-19
COG0516170 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nucleot 8e-19
PRK08649368 PRK08649, PRK08649, inosine 5-monophosphate dehydrogena 5e-07
COG2070336 COG2070, COG2070, Dioxygenases related to 2-nitropropan 9e-05
TIGR01304369 TIGR01304, IMP_DH_rel_2, IMP dehydrogenase family prote 4e-04
PRK05096346 PRK05096, PRK05096, guanosine 5'-monophosphate oxidored 0.002
TIGR01305343 TIGR01305, GMP_reduct_1, guanosine monophosphate reduct 0.002
TIGR01304369 TIGR01304, IMP_DH_rel_2, IMP dehydrogenase family prote 1e-19
COG2905610 COG2905, COG2905, Predicted signal-transduction protein 4e-14
COG2239451 COG2239, MgtE, Mg/Co/Ni transporter MgtE (contains CBS 3e-09
cd02809299 cd02809, alpha_hydroxyacid_oxid_FMN, Family of homologo 3e-08
cd04737351 cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-bind 3e-04
cd04722200 cd04722, TIM_phosphate_binding, TIM barrel proteins sha 3e-04
cd02808392 cd02808, GltS_FMN, Glutamate synthase (GltS) FMN-bindin 3e-04
COG2070336 COG2070, COG2070, Dioxygenases related to 2-nitropropan 5e-04
PRK01130221 PRK01130, PRK01130, N-acetylmannosamine-6-phosphate 2-e 5e-04
cd04729219 cd04729, NanE, N-acetylmannosamine-6-phosphate epimeras 7e-04
cd04736361 cd04736, MDH_FMN, Mandelate dehydrogenase (MDH)-like FM 0.004
pfam0057157 pfam00571, CBS, CBS domain 1e-07
PRK14869 546 PRK14869, PRK14869, putative manganese-dependent inorga 2e-06
cd04597113 cd04597, CBS_pair_DRTGG_assoc2, This cd contains two ta 4e-05
cd04584121 cd04584, CBS_pair_ACT_assoc, This cd contains two tande 7e-05
cd04803122 cd04803, CBS_pair_15, The CBS domain, named after human 2e-04
cd04592133 cd04592, CBS_pair_EriC_assoc_euk, This cd contains two 0.001
smart0011649 smart00116, CBS, Domain in cystathionine beta-synthase 0.002
cd04637122 cd04637, CBS_pair_24, The CBS domain, named after human 3e-07
pfam0057157 pfam00571, CBS, CBS domain 5e-07
cd04585122 cd04585, CBS_pair_ACT_assoc2, This cd contains two tand 6e-07
cd04584121 cd04584, CBS_pair_ACT_assoc, This cd contains two tande 2e-06
cd04631125 cd04631, CBS_pair_18, The CBS domain, named after human 2e-06
smart0011649 smart00116, CBS, Domain in cystathionine beta-synthase 4e-06
PRK14869546 PRK14869, PRK14869, putative manganese-dependent inorga 9e-06
cd04800111 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd con 2e-05
cd04633121 cd04633, CBS_pair_20, The CBS domain, named after human 2e-05
cd04613114 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains 2e-05
cd04604114 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two 4e-05
cd02205113 cd02205, CBS_pair, The CBS domain, named after human CB 1e-04
cd04621135 cd04621, CBS_pair_8, The CBS domain, named after human 1e-04
cd04612111 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains 3e-04
cd04802112 cd04802, CBS_pair_3, The CBS domain, named after human 3e-04
cd04634143 cd04634, CBS_pair_21, The CBS domain, named after human 4e-04
cd04586135 cd04586, CBS_pair_BON_assoc, This cd contains two tande 4e-04
cd04638106 cd04638, CBS_pair_25, The CBS domain, named after human 6e-04
cd04606109 cd04606, CBS_pair_Mg_transporter, This cd contains two 8e-04
cd04636132 cd04636, CBS_pair_23, The CBS domain, named after human 8e-04
cd04623113 cd04623, CBS_pair_10, The CBS domain, named after human 0.001
cd04597113 cd04597, CBS_pair_DRTGG_assoc2, This cd contains two ta 0.001
cd04583109 cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains tw 0.002
cd04622113 cd04622, CBS_pair_9, The CBS domain, named after human 0.003
cd04607113 cd04607, CBS_pair_NTP_transferase_assoc, This cd contai 0.003
cd04605110 cd04605, CBS_pair_MET2_assoc, This cd contains two tand 0.004
pfam01070301 pfam01070, FMN_dh, FMN-dependent dehydrogenase 4e-07
cd04730236 cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), on 2e-05
COG0069485 COG0069, GltB, Glutamate synthase domain 2 [Amino acid 3e-04
pfam03060330 pfam03060, NPD, 2-nitropropane dioxygenase 4e-04
COG1304360 COG1304, LldD, L-lactate dehydrogenase (FMN-dependent) 5e-04
pfam01645367 pfam01645, Glu_synthase, Conserved region in glutamate 0.002
TIGR00393268 TIGR00393, kpsF, KpsF/GutQ family protein 2e-06
cd04600124 cd04600, CBS_pair_HPP_assoc, This cd contains two tande 9e-06
COG3448382 COG3448, COG3448, CBS-domain-containing membrane protei 6e-04
cd04585122 cd04585, CBS_pair_ACT_assoc2, This cd contains two tand 0.003
TIGR03151307 TIGR03151, enACPred_II, putative enoyl-(acyl-carrier-pr 3e-04
cd04730236 cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), on 4e-04
cd04599105 cd04599, CBS_pair_GGDEF_assoc2, This cd contains two ta 0.002
TIGR00400449 TIGR00400, mgtE, Mg2+ transporter (mgtE) 0.004
>gnl|CDD|180134 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|185550 PTZ00314, PTZ00314, inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|37761 KOG2550, KOG2550, KOG2550, IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|177913 PLN02274, PLN02274, inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|181127 PRK07807, PRK07807, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180842 PRK07107, PRK07107, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|130370 TIGR01303, IMP_DH_rel_1, IMP dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|144171 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain Back     alignment and domain information
>gnl|CDD|162293 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|73364 cd00381, IMPDH, IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|180725 PRK06843, PRK06843, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|130372 TIGR01305, GMP_reduct_1, guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>gnl|CDD|180097 PRK05458, PRK05458, guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|130373 TIGR01306, GMP_reduct_2, guanosine monophosphate reductase, bacterial Back     alignment and domain information
>gnl|CDD|181521 PRK08649, PRK08649, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|179935 PRK05096, PRK05096, guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|30862 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|73101 cd04601, CBS_pair_IMPDH, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>gnl|CDD|73102 cd04602, CBS_pair_IMPDH_2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>gnl|CDD|73099 cd04599, CBS_pair_GGDEF_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>gnl|CDD|73085 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|73084 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|73111 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>gnl|CDD|73081 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|30863 COG0517, COG0517, FOG: CBS domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|73121 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73129 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73142 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>gnl|CDD|73122 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73088 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>gnl|CDD|73145 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73136 cd04638, CBS_pair_25, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|32593 COG2524, COG2524, Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>gnl|CDD|73105 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>gnl|CDD|73119 cd04620, CBS_pair_7, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73123 cd04624, CBS_pair_11, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73104 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>gnl|CDD|73112 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>gnl|CDD|73083 cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>gnl|CDD|73095 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>gnl|CDD|73135 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73132 cd04634, CBS_pair_21, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73131 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73090 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>gnl|CDD|73107 cd04607, CBS_pair_NTP_transferase_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>gnl|CDD|73140 cd04642, CBS_pair_29, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73128 cd04630, CBS_pair_17, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73100 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>gnl|CDD|73106 cd04606, CBS_pair_Mg_transporter, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>gnl|CDD|73127 cd04629, CBS_pair_16, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73096 cd04596, CBS_pair_DRTGG_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>gnl|CDD|73086 cd04586, CBS_pair_BON_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>gnl|CDD|73110 cd04610, CBS_pair_ParBc_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>gnl|CDD|73109 cd04609, CBS_pair_PALP_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>gnl|CDD|73087 cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>gnl|CDD|73115 cd04615, CBS_pair_2, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73144 cd04802, CBS_pair_3, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73130 cd04632, CBS_pair_19, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73082 cd04582, CBS_pair_ABC_OpuCA_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>gnl|CDD|73134 cd04636, CBS_pair_23, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|36975 KOG1764, KOG1764, KOG1764, 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|31445 COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|73143 cd04801, CBS_pair_M50_like, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>gnl|CDD|73133 cd04635, CBS_pair_22, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|33419 COG3620, COG3620, Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>gnl|CDD|73126 cd04627, CBS_pair_14, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73141 cd04643, CBS_pair_30, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|33866 COG4109, COG4109, Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>gnl|CDD|33251 COG3448, COG3448, CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|73113 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>gnl|CDD|73137 cd04639, CBS_pair_26, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73120 cd04621, CBS_pair_8, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73089 cd04589, CBS_pair_CAP-ED_DUF294_assoc_bac, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>gnl|CDD|73125 cd04626, CBS_pair_13, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|162220 TIGR01137, cysta_beta, cystathionine beta-synthase Back     alignment and domain information
>gnl|CDD|73139 cd04641, CBS_pair_28, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73094 cd04594, CBS_pair_EriC_assoc_archaea, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea Back     alignment and domain information
>gnl|CDD|36975 KOG1764, KOG1764, KOG1764, 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|183186 PRK11543, gutQ, D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|73098 cd04598, CBS_pair_GGDEF_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>gnl|CDD|73114 cd04614, CBS_pair_1, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73364 cd00381, IMPDH, IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|180725 PRK06843, PRK06843, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|30862 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|181521 PRK08649, PRK08649, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|32253 COG2070, COG2070, Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] Back     alignment and domain information
>gnl|CDD|162294 TIGR01304, IMP_DH_rel_2, IMP dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|179935 PRK05096, PRK05096, guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|130372 TIGR01305, GMP_reduct_1, guanosine monophosphate reductase, eukaryotic Back     alignment and domain information
>gnl|CDD|162294 TIGR01304, IMP_DH_rel_2, IMP dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|32729 COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|32420 COG2239, MgtE, Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|73371 cd02809, alpha_hydroxyacid_oxid_FMN, Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>gnl|CDD|73399 cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>gnl|CDD|73384 cd04722, TIM_phosphate_binding, TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>gnl|CDD|73370 cd02808, GltS_FMN, Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information
>gnl|CDD|32253 COG2070, COG2070, Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] Back     alignment and domain information
>gnl|CDD|179231 PRK01130, PRK01130, N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|73391 cd04729, NanE, N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate Back     alignment and domain information
>gnl|CDD|73398 cd04736, MDH_FMN, Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>gnl|CDD|144238 pfam00571, CBS, CBS domain Back     alignment and domain information
>gnl|CDD|184871 PRK14869, PRK14869, putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|73097 cd04597, CBS_pair_DRTGG_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>gnl|CDD|73084 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|73145 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73092 cd04592, CBS_pair_EriC_assoc_euk, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>gnl|CDD|128426 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>gnl|CDD|73135 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|144238 pfam00571, CBS, CBS domain Back     alignment and domain information
>gnl|CDD|73085 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|73084 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|73129 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|128426 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>gnl|CDD|184871 PRK14869, PRK14869, putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|73142 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>gnl|CDD|73131 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73113 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>gnl|CDD|73104 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>gnl|CDD|73081 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73120 cd04621, CBS_pair_8, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73112 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>gnl|CDD|73144 cd04802, CBS_pair_3, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73132 cd04634, CBS_pair_21, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73086 cd04586, CBS_pair_BON_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>gnl|CDD|73136 cd04638, CBS_pair_25, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73106 cd04606, CBS_pair_Mg_transporter, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>gnl|CDD|73134 cd04636, CBS_pair_23, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73122 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73097 cd04597, CBS_pair_DRTGG_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>gnl|CDD|73083 cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>gnl|CDD|73121 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73107 cd04607, CBS_pair_NTP_transferase_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>gnl|CDD|73105 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>gnl|CDD|144604 pfam01070, FMN_dh, FMN-dependent dehydrogenase Back     alignment and domain information
>gnl|CDD|73392 cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>gnl|CDD|30418 COG0069, GltB, Glutamate synthase domain 2 [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|145943 pfam03060, NPD, 2-nitropropane dioxygenase Back     alignment and domain information
>gnl|CDD|31495 COG1304, LldD, L-lactate dehydrogenase (FMN-dependent) and related alpha-hydroxy acid dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|110632 pfam01645, Glu_synthase, Conserved region in glutamate synthase Back     alignment and domain information
>gnl|CDD|129488 TIGR00393, kpsF, KpsF/GutQ family protein Back     alignment and domain information
>gnl|CDD|73100 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>gnl|CDD|33251 COG3448, COG3448, CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|73085 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|132195 TIGR03151, enACPred_II, putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>gnl|CDD|73392 cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>gnl|CDD|73099 cd04599, CBS_pair_GGDEF_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>gnl|CDD|129495 TIGR00400, mgtE, Mg2+ transporter (mgtE) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 493 inosine 5'-monophosphate dehydrogenase [Candidatus Libe
TIGR01302476 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; In 100.0
PTZ00314499 inosine-5'-monophosphate dehydrogenase; Provisional 100.0
PRK07807479 inositol-5-monophosphate dehydrogenase; Validated 100.0
pfam00478467 IMPDH IMP dehydrogenase / GMP reductase domain. This fa 100.0
KOG2550503 consensus 100.0
PRK06843404 inositol-5-monophosphate dehydrogenase; Validated 100.0
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine monoph 100.0
PRK05096347 guanosine 5'-monophosphate oxidoreductase; Provisional 100.0
PRK08649368 inositol-5-monophosphate dehydrogenase; Validated 100.0
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisional 100.0
TIGR01303476 IMP_DH_rel_1 IMP dehydrogenase family protein; InterPro 100.0
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase; InterPr 100.0
TIGR01304376 IMP_DH_rel_2 IMP dehydrogenase family protein; InterPro 100.0
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase; InterPr 100.0
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain. 99.65
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain 99.63
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding 99.63
PRK11197381 lldD L-lactate dehydrogenase; Provisional 99.59
TIGR02151349 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, typ 99.57
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding dom 99.56
KOG0538363 consensus 99.12
TIGR01303476 IMP_DH_rel_1 IMP dehydrogenase family protein; InterPro 96.7
PRK05567486 inositol-5'-monophosphate dehydrogenase; Reviewed 100.0
PRK07107497 inositol-5-monophosphate dehydrogenase; Validated 100.0
COG0516170 GuaB IMP dehydrogenase/GMP reductase [Nucleotide transp 99.97
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repeats of 99.9
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem repeat 99.87
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two tandem 99.86
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, is a 99.86
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem repeat 99.86
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats of t 99.86
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, is a 99.85
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, is a 99.85
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, is a 99.85
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem r 99.85
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, is a 99.85
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, is a 99.84
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem repea 99.84
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, is a 99.84
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, is a 99.84
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, is a 99.84
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem repeats 99.84
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two t 99.83
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, is a 99.83
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem repeats 99.83
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem repeats 99.83
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, is a 99.83
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, is a 99.83
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem re 99.83
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two 99.83
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem repeats 99.83
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, is a 99.82
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, is a 99.82
cd04586135 CBS_pair_BON_assoc This cd contains two tandem repeats 99.82
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two tande 99.82
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem 99.81
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, is a 99.81
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, is a 99.81
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tande 99.81
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, is a 99.81
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, is a 99.81
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, is a 99.81
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, is a 99.81
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains two tan 99.81
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, is a 99.81
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, is a 99.81
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tand 99.8
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, is a 99.8
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tande 99.8
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, is a 99.8
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, is a 99.8
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, is a 99.79
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem re 99.79
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, is a 99.79
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two 99.78
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two t 99.76
cd04801114 CBS_pair_M50_like This cd contains two tandem repeats o 99.76
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, is a 99.75
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem repeats 99.75
COG2524294 Predicted transcriptional regulator, contains C-termina 99.74
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem repeat 99.74
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, is a 99.73
cd04606109 CBS_pair_Mg_transporter This cd contains two tandem rep 99.69
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem repeat 99.67
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tandem re 99.61
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem 99.6
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem repeats 99.59
PRK01862583 putative voltage-gated ClC-type chloride channel ClcB; 99.58
cd02205113 CBS_pair The CBS domain, named after human CBS, is a sm 99.5
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tandem rep 99.38
COG3620187 Predicted transcriptional regulator with C-terminal CBS 99.34
COG0517117 FOG: CBS domain [General function prediction only] 99.33
TIGR00393272 kpsF sugar isomerase, KpsF/GutQ family; InterPro: IPR00 99.22
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 99.22
COG1253429 TlyC Hemolysins and related proteins containing CBS dom 99.18
KOG1764381 consensus 99.01
TIGR01137527 cysta_beta cystathionine beta-synthase; InterPro: IPR00 98.69
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, is a 98.56
COG4535293 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic 98.46
KOG1764381 consensus 98.45
COG4536423 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic 98.43
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 97.53
TIGR00400460 mgtE magnesium transporter; InterPro: IPR006669 This is 96.67
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of the n 99.87
pfam03060330 NPD 2-nitropropane dioxygenase. Members of this family 99.81
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) reduc 99.75
COG2070336 Dioxygenases related to 2-nitropropane dioxygenase [Gen 99.35
pfam04551345 GcpE GcpE protein. In a variety of organisms, including 96.51
PRK05437351 isopentenyl pyrophosphate isomerase; Provisional 99.79
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosp 99.73
COG1304360 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 a 99.48
COG0516170 GuaB IMP dehydrogenase/GMP reductase [Nucleotide transp 99.42
cd02808392 GltS_FMN Glutamate synthase (GltS) FMN-binding domain. 98.79
TIGR02708368 L_lactate_ox L-lactate oxidase; InterPro: IPR014080 Mem 98.67
COG0069485 GltB Glutamate synthase domain 2 [Amino acid transport 98.66
pfam01070301 FMN_dh FMN-dependent dehydrogenase. 99.75
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dep 99.7
PRK08318413 dihydropyrimidine dehydrogenase; Validated 99.24
PRK07565333 dihydroorotate dehydrogenase 2; Reviewed 99.23
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like prot 99.23
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 98.72
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 98.69
pfam01645367 Glu_synthase Conserved region in glutamate synthase. Th 98.59
PRK02506308 dihydroorotate dehydrogenase 1A; Reviewed 98.12
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide transport 98.06
COG4109432 Predicted transcriptional regulator containing CBS doma 99.73
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisional 99.65
COG3448382 CBS-domain-containing membrane protein [Signal transduc 99.59
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 99.58
TIGR03520408 GldE gliding motility-associated protein GldE. Members 99.43
PRK11573413 hypothetical protein; Provisional 99.24
TIGR01186372 proV glycine betaine/L-proline transport ATP binding su 99.23
KOG0475696 consensus 98.7
KOG0474762 consensus 98.51
KOG2118498 consensus 96.26
TIGR01137527 cysta_beta cystathionine beta-synthase; InterPro: IPR00 96.24
COG2905610 Predicted signal-transduction protein containing cAMP-b 99.69
TIGR01186372 proV glycine betaine/L-proline transport ATP binding su 95.94
COG2239451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [I 99.28
pfam00478467 IMPDH IMP dehydrogenase / GMP reductase domain. This fa 98.76
COG2513289 PrpB PEP phosphonomutase and related enzymes [Carbohydr 93.84
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem repea 98.95
PTZ00314499 inosine-5'-monophosphate dehydrogenase; Provisional 98.92
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, is a 98.66
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, is a 98.6
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, is a 98.59
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, is a 98.59
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, is a 98.56
smart0011649 CBS Domain in cystathionine beta-synthase and other pro 98.56
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tande 98.55
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem repeats 98.54
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem repeats 98.53
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem repeats 98.53
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem re 98.52
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, is a 98.51
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, is a 98.5
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, is a 98.49
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, is a 98.49
cd04586135 CBS_pair_BON_assoc This cd contains two tandem repeats 98.48
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, is a 98.48
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, is a 98.47
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, is a 98.47
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, is a 98.46
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, is a 98.46
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, is a 98.45
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem r 98.45
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two tande 98.44
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem repeats 98.41
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repeats of 98.4
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, is a 98.39
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, is a 98.39
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, is a 98.36
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem repeats 98.35
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem repeat 98.34
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two 98.32
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, is a 98.31
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, is a 98.29
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem 98.29
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains two tan 98.26
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem repeat 98.25
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tande 98.24
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats of t 98.23
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, is a 98.23
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem repeat 98.22
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tandem rep 98.2
pfam0057157 CBS CBS domain. CBS domains are small intracellular mod 98.2
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem repeats 98.15
cd04801114 CBS_pair_M50_like This cd contains two tandem repeats o 98.12
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two 98.03
PRK01862583 putative voltage-gated ClC-type chloride channel ClcB; 98.0
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem repeat 97.85
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tandem re 97.85
cd02205113 CBS_pair The CBS domain, named after human CBS, is a sm 97.6
COG2905 610 Predicted signal-transduction protein containing cAMP-b 97.5
COG3620187 Predicted transcriptional regulator with C-terminal CBS 97.36
COG1253429 TlyC Hemolysins and related proteins containing CBS dom 97.16
COG0517117 FOG: CBS domain [General function prediction only] 97.01
TIGR03520408 GldE gliding motility-associated protein GldE. Members 96.96
COG2239451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [I 96.86
PRK11573413 hypothetical protein; Provisional 96.55
KOG0474762 consensus 94.7
PRK05567486 inositol-5'-monophosphate dehydrogenase; Reviewed 98.93
TIGR01302476 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; In 98.81
TIGR01108 616 oadA oxaloacetate decarboxylase alpha subunit; InterPro 94.11
PRK13122242 consensus 93.92
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) c 98.92
PRK01130222 N-acetylmannosamine-6-phosphate 2-epimerase; Provisiona 98.84
pfam04131192 NanE Putative N-acetylmannosamine-6-phosphate epimerase 98.82
cd04722200 TIM_phosphate_binding TIM barrel proteins share a struc 98.69
pfam01180290 DHO_dh Dihydroorotate dehydrogenase. 98.62
PRK07455210 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 98.36
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 98.34
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and D 98.33
PRK08104212 consensus 98.33
PRK06015212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 98.32
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN bind 98.3
PRK08782219 consensus 98.24
PRK06552209 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 98.23
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding dom 98.2
PRK08904207 consensus 98.19
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family belong 98.19
pfam01081196 Aldolase KDPG and KHG aldolase. This family includes th 98.11
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epimerase 98.11
TIGR01182205 eda 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydrox 98.11
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding doma 98.1
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Review 98.09
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN bind 98.05
PRK07114223 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 98.03
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN bind 98.0
COG0800