254780889

inosine 5'-monophosphate dehydrogenase

GeneID in NCBI database:	8209909	Locus tag:	CLIBASIA_03930
Protein GI in NCBI database:	254780889	Protein Accession:	YP_003065302.1
Gene range:	+(864881, 866362)	Protein Length:	493aa
Gene description:	inosine 5'-monophosphate dehydrogenase
COG prediction:	[F] IMP dehydrogenase/GMP reductase
KEGG prediction:	quaB; inosine 5'-monophosphate dehydrogenase (EC:1.1.1.205); K00088 IMP dehydrogenase [EC:1.1.1.205]
SEED prediction:	Inosine-monophosphate dehydrogenase (EC 1.1.1.205)
Pathway involved in KEGG:	Purine metabolism [PATH:las00230]
Subsystem involved in SEED:	Purine conversions
sequence	sequence profile

Prediction of Local Sequence Properties

Source	Summary	Result

	scaler
NCBI Database	sequence
PSIPRED	secondary structure
SSPRO	secondary structure
DISEMBL	coil and loop
DISEMBL	flexible loop
SEG	low complexity
DISOPRED	disordered
DISEMBL	missing residues
DISPRO	disordered
TMHMM	none TM-Helix
TOPPRED	4 TM-Helix
HMMTOP	2 TM-Helix
MEMSAT	none TM-Helix
MEMSAT_SVM	none TM-Helix
PHOBIUS	none TM-Helix
SignalP_HMM	no
SignalP_NN	no
COILS	coiled coil
70% MSA	conservation map
90% MSA	conservation map

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490---

MARIIENNVGGVALTFDDVLLRPEFSNVLPRDIDISTRIAKDFTLNLPIMSAAMDQVTDSRLAIAMAQAGGLGVIHRNFSPSEQVAQVHQVKKFESGMVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDVRFASNAQQAVGELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIERSQLNPNATKDSKGRLRVAAAVSVAKDIADRVGPLFDVNVDLVVVDTAHGHSQKVLDAVVQIKKNFPSLLVMAGNIATAEGALALIDAGADIIKVGIGPGSICTTRVVTGVGCPQLSAIMSVVEVAERAGVAIVADGGIRFSGDIAKAIAAGSACVMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAMERGSSARYSQDGVTDVLKLVPEGIEGRVPYKGPIASVLHQMSGGLKSSMGYVGASNIEEFQKKANFIRVSVAGLRESHVHDVKITRESPNYSETI

ccccccccccccccccHHEEEccccccccHHHcEEEEEEcccEEEEccEEEcHHHHHHHHHHHHHHHHccccEEccccccHHHHHHHHHcccHHHcccccccEEEcccccHHHHHHHHHHccccEEEEEccccccEEEEEEHHHHHccccccccHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEccccEEEEEEEcHHHHHHccccHHHHHHHcccccccccccccHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHcccccEEEEEEEcHHHHHHHHHccccEEEEEcccccccccHHHcccccccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHccccEEEEccHHHHcccccccEEEEccEEHHHHccccccHHHcccccEEEcccccccHHHccccccEEEEcccccHHHHHHHHHHHHHHHHHHcccccHHHHHHccEEEEEcHHHccccccccEEEEEccccccccc

ccHHHHcccHHcccccccEEEcccccccccccccccHHHHcccccccHHHHHccccccHHHHHHHHHHccccEEEEccccHHHHHHHHHHHccccccEEEccccccccHHHHHHHHHHHHccccccEEEccccccEEEEEEcccEEEcccccccHHHHccccccEccccccHHHHHHHHHHcccEEEEEEcccccEEEEEEEHHHHHHHHcccccHcccccEEEEEEccccccHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHccccEEEEEcccccEcEEEEEEcccHHHHHHHHHHHHHHHHccccEEEcccEEEccHHHHHHHHcccEEEEEcHccccccccccEEEEEccEEEEEcccccHHHHccccccHHHccccccHHccccccccccccccccHHHHHHHHHHHHHHcccccccHcHHHHHHcccEEEEccccccccccccEEEEcccccccccc

MARIIennvggvaltfddvllrpefsnvlprdidistriakdftlnlpimsaaMDQVTDSRLAIAMAQAGGlgvihrnfspseqvAQVHQVKKFesgmvvnpvtispYATLADALALMKKYsisgipvvesdvgkLVGILTNRDVRFASNAQQAVGELMTRNLITVKKTVNLENAKALLHQHRIEKLLvvdddgccigLITVKdiersqlnpnatkdskgRLRVAAAVSVAKDIadrvgplfdvNVDLVVVDTAHGHSQKVLDAVVQIKKNFPSLLVMAGNIATAEGALALIDAGADIikvgigpgsicttrvvtgvgcpqLSAIMSVVEVAERAGVAivadggirfSGDIAKAIAAGSACVMIGsllagtdespgdiflyqgrsfksyrgmGSVAAMErgssarysqdgvTDVLKLvpegiegrvpykgpiaSVLHQMSgglkssmgyvgasNIEEFQKKANFIRVSVAglreshvhdvkitrespnyseti

mariiennvggvaltfddvllrpefsnvlprdidistriAKDFTLNLPIMSAAMDQVTDSRLAIAMAQAGGLGVIHRNFSPSEQVAQVHQVKKFESGMVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDVRFASNAQQAVGELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLItvkdiersqlnpnatkdskgrlRVAAAVSVAKdiadrvgplFDVNVDLVVVDTAHGHSQKVLDAVVQIKKNFPSLLVMAGNIATAEGALALIDAGADIIKVGIGPGSICTTRVVTGVGCPQLSAIMSVVEVAERAGVAIVADGGIRFSGDIAKAIAAGSACVMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAMERgssarysqdgVTDVLKLVPEGIEGRVPYKGPIASVLHQMSGGLKSSMGYVGASNIEEFQKKANFIRVSVAglreshvhdvkitrespnyseti

MARIIENNVGGVALTFDDVLLRPEFSNVLPRDIDISTRIAKDFTLNLPIMSAAMDQVTDSRLAIAMAQAGGLGVIHRNFSPSEQVAQVHQVKKFESGMVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDVRFASNAQQAVGELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIERSQLNPNATKDSKGRLRVAAAVSVAKDIADRVGPLFdvnvdlvvvdTAHGHSQKVLDAVVQIKKNFPSLLVMAGNIATAEgalalidagadiiKVGIGPGSICTTRVVTGVGCPQLSAIMSVVEVAERAGVAIVADGGIRFSGDIAKAIAAGSACVMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAMERGSSARYSQDGVTDVLKLVPEGIEGRVPYKGPIASVLHQMSGGLKSSMGYVGASNIEEFQKKANFIRVSVAGLRESHVHDVKITRESPNYSETI

*******NVGGVALTFDDVLLRPEFSNVLPRDIDISTRIAKDFTLNLPIMSAAMDQVTDSRLAIAMAQAGGLGVIHRNFSPSEQVAQVHQVKKFESGMVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDVRFASNAQQAVGELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIERSQLNPNATKDSKGRLRVAAAVSVAKDIADRVGPLFDVNVDLVVVDTAHGHSQKVLDAVVQIKKNFPSLLVMAGNIATAEGALALIDAGADIIKVGIGPGSICTTRVVTGVGCPQLSAIMSVVEVAERAGVAIVADGGIRFSGDIAKAIAAGSACVMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAMERGSSARYSQDGVTDVLKLVPEGIEGRVPYKGPIASVLHQMSGGLKSSMGYVGASNIEEFQKKANFIRVSVAGLRESHVHDVKITRE*PN*****

*ARIIENNVGGVALTFDDVLLRPEFSNVLPRDIDISTRIAKDFTLNLPIMSAAMDQVTDSRLAIAMAQAGGLGVIHRNFSPSEQVAQVHQVKKFESGMVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDVRFASNAQQAVGELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIERSQLNPNATKDSKGRLRVAAAVSVAKDIADRVGPLFDVNVDLVVVDTAHGHSQKVLDAVVQIKKNFPSLLVMAGNIATAEGALALIDAGADIIKVGIGPGSICTTRVVTGVGCPQLSAIMSVVEVAERAGVAIVADGGIRFSGDIAKAIAAGSACVMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAMERGSSARYSQDGVTDVLKLVPEGIEGRVPYKGPIASVLHQMSGGLKSSMGYVGASNIEEFQKKANFIRVSVAGLRESHVHDVKITRES*******

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

Identity	Alignment graph	Length	Definition	E-value
Target		493	inosine 5'-monophosphate dehydrogenase [Candidatus Libe
255764505		341	polysialic acid capsule expression protein [Candid	3e-04
254780426		320	hemolysin protein [Candidatus Liberibacter asiatic	0.001

>gi\|255764505\|ref\|YP_003065248.2\| polysialic acid capsule expression protein [Candidatus Liberibacter asiaticus str. psy62] Length = 341	Back alignment

 Score = 38.1 bits (87), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 75/174 (43%), Gaps = 25/174 (14%)

Query: 48  PIMSAAMDQVTDSRLAIAMAQAGGLGVIHRNFSPSEQVAQVHQVKKF-----------ES 96
           P  SA M       LAIA+ ++       RNFS ++    +H   K             S
Sbjct: 175 PTTSAIMQLAIGDALAIALLES-------RNFSENDFYV-LHPGGKLGTLFVCASDVMHS 226

Query: 97  GMVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDV--RFASNAQQ- 153
           G  +  V I     L DA+ ++ +     + VV+    KL GI+T  D+   F  +    
Sbjct: 227 GDSIPLVKIG--CPLIDAITILSEKRFGCVAVVDEG-QKLKGIITEGDIFRNFHKDLNTL 283

Query: 154 AVGELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIER 207
           +V ++M +N   + +   L  A  LL QH I  L+VVDD    IG++   D+ R
Sbjct: 284 SVEDVMIKNPKVILEDTLLTVAMQLLRQHNISVLMVVDDCQKAIGIVHFLDLLR 337

>gi\|254780426\|ref\|YP_003064839.1\| hemolysin protein [Candidatus Liberibacter asiaticus str. psy62] Length = 320	Back alignment

 Score = 35.8 bits (81), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/140 (25%), Positives = 69/140 (49%), Gaps = 14/140 (10%)

Query: 109 ATLADALALMKKYSISGIPVVESDVGKLVGILTNRDV------RFAS------NAQQAVG 156
           AT+ +A+ + +KY  S +PV ++ +    G++  RDV       +A       N Q +  
Sbjct: 106 ATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSES 165

Query: 157 ELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIERSQLNPNATK 216
            L+ +N++ V  ++ + +    + + RI   LV+D+ G   GL++ +DI  S L  + T 
Sbjct: 166 NLI-KNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDI-VSVLMRDITS 223

Query: 217 DSKGRLRVAAAVSVAKDIAD 236
           +   +  + +AVS    I D
Sbjct: 224 EHHSKKSMISAVSDNTFIVD 243

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

Identity	Alignment graph	Length	Definition	Round	E-value
Target		493	inosine 5'-monophosphate dehydrogenase [Candidatus Libe
315122694		496	inosine 5'-monophosphate dehydrogenase [Candidatus Libe	1	0.0
13476895		500	inosine 5'-monophosphate dehydrogenase [Mesorhizobium l	1	0.0
116250620		494	inosine 5'-monophosphate dehydrogenase [Rhizobium legum	1	0.0
260466886		500	inosine-5'-monophosphate dehydrogenase [Mesorhizobium o	1	0.0
319784200		500	inosine-5'-monophosphate dehydrogenase [Mesorhizobium c	1	0.0
150395604		500	inosine 5'-monophosphate dehydrogenase [Sinorhizobium m	1	0.0
86356440		494	inositol-5-monophosphate dehydrogenase [Rhizobium etli	1	0.0
153010375		497	inositol-5-monophosphate dehydrogenase [Ochrobactrum an	1	0.0
241203226		494	inosine 5'-monophosphate dehydrogenase [Rhizobium legum	1	0.0
327191166		494	inositol-5-monophosphate dehydrogenase [Rhizobium etli	1	0.0

>gi\|315122694\|ref\|YP_004063183.1\| inosine 5'-monophosphate dehydrogenase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 496	Back alignment and organism information

 Score =  826 bits (2133), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/495 (86%), Positives = 463/495 (93%), Gaps = 3/495 (0%)

Query: 1   MARIIENNVGGVALTFDDVLLRPEFSNVLPRDIDISTRIAKDFTLNLPIMSAAMDQVTDS 60
           MARIIENN+G +ALTFDDVLLRPEFS+VLP DIDIST+IAKDF LNLPI+SAAMDQVTDS
Sbjct: 1   MARIIENNIGDMALTFDDVLLRPEFSDVLPGDIDISTQIAKDFKLNLPIISAAMDQVTDS 60

Query: 61  RLAIAMAQAGGLGVIHRNFSPSEQVAQVHQVKKFESGMVVNPVTISPYATLADALALMKK 120
           RLAIAMAQAGGLGVIHRN SP EQV+QVHQVKKFESGMVVNPVTISP +TL DAL LMK 
Sbjct: 61  RLAIAMAQAGGLGVIHRNLSPCEQVSQVHQVKKFESGMVVNPVTISPCSTLEDALFLMKN 120

Query: 121 YSISGIPVVESDV---GKLVGILTNRDVRFASNAQQAVGELMTRNLITVKKTVNLENAKA 177
            SISGIPVVES+    GKLVGILTNRDVRFAS+ QQ VGELMTR+LITVKK ++LE AKA
Sbjct: 121 NSISGIPVVESNTCYPGKLVGILTNRDVRFASDTQQRVGELMTRDLITVKKEISLEEAKA 180

Query: 178 LLHQHRIEKLLVVDDDGCCIGLITVKDIERSQLNPNATKDSKGRLRVAAAVSVAKDIADR 237
           LLH++RIEKLLVVDDD CCIGLITVKDIERS+LNP+ATKDSKGRLRVAAAVSV KDI +R
Sbjct: 181 LLHKYRIEKLLVVDDDNCCIGLITVKDIERSRLNPHATKDSKGRLRVAAAVSVGKDIENR 240

Query: 238 VGPLFDVNVDLVVVDTAHGHSQKVLDAVVQIKKNFPSLLVMAGNIATAEGALALIDAGAD 297
           VGPL DV VDL+VVDTAHGHSQKVLDAV +IKKNFPS+LVMAGN+AT+EGALALIDAG+D
Sbjct: 241 VGPLVDVGVDLLVVDTAHGHSQKVLDAVKKIKKNFPSVLVMAGNVATSEGALALIDAGSD 300

Query: 298 IIKVGIGPGSICTTRVVTGVGCPQLSAIMSVVEVAERAGVAIVADGGIRFSGDIAKAIAA 357
           IIKVGIGPGSICTTR+VTGVGCPQLSAIMS V VAERAGVA++ADGGIRFSGDIAKAIAA
Sbjct: 301 IIKVGIGPGSICTTRIVTGVGCPQLSAIMSAVAVAERAGVAVIADGGIRFSGDIAKAIAA 360

Query: 358 GSACVMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAMERGSSARYSQDGVTDVLKL 417
           GSA VMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAM  GS+ARYSQDGVTDVLKL
Sbjct: 361 GSAAVMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAMVHGSAARYSQDGVTDVLKL 420

Query: 418 VPEGIEGRVPYKGPIASVLHQMSGGLKSSMGYVGASNIEEFQKKANFIRVSVAGLRESHV 477
           VPEGIE RVPYKGP+ASVLHQM+GGLKSSMGYVGA++I++FQKKANFIR+S AG+RESHV
Sbjct: 421 VPEGIEARVPYKGPVASVLHQMAGGLKSSMGYVGAADIKKFQKKANFIRISAAGVRESHV 480

Query: 478 HDVKITRESPNYSET 492
           HDVKITRESPNY ET
Sbjct: 481 HDVKITRESPNYFET 495

Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

>gi\|13476895\|ref\|NP_108464.1\| inosine 5'-monophosphate dehydrogenase [Mesorhizobium loti MAFF303099] Length = 500	Back alignment and organism information

>gi\|116250620\|ref\|YP_766458.1\| inosine 5'-monophosphate dehydrogenase [Rhizobium leguminosarum bv. viciae 3841] Length = 494	Back alignment and organism information

>gi\|260466886\|ref\|ZP_05813070.1\| inosine-5'-monophosphate dehydrogenase [Mesorhizobium opportunistum WSM2075] Length = 500	Back alignment and organism information

>gi\|319784200\|ref\|YP_004143676.1\| inosine-5'-monophosphate dehydrogenase [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 500	Back alignment and organism information

>gi\|150395604\|ref\|YP_001326071.1\| inosine 5'-monophosphate dehydrogenase [Sinorhizobium medicae WSM419] Length = 500	Back alignment and organism information

>gi\|86356440\|ref\|YP_468332.1\| inositol-5-monophosphate dehydrogenase [Rhizobium etli CFN 42] Length = 494	Back alignment and organism information

>gi\|153010375\|ref\|YP_001371589.1\| inositol-5-monophosphate dehydrogenase [Ochrobactrum anthropi ATCC 49188] Length = 497	Back alignment and organism information

>gi\|241203226\|ref\|YP_002974322.1\| inosine 5'-monophosphate dehydrogenase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 494	Back alignment and organism information

>gi\|327191166\|gb\|EGE58210.1\| inositol-5-monophosphate dehydrogenase [Rhizobium etli CNPAF512] Length = 494	Back alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

Identity	Alignment graph	Length	Definition	E-value
Target		493	inosine 5'-monophosphate dehydrogenase [Candidatus Libe
PRK05567		486	PRK05567, PRK05567, inosine 5'-monophosphate dehydrogen	0.0
PTZ00314		495	PTZ00314, PTZ00314, inosine-5'-monophosphate dehydrogen	1e-143
KOG2550		503	KOG2550, KOG2550, KOG2550, IMP dehydrogenase/GMP reduct	1e-107
PLN02274		505	PLN02274, PLN02274, inosine-5'-monophosphate dehydrogen	1e-97
PRK07807		479	PRK07807, PRK07807, inosine 5-monophosphate dehydrogena	4e-86
PRK07107		502	PRK07107, PRK07107, inosine 5-monophosphate dehydrogena	4e-79
TIGR01303		475	TIGR01303, IMP_DH_rel_1, IMP dehydrogenase family prote	2e-75
pfam00478		467	pfam00478, IMPDH, IMP dehydrogenase / GMP reductase dom	0.0
TIGR01302		450	TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehyd	1e-175
cd00381		325	cd00381, IMPDH, IMPDH: The catalytic domain of the inos	2e-92
PRK06843		404	PRK06843, PRK06843, inosine 5-monophosphate dehydrogena	5e-85
TIGR01305		343	TIGR01305, GMP_reduct_1, guanosine monophosphate reduct	2e-48
PRK05458		326	PRK05458, PRK05458, guanosine 5'-monophosphate oxidored	3e-43
TIGR01306		321	TIGR01306, GMP_reduct_2, guanosine monophosphate reduct	6e-37
PRK08649		368	PRK08649, PRK08649, inosine 5-monophosphate dehydrogena	1e-28
PRK05096		346	PRK05096, PRK05096, guanosine 5'-monophosphate oxidored	4e-54
COG0516		170	COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nucleot	8e-32
cd04601		110	cd04601, CBS_pair_IMPDH, This cd contains two tandem re	3e-37
cd04602		114	cd04602, CBS_pair_IMPDH_2, This cd contains two tandem	6e-20
cd04599		105	cd04599, CBS_pair_GGDEF_assoc2, This cd contains two ta	5e-18
cd04585		122	cd04585, CBS_pair_ACT_assoc2, This cd contains two tand	1e-17
cd04584		121	cd04584, CBS_pair_ACT_assoc, This cd contains two tande	4e-17
cd04611		111	cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contain	5e-16
cd02205		113	cd02205, CBS_pair, The CBS domain, named after human CB	1e-15
COG0517		117	COG0517, COG0517, FOG: CBS domain [General function pre	4e-15
cd04622		113	cd04622, CBS_pair_9, The CBS domain, named after human	5e-15
cd04631		125	cd04631, CBS_pair_18, The CBS domain, named after human	5e-14
cd04800		111	cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd con	3e-13
cd04623		113	cd04623, CBS_pair_10, The CBS domain, named after human	5e-13
cd04588		110	cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd con	6e-13
cd04803		122	cd04803, CBS_pair_15, The CBS domain, named after human	1e-12
cd04638		106	cd04638, CBS_pair_25, The CBS domain, named after human	4e-12
COG2524		294	COG2524, COG2524, Predicted transcriptional regulator,	5e-12
cd04605		110	cd04605, CBS_pair_MET2_assoc, This cd contains two tand	1e-11
cd04620		115	cd04620, CBS_pair_7, The CBS domain, named after human	1e-11
cd04624		112	cd04624, CBS_pair_11, The CBS domain, named after human	2e-11
cd04604		114	cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two	2e-11
cd04612		111	cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains	2e-11
cd04583		109	cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains tw	3e-11
cd04595		110	cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd contains	3e-11
cd04637		122	cd04637, CBS_pair_24, The CBS domain, named after human	7e-11
cd04634		143	cd04634, CBS_pair_21, The CBS domain, named after human	4e-10
cd04633		121	cd04633, CBS_pair_20, The CBS domain, named after human	1e-09
cd04590		111	cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two	1e-09
cd04607		113	cd04607, CBS_pair_NTP_transferase_assoc, This cd contai	2e-09
cd04642		126	cd04642, CBS_pair_29, The CBS domain, named after human	3e-09
cd04630		114	cd04630, CBS_pair_17, The CBS domain, named after human	4e-09
cd04600		124	cd04600, CBS_pair_HPP_assoc, This cd contains two tande	4e-09
cd04606		109	cd04606, CBS_pair_Mg_transporter, This cd contains two	4e-09
cd04629		114	cd04629, CBS_pair_16, The CBS domain, named after human	4e-09
cd04596		108	cd04596, CBS_pair_DRTGG_assoc, This cd contains two tan	4e-09
cd04586		135	cd04586, CBS_pair_BON_assoc, This cd contains two tande	6e-09
cd04610		107	cd04610, CBS_pair_ParBc_assoc, This cd contains two tan	7e-09
cd04609		110	cd04609, CBS_pair_PALP_assoc2, This cd contains two tan	8e-09
cd04587		113	cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd cont	8e-09
cd04615		113	cd04615, CBS_pair_2, The CBS domain, named after human	2e-08
cd04802		112	cd04802, CBS_pair_3, The CBS domain, named after human	3e-08
cd04632		128	cd04632, CBS_pair_19, The CBS domain, named after human	6e-08
cd04582		106	cd04582, CBS_pair_ABC_OpuCA_assoc, This cd contains two	2e-07
cd04636		132	cd04636, CBS_pair_23, The CBS domain, named after human	3e-07
KOG1764		381	KOG1764, KOG1764, KOG1764, 5'-AMP-activated protein kin	8e-07
COG1253		429	COG1253, TlyC, Hemolysins and related proteins containi	1e-06
cd04801		114	cd04801, CBS_pair_M50_like, This cd contains two tandem	1e-06
cd04635		122	cd04635, CBS_pair_22, The CBS domain, named after human	2e-06
COG3620		187	COG3620, COG3620, Predicted transcriptional regulator w	2e-06
cd04627		123	cd04627, CBS_pair_14, The CBS domain, named after human	2e-06
cd04643		116	cd04643, CBS_pair_30, The CBS domain, named after human	7e-06
COG4109		432	COG4109, COG4109, Predicted transcriptional regulator c	8e-06
COG3448		382	COG3448, COG3448, CBS-domain-containing membrane protei	9e-06
cd04613		114	cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains	1e-05
cd04639		111	cd04639, CBS_pair_26, The CBS domain, named after human	1e-05
cd04621		135	cd04621, CBS_pair_8, The CBS domain, named after human	1e-05
cd04589		111	cd04589, CBS_pair_CAP-ED_DUF294_assoc_bac, This cd cont	2e-05
cd04626		111	cd04626, CBS_pair_13, The CBS domain, named after human	2e-05
TIGR01186		363	TIGR01186, proV, glycine betaine/L-proline transport AT	2e-05
TIGR01137		454	TIGR01137, cysta_beta, cystathionine beta-synthase	2e-05
cd04641		120	cd04641, CBS_pair_28, The CBS domain, named after human	3e-05
cd04594		104	cd04594, CBS_pair_EriC_assoc_archaea, This cd contains	4e-05
KOG1764		381	KOG1764, KOG1764, KOG1764, 5'-AMP-activated protein kin	2e-04
PRK11543		321	PRK11543, gutQ, D-arabinose 5-phosphate isomerase; Prov	2e-04
cd04598		119	cd04598, CBS_pair_GGDEF_assoc, This cd contains two tan	5e-04
cd04614		96	cd04614, CBS_pair_1, The CBS domain, named after human	0.001
cd00381		325	cd00381, IMPDH, IMPDH: The catalytic domain of the inos	9e-26
PRK06843		404	PRK06843, PRK06843, inosine 5-monophosphate dehydrogena	6e-19
COG0516		170	COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nucleot	8e-19
PRK08649		368	PRK08649, PRK08649, inosine 5-monophosphate dehydrogena	5e-07
COG2070		336	COG2070, COG2070, Dioxygenases related to 2-nitropropan	9e-05
TIGR01304		369	TIGR01304, IMP_DH_rel_2, IMP dehydrogenase family prote	4e-04
PRK05096		346	PRK05096, PRK05096, guanosine 5'-monophosphate oxidored	0.002
TIGR01305		343	TIGR01305, GMP_reduct_1, guanosine monophosphate reduct	0.002
TIGR01304		369	TIGR01304, IMP_DH_rel_2, IMP dehydrogenase family prote	1e-19
COG2905		610	COG2905, COG2905, Predicted signal-transduction protein	4e-14
COG2239		451	COG2239, MgtE, Mg/Co/Ni transporter MgtE (contains CBS	3e-09
cd02809		299	cd02809, alpha_hydroxyacid_oxid_FMN, Family of homologo	3e-08
cd04737		351	cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-bind	3e-04
cd04722		200	cd04722, TIM_phosphate_binding, TIM barrel proteins sha	3e-04
cd02808		392	cd02808, GltS_FMN, Glutamate synthase (GltS) FMN-bindin	3e-04
COG2070		336	COG2070, COG2070, Dioxygenases related to 2-nitropropan	5e-04
PRK01130		221	PRK01130, PRK01130, N-acetylmannosamine-6-phosphate 2-e	5e-04
cd04729		219	cd04729, NanE, N-acetylmannosamine-6-phosphate epimeras	7e-04
cd04736		361	cd04736, MDH_FMN, Mandelate dehydrogenase (MDH)-like FM	0.004
pfam00571		57	pfam00571, CBS, CBS domain	1e-07
PRK14869		546	PRK14869, PRK14869, putative manganese-dependent inorga	2e-06
cd04597		113	cd04597, CBS_pair_DRTGG_assoc2, This cd contains two ta	4e-05
cd04584		121	cd04584, CBS_pair_ACT_assoc, This cd contains two tande	7e-05
cd04803		122	cd04803, CBS_pair_15, The CBS domain, named after human	2e-04
cd04592		133	cd04592, CBS_pair_EriC_assoc_euk, This cd contains two	0.001
smart00116		49	smart00116, CBS, Domain in cystathionine beta-synthase	0.002
cd04637		122	cd04637, CBS_pair_24, The CBS domain, named after human	3e-07
pfam00571		57	pfam00571, CBS, CBS domain	5e-07
cd04585		122	cd04585, CBS_pair_ACT_assoc2, This cd contains two tand	6e-07
cd04584		121	cd04584, CBS_pair_ACT_assoc, This cd contains two tande	2e-06
cd04631		125	cd04631, CBS_pair_18, The CBS domain, named after human	2e-06
smart00116		49	smart00116, CBS, Domain in cystathionine beta-synthase	4e-06
PRK14869		546	PRK14869, PRK14869, putative manganese-dependent inorga	9e-06
cd04800		111	cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd con	2e-05
cd04633		121	cd04633, CBS_pair_20, The CBS domain, named after human	2e-05
cd04613		114	cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains	2e-05
cd04604		114	cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two	4e-05
cd02205		113	cd02205, CBS_pair, The CBS domain, named after human CB	1e-04
cd04621		135	cd04621, CBS_pair_8, The CBS domain, named after human	1e-04
cd04612		111	cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains	3e-04
cd04802		112	cd04802, CBS_pair_3, The CBS domain, named after human	3e-04
cd04634		143	cd04634, CBS_pair_21, The CBS domain, named after human	4e-04
cd04586		135	cd04586, CBS_pair_BON_assoc, This cd contains two tande	4e-04
cd04638		106	cd04638, CBS_pair_25, The CBS domain, named after human	6e-04
cd04606		109	cd04606, CBS_pair_Mg_transporter, This cd contains two	8e-04
cd04636		132	cd04636, CBS_pair_23, The CBS domain, named after human	8e-04
cd04623		113	cd04623, CBS_pair_10, The CBS domain, named after human	0.001
cd04597		113	cd04597, CBS_pair_DRTGG_assoc2, This cd contains two ta	0.001
cd04583		109	cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains tw	0.002
cd04622		113	cd04622, CBS_pair_9, The CBS domain, named after human	0.003
cd04607		113	cd04607, CBS_pair_NTP_transferase_assoc, This cd contai	0.003
cd04605		110	cd04605, CBS_pair_MET2_assoc, This cd contains two tand	0.004
pfam01070		301	pfam01070, FMN_dh, FMN-dependent dehydrogenase	4e-07
cd04730		236	cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), on	2e-05
COG0069		485	COG0069, GltB, Glutamate synthase domain 2 [Amino acid	3e-04
pfam03060		330	pfam03060, NPD, 2-nitropropane dioxygenase	4e-04
COG1304		360	COG1304, LldD, L-lactate dehydrogenase (FMN-dependent)	5e-04
pfam01645		367	pfam01645, Glu_synthase, Conserved region in glutamate	0.002
TIGR00393		268	TIGR00393, kpsF, KpsF/GutQ family protein	2e-06
cd04600		124	cd04600, CBS_pair_HPP_assoc, This cd contains two tande	9e-06
COG3448		382	COG3448, COG3448, CBS-domain-containing membrane protei	6e-04
cd04585		122	cd04585, CBS_pair_ACT_assoc2, This cd contains two tand	0.003
TIGR03151		307	TIGR03151, enACPred_II, putative enoyl-(acyl-carrier-pr	3e-04
cd04730		236	cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), on	4e-04
cd04599		105	cd04599, CBS_pair_GGDEF_assoc2, This cd contains two ta	0.002
TIGR00400		449	TIGR00400, mgtE, Mg2+ transporter (mgtE)	0.004

>gnl\|CDD\|180134 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed	Back alignment and domain information

>gnl\|CDD\|185550 PTZ00314, PTZ00314, inosine-5'-monophosphate dehydrogenase; Provisional	Back alignment and domain information

>gnl\|CDD\|37761 KOG2550, KOG2550, KOG2550, IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|177913 PLN02274, PLN02274, inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|181127 PRK07807, PRK07807, inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|180842 PRK07107, PRK07107, inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|130370 TIGR01303, IMP_DH_rel_1, IMP dehydrogenase family protein	Back alignment and domain information

>gnl\|CDD\|144171 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain	Back alignment and domain information

>gnl\|CDD\|162293 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|73364 cd00381, IMPDH, IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|180725 PRK06843, PRK06843, inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|130372 TIGR01305, GMP_reduct_1, guanosine monophosphate reductase, eukaryotic	Back alignment and domain information

>gnl\|CDD\|180097 PRK05458, PRK05458, guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>gnl\|CDD\|130373 TIGR01306, GMP_reduct_2, guanosine monophosphate reductase, bacterial	Back alignment and domain information

>gnl\|CDD\|181521 PRK08649, PRK08649, inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|179935 PRK05096, PRK05096, guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>gnl\|CDD\|30862 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|73101 cd04601, CBS_pair_IMPDH, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>gnl\|CDD\|73102 cd04602, CBS_pair_IMPDH_2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein	Back alignment and domain information

>gnl\|CDD\|73099 cd04599, CBS_pair_GGDEF_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>gnl\|CDD\|73085 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>gnl\|CDD\|73084 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>gnl\|CDD\|73111 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream	Back alignment and domain information

>gnl\|CDD\|73081 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|30863 COG0517, COG0517, FOG: CBS domain [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|73121 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73129 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73142 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>gnl\|CDD\|73122 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73088 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain	Back alignment and domain information

>gnl\|CDD\|73145 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73136 cd04638, CBS_pair_25, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|32593 COG2524, COG2524, Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription]	Back alignment and domain information

>gnl\|CDD\|73105 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain	Back alignment and domain information

>gnl\|CDD\|73119 cd04620, CBS_pair_7, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73123 cd04624, CBS_pair_11, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73104 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein	Back alignment and domain information

>gnl\|CDD\|73112 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>gnl\|CDD\|73083 cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA	Back alignment and domain information

>gnl\|CDD\|73095 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain	Back alignment and domain information

>gnl\|CDD\|73135 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73132 cd04634, CBS_pair_21, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73131 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73090 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain	Back alignment and domain information

>gnl\|CDD\|73107 cd04607, CBS_pair_NTP_transferase_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream	Back alignment and domain information

>gnl\|CDD\|73140 cd04642, CBS_pair_29, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73128 cd04630, CBS_pair_17, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73100 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain	Back alignment and domain information

>gnl\|CDD\|73106 cd04606, CBS_pair_Mg_transporter, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE	Back alignment and domain information

>gnl\|CDD\|73127 cd04629, CBS_pair_16, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73096 cd04596, CBS_pair_DRTGG_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream	Back alignment and domain information

>gnl\|CDD\|73086 cd04586, CBS_pair_BON_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain	Back alignment and domain information

>gnl\|CDD\|73110 cd04610, CBS_pair_ParBc_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream	Back alignment and domain information

>gnl\|CDD\|73109 cd04609, CBS_pair_PALP_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream	Back alignment and domain information

>gnl\|CDD\|73087 cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>gnl\|CDD\|73115 cd04615, CBS_pair_2, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73144 cd04802, CBS_pair_3, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73130 cd04632, CBS_pair_19, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73082 cd04582, CBS_pair_ABC_OpuCA_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA	Back alignment and domain information

>gnl\|CDD\|73134 cd04636, CBS_pair_23, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|36975 KOG1764, KOG1764, KOG1764, 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|31445 COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|73143 cd04801, CBS_pair_M50_like, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50	Back alignment and domain information

>gnl\|CDD\|73133 cd04635, CBS_pair_22, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|33419 COG3620, COG3620, Predicted transcriptional regulator with C-terminal CBS domains [Transcription]	Back alignment and domain information

>gnl\|CDD\|73126 cd04627, CBS_pair_14, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73141 cd04643, CBS_pair_30, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|33866 COG4109, COG4109, Predicted transcriptional regulator containing CBS domains [Transcription]	Back alignment and domain information

>gnl\|CDD\|33251 COG3448, COG3448, CBS-domain-containing membrane protein [Signal transduction mechanisms]	Back alignment and domain information

>gnl\|CDD\|73113 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>gnl\|CDD\|73137 cd04639, CBS_pair_26, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73120 cd04621, CBS_pair_8, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73089 cd04589, CBS_pair_CAP-ED_DUF294_assoc_bac, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain	Back alignment and domain information

>gnl\|CDD\|73125 cd04626, CBS_pair_13, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit	Back alignment and domain information

>gnl\|CDD\|162220 TIGR01137, cysta_beta, cystathionine beta-synthase	Back alignment and domain information

>gnl\|CDD\|73139 cd04641, CBS_pair_28, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73094 cd04594, CBS_pair_EriC_assoc_archaea, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea	Back alignment and domain information

>gnl\|CDD\|36975 KOG1764, KOG1764, KOG1764, 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|183186 PRK11543, gutQ, D-arabinose 5-phosphate isomerase; Provisional	Back alignment and domain information

>gnl\|CDD\|73098 cd04598, CBS_pair_GGDEF_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>gnl\|CDD\|73114 cd04614, CBS_pair_1, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73364 cd00381, IMPDH, IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase	Back alignment and domain information

>gnl\|CDD\|180725 PRK06843, PRK06843, inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|30862 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|181521 PRK08649, PRK08649, inosine 5-monophosphate dehydrogenase; Validated	Back alignment and domain information

>gnl\|CDD\|32253 COG2070, COG2070, Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|162294 TIGR01304, IMP_DH_rel_2, IMP dehydrogenase family protein	Back alignment and domain information

>gnl\|CDD\|179935 PRK05096, PRK05096, guanosine 5'-monophosphate oxidoreductase; Provisional	Back alignment and domain information

>gnl\|CDD\|130372 TIGR01305, GMP_reduct_1, guanosine monophosphate reductase, eukaryotic	Back alignment and domain information

>gnl\|CDD\|162294 TIGR01304, IMP_DH_rel_2, IMP dehydrogenase family protein	Back alignment and domain information

>gnl\|CDD\|32729 COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms]	Back alignment and domain information

>gnl\|CDD\|32420 COG2239, MgtE, Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|73371 cd02809, alpha_hydroxyacid_oxid_FMN, Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes	Back alignment and domain information

>gnl\|CDD\|73399 cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain	Back alignment and domain information

>gnl\|CDD\|73384 cd04722, TIM_phosphate_binding, TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure	Back alignment and domain information

>gnl\|CDD\|73370 cd02808, GltS_FMN, Glutamate synthase (GltS) FMN-binding domain	Back alignment and domain information

>gnl\|CDD\|32253 COG2070, COG2070, Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|179231 PRK01130, PRK01130, N-acetylmannosamine-6-phosphate 2-epimerase; Provisional	Back alignment and domain information

>gnl\|CDD\|73391 cd04729, NanE, N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate	Back alignment and domain information

>gnl\|CDD\|73398 cd04736, MDH_FMN, Mandelate dehydrogenase (MDH)-like FMN-binding domain	Back alignment and domain information

>gnl\|CDD\|144238 pfam00571, CBS, CBS domain	Back alignment and domain information

>gnl\|CDD\|184871 PRK14869, PRK14869, putative manganese-dependent inorganic pyrophosphatase; Provisional	Back alignment and domain information

>gnl\|CDD\|73097 cd04597, CBS_pair_DRTGG_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream	Back alignment and domain information

>gnl\|CDD\|73084 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>gnl\|CDD\|73145 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73092 cd04592, CBS_pair_EriC_assoc_euk, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes	Back alignment and domain information

>gnl\|CDD\|128426 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins	Back alignment and domain information

>gnl\|CDD\|73135 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|144238 pfam00571, CBS, CBS domain	Back alignment and domain information

>gnl\|CDD\|73085 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>gnl\|CDD\|73084 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>gnl\|CDD\|73129 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|128426 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins	Back alignment and domain information

>gnl\|CDD\|184871 PRK14869, PRK14869, putative manganese-dependent inorganic pyrophosphatase; Provisional	Back alignment and domain information

>gnl\|CDD\|73142 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain	Back alignment and domain information

>gnl\|CDD\|73131 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73113 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>gnl\|CDD\|73104 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein	Back alignment and domain information

>gnl\|CDD\|73081 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73120 cd04621, CBS_pair_8, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73112 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC	Back alignment and domain information

>gnl\|CDD\|73144 cd04802, CBS_pair_3, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73132 cd04634, CBS_pair_21, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73086 cd04586, CBS_pair_BON_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain	Back alignment and domain information

>gnl\|CDD\|73136 cd04638, CBS_pair_25, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73106 cd04606, CBS_pair_Mg_transporter, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE	Back alignment and domain information

>gnl\|CDD\|73134 cd04636, CBS_pair_23, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73122 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73097 cd04597, CBS_pair_DRTGG_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream	Back alignment and domain information

>gnl\|CDD\|73083 cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA	Back alignment and domain information

>gnl\|CDD\|73121 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins	Back alignment and domain information

>gnl\|CDD\|73107 cd04607, CBS_pair_NTP_transferase_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream	Back alignment and domain information

>gnl\|CDD\|73105 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain	Back alignment and domain information

>gnl\|CDD\|144604 pfam01070, FMN_dh, FMN-dependent dehydrogenase	Back alignment and domain information

>gnl\|CDD\|73392 cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites	Back alignment and domain information

>gnl\|CDD\|30418 COG0069, GltB, Glutamate synthase domain 2 [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|145943 pfam03060, NPD, 2-nitropropane dioxygenase	Back alignment and domain information

>gnl\|CDD\|31495 COG1304, LldD, L-lactate dehydrogenase (FMN-dependent) and related alpha-hydroxy acid dehydrogenases [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|110632 pfam01645, Glu_synthase, Conserved region in glutamate synthase	Back alignment and domain information

>gnl\|CDD\|129488 TIGR00393, kpsF, KpsF/GutQ family protein	Back alignment and domain information

>gnl\|CDD\|73100 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain	Back alignment and domain information

>gnl\|CDD\|33251 COG3448, COG3448, CBS-domain-containing membrane protein [Signal transduction mechanisms]	Back alignment and domain information

>gnl\|CDD\|73085 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria	Back alignment and domain information

>gnl\|CDD\|132195 TIGR03151, enACPred_II, putative enoyl-(acyl-carrier-protein) reductase II	Back alignment and domain information

>gnl\|CDD\|73392 cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites	Back alignment and domain information

>gnl\|CDD\|73099 cd04599, CBS_pair_GGDEF_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain	Back alignment and domain information

>gnl\|CDD\|129495 TIGR00400, mgtE, Mg2+ transporter (mgtE)	Back alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

Identity	Alignment graph	Length	Definition	Probability
Target		493	inosine 5'-monophosphate dehydrogenase [Candidatus Libe
TIGR01302		476	IMP_dehydrog inosine-5'-monophosphate dehydrogenase; In	100.0
PTZ00314		499	inosine-5'-monophosphate dehydrogenase; Provisional	100.0
PRK07807		479	inositol-5-monophosphate dehydrogenase; Validated	100.0
pfam00478		467	IMPDH IMP dehydrogenase / GMP reductase domain. This fa	100.0
KOG2550		503	consensus	100.0
PRK06843		404	inositol-5-monophosphate dehydrogenase; Validated	100.0
cd00381		325	IMPDH IMPDH: The catalytic domain of the inosine monoph	100.0
PRK05096		347	guanosine 5'-monophosphate oxidoreductase; Provisional	100.0
PRK08649		368	inositol-5-monophosphate dehydrogenase; Validated	100.0
PRK05458		326	guanosine 5'-monophosphate oxidoreductase; Provisional	100.0
TIGR01303		476	IMP_DH_rel_1 IMP dehydrogenase family protein; InterPro	100.0
TIGR01305		343	GMP_reduct_1 guanosine monophosphate reductase; InterPr	100.0
TIGR01304		376	IMP_DH_rel_2 IMP dehydrogenase family protein; InterPro	100.0
TIGR01306		321	GMP_reduct_2 guanosine monophosphate reductase; InterPr	100.0
cd02922		344	FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain.	99.65
cd04737		351	LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain	99.63
cd04736		361	MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding	99.63
PRK11197		381	lldD L-lactate dehydrogenase; Provisional	99.59
TIGR02151		349	IPP_isom_2 isopentenyl-diphosphate delta-isomerase, typ	99.57
cd03332		383	LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding dom	99.56
KOG0538		363	consensus	99.12
TIGR01303		476	IMP_DH_rel_1 IMP dehydrogenase family protein; InterPro	96.7
PRK05567		486	inositol-5'-monophosphate dehydrogenase; Reviewed	100.0
PRK07107		497	inositol-5-monophosphate dehydrogenase; Validated	100.0
COG0516		170	GuaB IMP dehydrogenase/GMP reductase [Nucleotide transp	99.97
cd04602		114	CBS_pair_IMPDH_2 This cd contains two tandem repeats of	99.9
cd04596		108	CBS_pair_DRTGG_assoc This cd contains two tandem repeat	99.87
cd04594		104	CBS_pair_EriC_assoc_archaea This cd contains two tandem	99.86
cd04635		122	CBS_pair_22 The CBS domain, named after human CBS, is a	99.86
cd04610		107	CBS_pair_ParBc_assoc This cd contains two tandem repeat	99.86
cd04601		110	CBS_pair_IMPDH This cd contains two tandem repeats of t	99.86
cd04617		118	CBS_pair_4 The CBS domain, named after human CBS, is a	99.85
cd04620		115	CBS_pair_7 The CBS domain, named after human CBS, is a	99.85
cd04632		128	CBS_pair_19 The CBS domain, named after human CBS, is a	99.85
cd04583		109	CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem r	99.85
cd04638		106	CBS_pair_25 The CBS domain, named after human CBS, is a	99.85
cd04619		114	CBS_pair_6 The CBS domain, named after human CBS, is a	99.84
cd04599		105	CBS_pair_GGDEF_assoc2 This cd contains two tandem repea	99.84
cd04629		114	CBS_pair_16 The CBS domain, named after human CBS, is a	99.84
cd04631		125	CBS_pair_18 The CBS domain, named after human CBS, is a	99.84
cd04621		135	CBS_pair_8 The CBS domain, named after human CBS, is a	99.84
cd04600		124	CBS_pair_HPP_assoc This cd contains two tandem repeats	99.84
cd04587		113	CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two t	99.83
cd04615		113	CBS_pair_2 The CBS domain, named after human CBS, is a	99.83
cd04605		110	CBS_pair_MET2_assoc This cd contains two tandem repeats	99.83
cd04584		121	CBS_pair_ACT_assoc This cd contains two tandem repeats	99.83
cd04637		122	CBS_pair_24 The CBS domain, named after human CBS, is a	99.83
cd04636		132	CBS_pair_23 The CBS domain, named after human CBS, is a	99.83
cd04582		106	CBS_pair_ABC_OpuCA_assoc This cd contains two tandem re	99.83
cd04588		110	CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two	99.83
cd04585		122	CBS_pair_ACT_assoc2 This cd contains two tandem repeats	99.83
cd04624		112	CBS_pair_11 The CBS domain, named after human CBS, is a	99.82
cd04622		113	CBS_pair_9 The CBS domain, named after human CBS, is a	99.82
cd04586		135	CBS_pair_BON_assoc This cd contains two tandem repeats	99.82
cd04593		115	CBS_pair_EriC_assoc_bac_arch This cd contains two tande	99.82
cd04612		111	CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem	99.81
cd04643		116	CBS_pair_30 The CBS domain, named after human CBS, is a	99.81
cd04639		111	CBS_pair_26 The CBS domain, named after human CBS, is a	99.81
cd04613		114	CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tande	99.81
cd04625		112	CBS_pair_12 The CBS domain, named after human CBS, is a	99.81
cd04623		113	CBS_pair_10 The CBS domain, named after human CBS, is a	99.81
cd04626		111	CBS_pair_13 The CBS domain, named after human CBS, is a	99.81
cd04642		126	CBS_pair_29 The CBS domain, named after human CBS, is a	99.81
cd04607		113	CBS_pair_NTP_transferase_assoc This cd contains two tan	99.81
cd04634		143	CBS_pair_21 The CBS domain, named after human CBS, is a	99.81
cd04803		122	CBS_pair_15 The CBS domain, named after human CBS, is a	99.81
cd04611		111	CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tand	99.8
cd04630		114	CBS_pair_17 The CBS domain, named after human CBS, is a	99.8
cd04595		110	CBS_pair_DHH_polyA_Pol_assoc This cd contains two tande	99.8
cd04641		120	CBS_pair_28 The CBS domain, named after human CBS, is a	99.8
cd04614		96	CBS_pair_1 The CBS domain, named after human CBS, is a	99.8
cd04633		121	CBS_pair_20 The CBS domain, named after human CBS, is a	99.79
cd04604		114	CBS_pair_KpsF_GutQ_assoc This cd contains two tandem re	99.79
cd04802		112	CBS_pair_3 The CBS domain, named after human CBS, is a	99.79
cd04800		111	CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two	99.78
cd04589		111	CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two t	99.76
cd04801		114	CBS_pair_M50_like This cd contains two tandem repeats o	99.76
cd04627		123	CBS_pair_14 The CBS domain, named after human CBS, is a	99.75
cd04603		111	CBS_pair_KefB_assoc This cd contains two tandem repeats	99.75
COG2524		294	Predicted transcriptional regulator, contains C-termina	99.74
cd04609		110	CBS_pair_PALP_assoc2 This cd contains two tandem repeat	99.74
cd04640		126	CBS_pair_27 The CBS domain, named after human CBS, is a	99.73
cd04606		109	CBS_pair_Mg_transporter This cd contains two tandem rep	99.69
cd04598		119	CBS_pair_GGDEF_assoc This cd contains two tandem repeat	99.67
cd04590		111	CBS_pair_CorC_HlyC_assoc This cd contains two tandem re	99.61
cd04591		105	CBS_pair_EriC_assoc_euk_bac This cd contains two tandem	99.6
cd04608		124	CBS_pair_PALP_assoc This cd contains two tandem repeats	99.59
PRK01862		583	putative voltage-gated ClC-type chloride channel ClcB;	99.58
cd02205		113	CBS_pair The CBS domain, named after human CBS, is a sm	99.5
cd04592		133	CBS_pair_EriC_assoc_euk This cd contains two tandem rep	99.38
COG3620		187	Predicted transcriptional regulator with C-terminal CBS	99.34
COG0517		117	FOG: CBS domain [General function prediction only]	99.33
TIGR00393		272	kpsF sugar isomerase, KpsF/GutQ family; InterPro: IPR00	99.22
PRK10070		400	glycine betaine transporter ATP-binding subunit; Provis	99.22
COG1253		429	TlyC Hemolysins and related proteins containing CBS dom	99.18
KOG1764		381	consensus	99.01
TIGR01137		527	cysta_beta cystathionine beta-synthase; InterPro: IPR00	98.69
cd04618		98	CBS_pair_5 The CBS domain, named after human CBS, is a	98.56
COG4535		293	CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic	98.46
KOG1764		381	consensus	98.45
COG4536		423	CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic	98.43
PRK10070		400	glycine betaine transporter ATP-binding subunit; Provis	97.53
TIGR00400		460	mgtE magnesium transporter; InterPro: IPR006669 This is	96.67
cd04730		236	NPD_like 2-Nitropropane dioxygenase (NPD), one of the n	99.87
pfam03060		330	NPD 2-nitropropane dioxygenase. Members of this family	99.81
TIGR03151		307	enACPred_II putative enoyl-(acyl-carrier-protein) reduc	99.75
COG2070		336	Dioxygenases related to 2-nitropropane dioxygenase [Gen	99.35
pfam04551		345	GcpE GcpE protein. In a variety of organisms, including	96.51
PRK05437		351	isopentenyl pyrophosphate isomerase; Provisional	99.79
cd02811		326	IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosp	99.73
COG1304		360	idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 a	99.48
COG0516		170	GuaB IMP dehydrogenase/GMP reductase [Nucleotide transp	99.42
cd02808		392	GltS_FMN Glutamate synthase (GltS) FMN-binding domain.	98.79
TIGR02708		368	L_lactate_ox L-lactate oxidase; InterPro: IPR014080 Mem	98.67
COG0069		485	GltB Glutamate synthase domain 2 [Amino acid transport	98.66
pfam01070		301	FMN_dh FMN-dependent dehydrogenase.	99.75
cd02809		299	alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dep	99.7
PRK08318		413	dihydropyrimidine dehydrogenase; Validated	99.24
PRK07565		333	dihydroorotate dehydrogenase 2; Reviewed	99.23
cd04739		325	DHOD_like Dihydroorotate dehydrogenase (DHOD) like prot	99.23
cd04740		296	DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class	98.72
PRK07259		301	dihydroorotate dehydrogenase 1B; Reviewed	98.69
pfam01645		367	Glu_synthase Conserved region in glutamate synthase. Th	98.59
PRK02506		308	dihydroorotate dehydrogenase 1A; Reviewed	98.12
COG0167		310	PyrD Dihydroorotate dehydrogenase [Nucleotide transport	98.06
COG4109		432	Predicted transcriptional regulator containing CBS doma	99.73
PRK11543		321	gutQ D-arabinose 5-phosphate isomerase; Provisional	99.65
COG3448		382	CBS-domain-containing membrane protein [Signal transduc	99.59
PRK10892		326	D-arabinose 5-phosphate isomerase; Provisional	99.58
TIGR03520		408	GldE gliding motility-associated protein GldE. Members	99.43
PRK11573		413	hypothetical protein; Provisional	99.24
TIGR01186		372	proV glycine betaine/L-proline transport ATP binding su	99.23
KOG0475		696	consensus	98.7
KOG0474		762	consensus	98.51
KOG2118		498	consensus	96.26
TIGR01137		527	cysta_beta cystathionine beta-synthase; InterPro: IPR00	96.24
COG2905		610	Predicted signal-transduction protein containing cAMP-b	99.69
TIGR01186		372	proV glycine betaine/L-proline transport ATP binding su	95.94
COG2239		451	MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [I	99.28
pfam00478		467	IMPDH IMP dehydrogenase / GMP reductase domain. This fa	98.76
COG2513		289	PrpB PEP phosphonomutase and related enzymes [Carbohydr	93.84
cd04597		113	CBS_pair_DRTGG_assoc2 This cd contains two tandem repea	98.95
PTZ00314		499	inosine-5'-monophosphate dehydrogenase; Provisional	98.92
cd04641		120	CBS_pair_28 The CBS domain, named after human CBS, is a	98.66
cd04635		122	CBS_pair_22 The CBS domain, named after human CBS, is a	98.6
cd04621		135	CBS_pair_8 The CBS domain, named after human CBS, is a	98.59
cd04643		116	CBS_pair_30 The CBS domain, named after human CBS, is a	98.59
cd04632		128	CBS_pair_19 The CBS domain, named after human CBS, is a	98.56
smart00116		49	CBS Domain in cystathionine beta-synthase and other pro	98.56
cd04613		114	CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tande	98.55
cd04605		110	CBS_pair_MET2_assoc This cd contains two tandem repeats	98.54
cd04584		121	CBS_pair_ACT_assoc This cd contains two tandem repeats	98.53
cd04600		124	CBS_pair_HPP_assoc This cd contains two tandem repeats	98.53
cd04582		106	CBS_pair_ABC_OpuCA_assoc This cd contains two tandem re	98.52
cd04640		126	CBS_pair_27 The CBS domain, named after human CBS, is a	98.51
cd04614		96	CBS_pair_1 The CBS domain, named after human CBS, is a	98.5
cd04629		114	CBS_pair_16 The CBS domain, named after human CBS, is a	98.49
cd04615		113	CBS_pair_2 The CBS domain, named after human CBS, is a	98.49
cd04586		135	CBS_pair_BON_assoc This cd contains two tandem repeats	98.48
cd04624		112	CBS_pair_11 The CBS domain, named after human CBS, is a	98.48
cd04638		106	CBS_pair_25 The CBS domain, named after human CBS, is a	98.47
cd04803		122	CBS_pair_15 The CBS domain, named after human CBS, is a	98.47
cd04636		132	CBS_pair_23 The CBS domain, named after human CBS, is a	98.46
cd04617		118	CBS_pair_4 The CBS domain, named after human CBS, is a	98.46
cd04642		126	CBS_pair_29 The CBS domain, named after human CBS, is a	98.45
cd04583		109	CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem r	98.45
cd04593		115	CBS_pair_EriC_assoc_bac_arch This cd contains two tande	98.44
cd04608		124	CBS_pair_PALP_assoc This cd contains two tandem repeats	98.41
cd04602		114	CBS_pair_IMPDH_2 This cd contains two tandem repeats of	98.4
cd04631		125	CBS_pair_18 The CBS domain, named after human CBS, is a	98.39
cd04639		111	CBS_pair_26 The CBS domain, named after human CBS, is a	98.39
cd04633		121	CBS_pair_20 The CBS domain, named after human CBS, is a	98.36
cd04585		122	CBS_pair_ACT_assoc2 This cd contains two tandem repeats	98.35
cd04610		107	CBS_pair_ParBc_assoc This cd contains two tandem repeat	98.34
cd04588		110	CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two	98.32
cd04634		143	CBS_pair_21 The CBS domain, named after human CBS, is a	98.31
cd04623		113	CBS_pair_10 The CBS domain, named after human CBS, is a	98.29
cd04612		111	CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem	98.29
cd04607		113	CBS_pair_NTP_transferase_assoc This cd contains two tan	98.26
cd04609		110	CBS_pair_PALP_assoc2 This cd contains two tandem repeat	98.25
cd04595		110	CBS_pair_DHH_polyA_Pol_assoc This cd contains two tande	98.24
cd04601		110	CBS_pair_IMPDH This cd contains two tandem repeats of t	98.23
cd04620		115	CBS_pair_7 The CBS domain, named after human CBS, is a	98.23
cd04596		108	CBS_pair_DRTGG_assoc This cd contains two tandem repeat	98.22
cd04592		133	CBS_pair_EriC_assoc_euk This cd contains two tandem rep	98.2
pfam00571		57	CBS CBS domain. CBS domains are small intracellular mod	98.2
cd04603		111	CBS_pair_KefB_assoc This cd contains two tandem repeats	98.15
cd04801		114	CBS_pair_M50_like This cd contains two tandem repeats o	98.12
cd04800		111	CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two	98.03
PRK01862		583	putative voltage-gated ClC-type chloride channel ClcB;	98.0
cd04598		119	CBS_pair_GGDEF_assoc This cd contains two tandem repeat	97.85
cd04590		111	CBS_pair_CorC_HlyC_assoc This cd contains two tandem re	97.85
cd02205		113	CBS_pair The CBS domain, named after human CBS, is a sm	97.6
COG2905		610	Predicted signal-transduction protein containing cAMP-b	97.5
COG3620		187	Predicted transcriptional regulator with C-terminal CBS	97.36
COG1253		429	TlyC Hemolysins and related proteins containing CBS dom	97.16
COG0517		117	FOG: CBS domain [General function prediction only]	97.01
TIGR03520		408	GldE gliding motility-associated protein GldE. Members	96.96
COG2239		451	MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [I	96.86
PRK11573		413	hypothetical protein; Provisional	96.55
KOG0474		762	consensus	94.7
PRK05567		486	inositol-5'-monophosphate dehydrogenase; Reviewed	98.93
TIGR01302		476	IMP_dehydrog inosine-5'-monophosphate dehydrogenase; In	98.81
TIGR01108		616	oadA oxaloacetate decarboxylase alpha subunit; InterPro	94.11
PRK13122		242	consensus	93.92
cd04729		219	NanE N-acetylmannosamine-6-phosphate epimerase (NanE) c	98.92
PRK01130		222	N-acetylmannosamine-6-phosphate 2-epimerase; Provisiona	98.84
pfam04131		192	NanE Putative N-acetylmannosamine-6-phosphate epimerase	98.82
cd04722		200	TIM_phosphate_binding TIM barrel proteins share a struc	98.69
pfam01180		290	DHO_dh Dihydroorotate dehydrogenase.	98.62
PRK07455		210	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon	98.36
PRK05718		212	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon	98.34
cd02810		289	DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and D	98.33
PRK08104		212	consensus	98.33
PRK06015		212	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon	98.32
cd04734		343	OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN bind	98.3
PRK08782		219	consensus	98.24
PRK06552		209	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon	98.23
cd02930		353	DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding dom	98.2
PRK08904		207	consensus	98.19
cd00452		190	KDPG_aldolase KDPG and KHG aldolase. This family belong	98.19
pfam01081		196	Aldolase KDPG and KHG aldolase. This family includes th	98.11
COG3010		229	NanE Putative N-acetylmannosamine-6-phosphate epimerase	98.11
TIGR01182		205	eda 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydrox	98.11
cd02931		382	ER_like_FMN Enoate reductase (ER)-like FMN-binding doma	98.1
PRK09140		206	2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Review	98.09
cd04735		353	OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN bind	98.05
PRK07114		223	keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon	98.03
cd02932		336	OYE_YqiM_FMN Old yellow enzyme (OYE

Protein GIs
peg_789	254780871
254780872	254780873
254780874	254780875
254780876	254780877
254780878	254780879
254780880	254780881
254780882	254780883
255764506	254780885
254780886	254780887
254780888	peg_804
254780889	254780890
254780891	254780892
254780893	254780894
254780895	254780896
peg_813	254780897
254780898	peg_816
peg_817	peg_818
254780899	254780900
254780901	254780902
254780903	254780904
254780905	254780906
254780907	254780908
254780909	255764507
254780911	254780912
254780913	254780914
peg_834	254780915
254780916	254780917
254780918	254780919
254780920	254780921
254780922	254780923
254780924	254780925
254780926	254780927
254780928	254780929
254780930	254780931
peg_851	peg_852
254780932	254780933
254780934	254780935
254780936	254780937
254780938	254780939
254780940	254780941
254780942	254780943
254780944	254780945
254780946	254780947
peg_869	254780948
254780949	255764508
peg_873	peg_874
254780951	254780952
254780953	254780954
254780955	peg_880
254780956	254780957
254780958	254780959
peg_885	254780960
peg_887	peg_888
peg_889	254780961
254780962	254780963
254780964	254780965
254780966	254780967
254780968	254780969
254780970	254780971
254780972	254780973
254780974	254780975
peg_905	254780976
254780977	254780978
254780979	254780980
peg_911	peg_912
254780981	peg_913
254780982	254780983
peg_916	254780984
254780985	254780986
254780987	254780988
254780989	254780990
254780991	254780992
254780993	254780994
254780995	254780996
254780997	254780998
254780999	peg_930
peg_931	254781000
254781001	254781002
254781003	254781004
peg_937	254781005
254781006	254781007
254781008	peg_942
254781009	254781010
peg_945	254781011
254781012	254781013
254781014	peg_950
254781015	254781016
254781017	254781018
254781019	254781020
255764509	254781022
254781023	254781024
254781025	peg_961
254781026	254781027
254781028	254781029
254781030	254781031
254781032	254781033
254781034	255764510
254781036	254781037
254781038	254781039
254781040	254781041
254781042	254781043
254781044	254781045
254781046	254781047
254781048	254781049
254781050	254781051
254781052	254781053
254781054	254781055
254781056	254781057
254781058	peg_993
254781059	254781060
254781061	254781062
254781063	254781064
254781065	254781066
254781067	254781068
254781069	254781070
254781071	254781072
254781073	254781074
254781075	254781076
254781077	254781078
254781079	254781080
254781081	254781082
254781083	254781084
254781085	254781086
254781087	254781088
254781089	254781090
254781091	254781092
254781093	254781094
254781095	254781096
254781097	254781098
254781099	254781100
254781101	254781102
254781103	254781104
255764511	254781106
254781107	254781108
254781109	254781110
peg_1044	254781111
254781112	254781113
254781114	254781115
255764512	255764513
254781118	254781119
254781120	254781121
254781122	254781123
254781124	254781125
peg_1058	254781126
254781127	254781128
254781129	254781130
254781131	peg_1064
254781132	254781133
254781134	254781135
254781136	254781137
254781138	254781139
254781140	peg_1073
peg_1074	254781141
254781142	254781143
254781144	254781145
peg_1078	peg_1079
peg_1080	254781146
254781147	peg_1083
254781148	254781149
peg_1086	peg_1087
254781150	254781151
254781152	peg_1090
254781153	254781154
254781155	254781156
254781157	254781158
254781159	peg_1096
254781160	254781161
254781162	254781163
peg_1101	254781164
254781165	254781166
254781167	254781168
254781169	peg_1107
254781170	254781171
254781172	255764514
254781174	254781175
254781176	254781177
254781178	254781179
254781180	254781181
peg_1120	254781182
254781183	peg_1123
254781184	254781185
254781186	254781187
254781188	peg_1128
254781189	254781190
254781191	254781192
254781193	254781194
255764515	254781196
254781197	254781198
254781199	peg_1140
255764516	peg_1142
255764517	254781202
254781203	254781204
254781205	254781206
254781207	254781208
254781209	254781210
254781211	254781212
254781213	254781214
254781215	254781216
254781217	254781218
254781219	254781220
254781221	254781222
254781223	254781224
254781225	254781226
254781227	254781228
254780122	254780123
254780124	254780125
254780126	254780127
254780128	254780129
254780130	254780131
254780132	254780133
254780134	254780135
254780136	peg_15
254780137	254780138
254780139	254780140
254780141	peg_21
254780142	254780143
254780144	254780145
peg_26	254780146
254780147	254780148
254780149	254780150
254780151	peg_33
peg_34	254780152
peg_36	254780153
254780154	254780155
254780156	254780157
254780158	peg_42
254780159	254780160
254780161	254780162
254780163	254780164
254780165	254780166
254780167	254780168
254780169	peg_54
254780170	254780171
254780172	254780173
254780174	peg_60
254780175	254780176
254780177	254780178
254780179	254780180
254780181	254780182
254780183	254780184
254780185	254780186
254780187	254780188
peg_74	peg_75
254780189	254780190
254780191	255764460
peg_80	254780193
peg_82	254780194
254780195	254780196
254780197	254780198
254780199	254780200
254780201	254780202
peg_91	254780203
254780204	254780205
254780206	254780207
254780208	peg_97
peg_98	254780209
254780210	254780211
254780212	254780213
254780214	254780215
255764461	254780217
254780218	254780219
254780220	peg_109
254780221	254780222
254780223	254780224
254780225	254780226
peg_116	254780227
254780228	254780229
254780230	254780231
254780232	254780233
254780234	254780235
254780236	254780237
peg_128	254780238
254780239	254780240
254780241	254780242
254780243	254780244
254780245	254780246
254780247	254780248
254780249	254780250
254780251	254780252
254780253	254780254
254780255	254780256
254780257	254780258
254780259	254780260
254780261	254780262
254780263	254780264
254780265	254780266
254780267	254780268
254780269	254780270
254780271	254780272
254780273	254780274
peg_166	254780275
254780276	254780277
254780278	254780279
254780280	254780281
254780282	254780283
254780284	254780285
254780286	254780287
254780288	254780289
254780290	254780291
254780292	254780293
peg_186	254780294
254780295	255764462
254780297	peg_191
254780298	254780299
254780300	254780301
254780302	254780303
254780304	254780305
254780306	254780307
254780308	254780309
254780310	peg_204
254780311	254780312
254780313	254780314
254780315	254780316
254780317	254780318
254780319	254780320
254780321	254780322
254780323	peg_218
254780324	254780325
254780326	254780327
254780328	peg_224
254780329	254780330
peg_227	254780331
254780332	254780333
254780334	peg_232
254780335	peg_233
254780336	254780337
254780338	peg_237
254780339	254780340
254780341	254780342
254780343	254780344
254780345	254780346
254780347	254780348
peg_248	254780349
254780350	254780351
peg_252	255764463
peg_254	254780353
254780354	254780355
254780356	254780357
255764464	254780359
254780360	254780361
255764465	254780363
254780364	254780365
255764466	254780367
254780368	254780369
254780370	254780371
254780372	254780373
254780374	254780375
254780376	254780377
254780378	254780379
254780380	254780381
254780382	254780383
254780384	255764467
254780386	254780387
254780388	254780389
254780390	254780391
254780392	255764468
255764469	254780395
peg_298	254780396
254780397	254780398
254780399	254780400
254780401	254780402
254780403	254780404
254780405	254780406
254780407	254780408
254780409	254780410
254780411	254780412
254780413	254780414
255764470	254780416
254780417	254780418
254780419	254780420
254780421	255764471
254780423	254780424
254780425	254780426
peg_330	254780427
255764472	254780429
254780430	254780431
254780432	255764473
254780434	254780435
254780436	254780437
254780438	254780439
254780440	255764474
254780442	254780443
peg_348	peg_349
254780444	254780445
254780446	254780447
254780448	254780449
254780450	254780451
254780452	254780453
254780454	peg_360
254780455	254780456
peg_363	254780457
254780458	254780459
254780460	254780461
254780462	254780463
254780464	254780465
254780466	peg_374
254780467	254780468
254780469	254780470
254780471	254780472
254780473	254780474
254780475	254780476
254780477	254780478
254780479	254780480
254780481	254780482
254780483	254780484
peg_393	peg_394
254780485	254780486
254780487	254780488
254780489	254780490
254780491	254780492
254780829	254780828
254780827	254780826
255764475	255764476
254780824	254780823
peg_409	peg_410
254780822	254780821
254780820	peg_414
255764477	254780818
254780817	254780816
254780815	254780814
254780813	254780812
254780811	peg_423
254780810	254780809
254780808	254780807
254780806	254780805
254780804	254780803
254780802	254780801
254780800	254780799
254780798	254780797
254780796	254780795
254780794	254780793
255764478	254780791
254780790	254780789
254780788	254780787
254780786	254780785
254780784	254780783
254780782	255764479
254780781	254780780
peg_455	255764480
254780779	254780778
254780777	254780776
254780775	254780774
254780773	254780772
254780771	254780770
255764481	254780768
254780767	254780766
254780765	254780764
peg_472	peg_473
254780763	254780762
peg_476	peg_477
254780761	254780760
254780759	254780758
254780757	255764482
254780755	254780754
254780753	254780752
254780751	254780750
254780749	254780748
254780747	peg_493
254780746	254780745
254780744	254780743
254780742	254780741
254780740	254780739
255764483	254780737
254780736	254780735
254780734	254780733
254780732	peg_509
255764484	254780730
254780729	254780728
254780727	255764485
254780725	254780724
254780723	254780722
254780721	254780720
254780719	254780718
peg_523	254780717
254780716	254780715
254780714	254780713
254780712	254780711
254780710	peg_532
254780709	254780708
254780707	255764486
254780705	254780704
254780703	255764487
254780701	peg_542
254780700	254780699
254780698	254780697
254780696	254780695
254780694	254780693
254780692	254780691
254780690	254780689
254780688	254780687
255764488	254780685
254780684	254780683
254780682	255764489
254780680	peg_563
254780679	254780678
254780677	254780676
254780675	254780674
peg_568	254780673
255764490	254780671
254780670	254780669
peg_574	254780668
254780667	254780666
255764491	peg_577
254780664	254780663
254780662	254780661
peg_582	254780660
254780659	254780658
254780657	255764492
254780655	254780654
254780653	254780652
254780651	254780650
peg_593	254780649
254780648	254780647
254780646	peg_598
254780645	254780644
255764493	254780642
254780641	254780640
peg_603	254780639
254780638	255764494
254780636	254780635
254780634	254780633
254780632	254780631
peg_612	254780630
254780629	254780628
254780627	254780626
254780625	254780624
254780623	254780622
254780621	254780620
254780619	254780618
254780617	254780616
254780615	254780614
254780613	254780612
254780611	254780610
peg_634	255764495
254780608	254780607
254780606	254780605
254780604	254780603
254780602	254780601
254780600	255764496
254780598	255764497
254780596	254780595
254780594	254780593
254780592	254780591
254780590	254780589
254780588	255764498
peg_658	254780586
254780585	254780584
254780583	254780582
254780581	255764499
254780579	254780578
254780577	254780576
254780575	255764500
peg_671	254780573
254780572	254780571
254780570	254780569
254780568	254780567
254780565	254780564
254780563	254780562
peg_683	254780561
255764501	254780559
254780558	254780557
254780556	254780555
peg_691	254780554
254780553	254780552
254780551	255764502
254780549	254780548
254780547	254780546
254780545	254780544
254780543	254780542
255764503	254780540
254780539	254780538
254780537	254780536
254780535	254780534
254780533	254780532
254780531	254780530
254780529	254780528
254780527	254780526
254780525	254780524
254780523	254780522
254780521	254780520
254780519	254780518
255764504	254780516
254780515	254780514
254780513	254780512
254780511	254780510
254780509	254780508
254780507	254780506
254780505	254780504
254780503	254780502
254780501	254780500
254780499	254780498
254780497	254780496
254780495	254780494
254780493	254780830
254780831	254780832
254780833	peg_753
peg_754	254780834
255764505	254780836
254780837	peg_759
254780838	254780839
254780840	254780841
254780842	254780843
254780844	254780845
254780846	254780847
254780848	254780849
254780850	254780851
254780852	254780853
254780854	254780855
254780856	254780857
254780858	254780859
254780860	254780861
254780862	254780863
254780864	254780865
254780866	254780867
254780868	254780869
peg_786	254780870
peg_788