254780889
inosine 5'-monophosphate dehydrogenase
GeneID in NCBI database: | 8209909 | Locus tag: | CLIBASIA_03930 |
Protein GI in NCBI database: | 254780889 | Protein Accession: | YP_003065302.1 |
Gene range: | +(864881, 866362) | Protein Length: | 493aa |
Gene description: | inosine 5'-monophosphate dehydrogenase | ||
COG prediction: | [F] IMP dehydrogenase/GMP reductase | ||
KEGG prediction: | quaB; inosine 5'-monophosphate dehydrogenase (EC:1.1.1.205); K00088 IMP dehydrogenase [EC:1.1.1.205] | ||
SEED prediction: | Inosine-monophosphate dehydrogenase (EC 1.1.1.205) | ||
Pathway involved in KEGG: | Purine metabolism [PATH:las00230] | ||
Subsystem involved in SEED: | Purine conversions | ||
sequence | sequence profile |
Prediction of Local Sequence Properties
Source | Summary | Result |
---|
|
|
Close Homologs Detected by BLAST or PSI-BLAST
Homolog within the Genome Detected by BLAST
Original result of BLAST against C. L. asiaticus genome
Identity | Alignment graph | Length | Definition | E-value | |
Target | 493 | inosine 5'-monophosphate dehydrogenase [Candidatus Libe | |||
255764505 | 341 | polysialic acid capsule expression protein [Candid | 3e-04 | ||
254780426 | 320 | hemolysin protein [Candidatus Liberibacter asiatic | 0.001 |
>gi|255764505|ref|YP_003065248.2| polysialic acid capsule expression protein [Candidatus Liberibacter asiaticus str. psy62] Length = 341 | Back alignment |
---|
Score = 38.1 bits (87), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 49/174 (28%), Positives = 75/174 (43%), Gaps = 25/174 (14%) Query: 48 PIMSAAMDQVTDSRLAIAMAQAGGLGVIHRNFSPSEQVAQVHQVKKF-----------ES 96 P SA M LAIA+ ++ RNFS ++ +H K S Sbjct: 175 PTTSAIMQLAIGDALAIALLES-------RNFSENDFYV-LHPGGKLGTLFVCASDVMHS 226 Query: 97 GMVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDV--RFASNAQQ- 153 G + V I L DA+ ++ + + VV+ KL GI+T D+ F + Sbjct: 227 GDSIPLVKIG--CPLIDAITILSEKRFGCVAVVDEG-QKLKGIITEGDIFRNFHKDLNTL 283 Query: 154 AVGELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIER 207 +V ++M +N + + L A LL QH I L+VVDD IG++ D+ R Sbjct: 284 SVEDVMIKNPKVILEDTLLTVAMQLLRQHNISVLMVVDDCQKAIGIVHFLDLLR 337 |
>gi|254780426|ref|YP_003064839.1| hemolysin protein [Candidatus Liberibacter asiaticus str. psy62] Length = 320 | Back alignment |
---|
Score = 35.8 bits (81), Expect = 0.001, Method: Compositional matrix adjust. Identities = 36/140 (25%), Positives = 69/140 (49%), Gaps = 14/140 (10%) Query: 109 ATLADALALMKKYSISGIPVVESDVGKLVGILTNRDV------RFAS------NAQQAVG 156 AT+ +A+ + +KY S +PV ++ + G++ RDV +A N Q + Sbjct: 106 ATVYEAMLMFEKYGRSWMPVYKNSLDNPRGMVHMRDVISYISHMYAKTNNINLNIQLSES 165 Query: 157 ELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIERSQLNPNATK 216 L+ +N++ V ++ + + + + RI LV+D+ G GL++ +DI S L + T Sbjct: 166 NLI-KNILFVPSSMLVSDLLTNIQESRIRMALVIDEHGGTDGLVSYEDI-VSVLMRDITS 223 Query: 217 DSKGRLRVAAAVSVAKDIAD 236 + + + +AVS I D Sbjct: 224 EHHSKKSMISAVSDNTFIVD 243 |
Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations
Original result of PSI-BLAST first 2 iterations
Identity | Alignment graph | Length | Definition | Round | E-value |
Target | 493 | inosine 5'-monophosphate dehydrogenase [Candidatus Libe | |||
315122694 | 496 | inosine 5'-monophosphate dehydrogenase [Candidatus Libe | 1 | 0.0 | |
13476895 | 500 | inosine 5'-monophosphate dehydrogenase [Mesorhizobium l | 1 | 0.0 | |
116250620 | 494 | inosine 5'-monophosphate dehydrogenase [Rhizobium legum | 1 | 0.0 | |
260466886 | 500 | inosine-5'-monophosphate dehydrogenase [Mesorhizobium o | 1 | 0.0 | |
319784200 | 500 | inosine-5'-monophosphate dehydrogenase [Mesorhizobium c | 1 | 0.0 | |
150395604 | 500 | inosine 5'-monophosphate dehydrogenase [Sinorhizobium m | 1 | 0.0 | |
86356440 | 494 | inositol-5-monophosphate dehydrogenase [Rhizobium etli | 1 | 0.0 | |
153010375 | 497 | inositol-5-monophosphate dehydrogenase [Ochrobactrum an | 1 | 0.0 | |
241203226 | 494 | inosine 5'-monophosphate dehydrogenase [Rhizobium legum | 1 | 0.0 | |
327191166 | 494 | inositol-5-monophosphate dehydrogenase [Rhizobium etli | 1 | 0.0 |
>gi|315122694|ref|YP_004063183.1| inosine 5'-monophosphate dehydrogenase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 496 | Back alignment and organism information |
---|
Score = 826 bits (2133), Expect = 0.0, Method: Compositional matrix adjust. Identities = 428/495 (86%), Positives = 463/495 (93%), Gaps = 3/495 (0%) Query: 1 MARIIENNVGGVALTFDDVLLRPEFSNVLPRDIDISTRIAKDFTLNLPIMSAAMDQVTDS 60 MARIIENN+G +ALTFDDVLLRPEFS+VLP DIDIST+IAKDF LNLPI+SAAMDQVTDS Sbjct: 1 MARIIENNIGDMALTFDDVLLRPEFSDVLPGDIDISTQIAKDFKLNLPIISAAMDQVTDS 60 Query: 61 RLAIAMAQAGGLGVIHRNFSPSEQVAQVHQVKKFESGMVVNPVTISPYATLADALALMKK 120 RLAIAMAQAGGLGVIHRN SP EQV+QVHQVKKFESGMVVNPVTISP +TL DAL LMK Sbjct: 61 RLAIAMAQAGGLGVIHRNLSPCEQVSQVHQVKKFESGMVVNPVTISPCSTLEDALFLMKN 120 Query: 121 YSISGIPVVESDV---GKLVGILTNRDVRFASNAQQAVGELMTRNLITVKKTVNLENAKA 177 SISGIPVVES+ GKLVGILTNRDVRFAS+ QQ VGELMTR+LITVKK ++LE AKA Sbjct: 121 NSISGIPVVESNTCYPGKLVGILTNRDVRFASDTQQRVGELMTRDLITVKKEISLEEAKA 180 Query: 178 LLHQHRIEKLLVVDDDGCCIGLITVKDIERSQLNPNATKDSKGRLRVAAAVSVAKDIADR 237 LLH++RIEKLLVVDDD CCIGLITVKDIERS+LNP+ATKDSKGRLRVAAAVSV KDI +R Sbjct: 181 LLHKYRIEKLLVVDDDNCCIGLITVKDIERSRLNPHATKDSKGRLRVAAAVSVGKDIENR 240 Query: 238 VGPLFDVNVDLVVVDTAHGHSQKVLDAVVQIKKNFPSLLVMAGNIATAEGALALIDAGAD 297 VGPL DV VDL+VVDTAHGHSQKVLDAV +IKKNFPS+LVMAGN+AT+EGALALIDAG+D Sbjct: 241 VGPLVDVGVDLLVVDTAHGHSQKVLDAVKKIKKNFPSVLVMAGNVATSEGALALIDAGSD 300 Query: 298 IIKVGIGPGSICTTRVVTGVGCPQLSAIMSVVEVAERAGVAIVADGGIRFSGDIAKAIAA 357 IIKVGIGPGSICTTR+VTGVGCPQLSAIMS V VAERAGVA++ADGGIRFSGDIAKAIAA Sbjct: 301 IIKVGIGPGSICTTRIVTGVGCPQLSAIMSAVAVAERAGVAVIADGGIRFSGDIAKAIAA 360 Query: 358 GSACVMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAMERGSSARYSQDGVTDVLKL 417 GSA VMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAM GS+ARYSQDGVTDVLKL Sbjct: 361 GSAAVMIGSLLAGTDESPGDIFLYQGRSFKSYRGMGSVAAMVHGSAARYSQDGVTDVLKL 420 Query: 418 VPEGIEGRVPYKGPIASVLHQMSGGLKSSMGYVGASNIEEFQKKANFIRVSVAGLRESHV 477 VPEGIE RVPYKGP+ASVLHQM+GGLKSSMGYVGA++I++FQKKANFIR+S AG+RESHV Sbjct: 421 VPEGIEARVPYKGPVASVLHQMAGGLKSSMGYVGAADIKKFQKKANFIRISAAGVRESHV 480 Query: 478 HDVKITRESPNYSET 492 HDVKITRESPNY ET Sbjct: 481 HDVKITRESPNYFET 495 |
Species: Candidatus Liberibacter solanacearum Genus: Candidatus Liberibacter Family: Rhizobiaceae Order: Rhizobiales Class: Alphaproteobacteria Phylum: Proteobacteria Superkingdom: Bacteria |
>gi|13476895|ref|NP_108464.1| inosine 5'-monophosphate dehydrogenase [Mesorhizobium loti MAFF303099] Length = 500 | Back alignment and organism information |
---|
>gi|116250620|ref|YP_766458.1| inosine 5'-monophosphate dehydrogenase [Rhizobium leguminosarum bv. viciae 3841] Length = 494 | Back alignment and organism information |
---|
>gi|260466886|ref|ZP_05813070.1| inosine-5'-monophosphate dehydrogenase [Mesorhizobium opportunistum WSM2075] Length = 500 | Back alignment and organism information |
---|
>gi|319784200|ref|YP_004143676.1| inosine-5'-monophosphate dehydrogenase [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 500 | Back alignment and organism information |
---|
>gi|150395604|ref|YP_001326071.1| inosine 5'-monophosphate dehydrogenase [Sinorhizobium medicae WSM419] Length = 500 | Back alignment and organism information |
---|
>gi|86356440|ref|YP_468332.1| inositol-5-monophosphate dehydrogenase [Rhizobium etli CFN 42] Length = 494 | Back alignment and organism information |
---|
>gi|153010375|ref|YP_001371589.1| inositol-5-monophosphate dehydrogenase [Ochrobactrum anthropi ATCC 49188] Length = 497 | Back alignment and organism information |
---|
>gi|241203226|ref|YP_002974322.1| inosine 5'-monophosphate dehydrogenase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 494 | Back alignment and organism information |
---|
>gi|327191166|gb|EGE58210.1| inositol-5-monophosphate dehydrogenase [Rhizobium etli CNPAF512] Length = 494 | Back alignment and organism information |
---|
Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch
Conserved Domains in CDD Database Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
Original result of RPS-BLASTagainst CDD database part II
Identity | Alignment graph | Length | Definition | E-value |
Target | 493 | inosine 5'-monophosphate dehydrogenase [Candidatus Libe | ||
PRK05567 | 486 | PRK05567, PRK05567, inosine 5'-monophosphate dehydrogen | 0.0 | |
PTZ00314 | 495 | PTZ00314, PTZ00314, inosine-5'-monophosphate dehydrogen | 1e-143 | |
KOG2550 | 503 | KOG2550, KOG2550, KOG2550, IMP dehydrogenase/GMP reduct | 1e-107 | |
PLN02274 | 505 | PLN02274, PLN02274, inosine-5'-monophosphate dehydrogen | 1e-97 | |
PRK07807 | 479 | PRK07807, PRK07807, inosine 5-monophosphate dehydrogena | 4e-86 | |
PRK07107 | 502 | PRK07107, PRK07107, inosine 5-monophosphate dehydrogena | 4e-79 | |
TIGR01303 | 475 | TIGR01303, IMP_DH_rel_1, IMP dehydrogenase family prote | 2e-75 | |
pfam00478 | 467 | pfam00478, IMPDH, IMP dehydrogenase / GMP reductase dom | 0.0 | |
TIGR01302 | 450 | TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehyd | 1e-175 | |
cd00381 | 325 | cd00381, IMPDH, IMPDH: The catalytic domain of the inos | 2e-92 | |
PRK06843 | 404 | PRK06843, PRK06843, inosine 5-monophosphate dehydrogena | 5e-85 | |
TIGR01305 | 343 | TIGR01305, GMP_reduct_1, guanosine monophosphate reduct | 2e-48 | |
PRK05458 | 326 | PRK05458, PRK05458, guanosine 5'-monophosphate oxidored | 3e-43 | |
TIGR01306 | 321 | TIGR01306, GMP_reduct_2, guanosine monophosphate reduct | 6e-37 | |
PRK08649 | 368 | PRK08649, PRK08649, inosine 5-monophosphate dehydrogena | 1e-28 | |
PRK05096 | 346 | PRK05096, PRK05096, guanosine 5'-monophosphate oxidored | 4e-54 | |
COG0516 | 170 | COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nucleot | 8e-32 | |
cd04601 | 110 | cd04601, CBS_pair_IMPDH, This cd contains two tandem re | 3e-37 | |
cd04602 | 114 | cd04602, CBS_pair_IMPDH_2, This cd contains two tandem | 6e-20 | |
cd04599 | 105 | cd04599, CBS_pair_GGDEF_assoc2, This cd contains two ta | 5e-18 | |
cd04585 | 122 | cd04585, CBS_pair_ACT_assoc2, This cd contains two tand | 1e-17 | |
cd04584 | 121 | cd04584, CBS_pair_ACT_assoc, This cd contains two tande | 4e-17 | |
cd04611 | 111 | cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contain | 5e-16 | |
cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after human CB | 1e-15 | |
COG0517 | 117 | COG0517, COG0517, FOG: CBS domain [General function pre | 4e-15 | |
cd04622 | 113 | cd04622, CBS_pair_9, The CBS domain, named after human | 5e-15 | |
cd04631 | 125 | cd04631, CBS_pair_18, The CBS domain, named after human | 5e-14 | |
cd04800 | 111 | cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd con | 3e-13 | |
cd04623 | 113 | cd04623, CBS_pair_10, The CBS domain, named after human | 5e-13 | |
cd04588 | 110 | cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd con | 6e-13 | |
cd04803 | 122 | cd04803, CBS_pair_15, The CBS domain, named after human | 1e-12 | |
cd04638 | 106 | cd04638, CBS_pair_25, The CBS domain, named after human | 4e-12 | |
COG2524 | 294 | COG2524, COG2524, Predicted transcriptional regulator, | 5e-12 | |
cd04605 | 110 | cd04605, CBS_pair_MET2_assoc, This cd contains two tand | 1e-11 | |
cd04620 | 115 | cd04620, CBS_pair_7, The CBS domain, named after human | 1e-11 | |
cd04624 | 112 | cd04624, CBS_pair_11, The CBS domain, named after human | 2e-11 | |
cd04604 | 114 | cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two | 2e-11 | |
cd04612 | 111 | cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains | 2e-11 | |
cd04583 | 109 | cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains tw | 3e-11 | |
cd04595 | 110 | cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd contains | 3e-11 | |
cd04637 | 122 | cd04637, CBS_pair_24, The CBS domain, named after human | 7e-11 | |
cd04634 | 143 | cd04634, CBS_pair_21, The CBS domain, named after human | 4e-10 | |
cd04633 | 121 | cd04633, CBS_pair_20, The CBS domain, named after human | 1e-09 | |
cd04590 | 111 | cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two | 1e-09 | |
cd04607 | 113 | cd04607, CBS_pair_NTP_transferase_assoc, This cd contai | 2e-09 | |
cd04642 | 126 | cd04642, CBS_pair_29, The CBS domain, named after human | 3e-09 | |
cd04630 | 114 | cd04630, CBS_pair_17, The CBS domain, named after human | 4e-09 | |
cd04600 | 124 | cd04600, CBS_pair_HPP_assoc, This cd contains two tande | 4e-09 | |
cd04606 | 109 | cd04606, CBS_pair_Mg_transporter, This cd contains two | 4e-09 | |
cd04629 | 114 | cd04629, CBS_pair_16, The CBS domain, named after human | 4e-09 | |
cd04596 | 108 | cd04596, CBS_pair_DRTGG_assoc, This cd contains two tan | 4e-09 | |
cd04586 | 135 | cd04586, CBS_pair_BON_assoc, This cd contains two tande | 6e-09 | |
cd04610 | 107 | cd04610, CBS_pair_ParBc_assoc, This cd contains two tan | 7e-09 | |
cd04609 | 110 | cd04609, CBS_pair_PALP_assoc2, This cd contains two tan | 8e-09 | |
cd04587 | 113 | cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd cont | 8e-09 | |
cd04615 | 113 | cd04615, CBS_pair_2, The CBS domain, named after human | 2e-08 | |
cd04802 | 112 | cd04802, CBS_pair_3, The CBS domain, named after human | 3e-08 | |
cd04632 | 128 | cd04632, CBS_pair_19, The CBS domain, named after human | 6e-08 | |
cd04582 | 106 | cd04582, CBS_pair_ABC_OpuCA_assoc, This cd contains two | 2e-07 | |
cd04636 | 132 | cd04636, CBS_pair_23, The CBS domain, named after human | 3e-07 | |
KOG1764 | 381 | KOG1764, KOG1764, KOG1764, 5'-AMP-activated protein kin | 8e-07 | |
COG1253 | 429 | COG1253, TlyC, Hemolysins and related proteins containi | 1e-06 | |
cd04801 | 114 | cd04801, CBS_pair_M50_like, This cd contains two tandem | 1e-06 | |
cd04635 | 122 | cd04635, CBS_pair_22, The CBS domain, named after human | 2e-06 | |
COG3620 | 187 | COG3620, COG3620, Predicted transcriptional regulator w | 2e-06 | |
cd04627 | 123 | cd04627, CBS_pair_14, The CBS domain, named after human | 2e-06 | |
cd04643 | 116 | cd04643, CBS_pair_30, The CBS domain, named after human | 7e-06 | |
COG4109 | 432 | COG4109, COG4109, Predicted transcriptional regulator c | 8e-06 | |
COG3448 | 382 | COG3448, COG3448, CBS-domain-containing membrane protei | 9e-06 | |
cd04613 | 114 | cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains | 1e-05 | |
cd04639 | 111 | cd04639, CBS_pair_26, The CBS domain, named after human | 1e-05 | |
cd04621 | 135 | cd04621, CBS_pair_8, The CBS domain, named after human | 1e-05 | |
cd04589 | 111 | cd04589, CBS_pair_CAP-ED_DUF294_assoc_bac, This cd cont | 2e-05 | |
cd04626 | 111 | cd04626, CBS_pair_13, The CBS domain, named after human | 2e-05 | |
TIGR01186 | 363 | TIGR01186, proV, glycine betaine/L-proline transport AT | 2e-05 | |
TIGR01137 | 454 | TIGR01137, cysta_beta, cystathionine beta-synthase | 2e-05 | |
cd04641 | 120 | cd04641, CBS_pair_28, The CBS domain, named after human | 3e-05 | |
cd04594 | 104 | cd04594, CBS_pair_EriC_assoc_archaea, This cd contains | 4e-05 | |
KOG1764 | 381 | KOG1764, KOG1764, KOG1764, 5'-AMP-activated protein kin | 2e-04 | |
PRK11543 | 321 | PRK11543, gutQ, D-arabinose 5-phosphate isomerase; Prov | 2e-04 | |
cd04598 | 119 | cd04598, CBS_pair_GGDEF_assoc, This cd contains two tan | 5e-04 | |
cd04614 | 96 | cd04614, CBS_pair_1, The CBS domain, named after human | 0.001 | |
cd00381 | 325 | cd00381, IMPDH, IMPDH: The catalytic domain of the inos | 9e-26 | |
PRK06843 | 404 | PRK06843, PRK06843, inosine 5-monophosphate dehydrogena | 6e-19 | |
COG0516 | 170 | COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nucleot | 8e-19 | |
PRK08649 | 368 | PRK08649, PRK08649, inosine 5-monophosphate dehydrogena | 5e-07 | |
COG2070 | 336 | COG2070, COG2070, Dioxygenases related to 2-nitropropan | 9e-05 | |
TIGR01304 | 369 | TIGR01304, IMP_DH_rel_2, IMP dehydrogenase family prote | 4e-04 | |
PRK05096 | 346 | PRK05096, PRK05096, guanosine 5'-monophosphate oxidored | 0.002 | |
TIGR01305 | 343 | TIGR01305, GMP_reduct_1, guanosine monophosphate reduct | 0.002 | |
TIGR01304 | 369 | TIGR01304, IMP_DH_rel_2, IMP dehydrogenase family prote | 1e-19 | |
COG2905 | 610 | COG2905, COG2905, Predicted signal-transduction protein | 4e-14 | |
COG2239 | 451 | COG2239, MgtE, Mg/Co/Ni transporter MgtE (contains CBS | 3e-09 | |
cd02809 | 299 | cd02809, alpha_hydroxyacid_oxid_FMN, Family of homologo | 3e-08 | |
cd04737 | 351 | cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-bind | 3e-04 | |
cd04722 | 200 | cd04722, TIM_phosphate_binding, TIM barrel proteins sha | 3e-04 | |
cd02808 | 392 | cd02808, GltS_FMN, Glutamate synthase (GltS) FMN-bindin | 3e-04 | |
COG2070 | 336 | COG2070, COG2070, Dioxygenases related to 2-nitropropan | 5e-04 | |
PRK01130 | 221 | PRK01130, PRK01130, N-acetylmannosamine-6-phosphate 2-e | 5e-04 | |
cd04729 | 219 | cd04729, NanE, N-acetylmannosamine-6-phosphate epimeras | 7e-04 | |
cd04736 | 361 | cd04736, MDH_FMN, Mandelate dehydrogenase (MDH)-like FM | 0.004 | |
pfam00571 | 57 | pfam00571, CBS, CBS domain | 1e-07 | |
PRK14869 | 546 | PRK14869, PRK14869, putative manganese-dependent inorga | 2e-06 | |
cd04597 | 113 | cd04597, CBS_pair_DRTGG_assoc2, This cd contains two ta | 4e-05 | |
cd04584 | 121 | cd04584, CBS_pair_ACT_assoc, This cd contains two tande | 7e-05 | |
cd04803 | 122 | cd04803, CBS_pair_15, The CBS domain, named after human | 2e-04 | |
cd04592 | 133 | cd04592, CBS_pair_EriC_assoc_euk, This cd contains two | 0.001 | |
smart00116 | 49 | smart00116, CBS, Domain in cystathionine beta-synthase | 0.002 | |
cd04637 | 122 | cd04637, CBS_pair_24, The CBS domain, named after human | 3e-07 | |
pfam00571 | 57 | pfam00571, CBS, CBS domain | 5e-07 | |
cd04585 | 122 | cd04585, CBS_pair_ACT_assoc2, This cd contains two tand | 6e-07 | |
cd04584 | 121 | cd04584, CBS_pair_ACT_assoc, This cd contains two tande | 2e-06 | |
cd04631 | 125 | cd04631, CBS_pair_18, The CBS domain, named after human | 2e-06 | |
smart00116 | 49 | smart00116, CBS, Domain in cystathionine beta-synthase | 4e-06 | |
PRK14869 | 546 | PRK14869, PRK14869, putative manganese-dependent inorga | 9e-06 | |
cd04800 | 111 | cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd con | 2e-05 | |
cd04633 | 121 | cd04633, CBS_pair_20, The CBS domain, named after human | 2e-05 | |
cd04613 | 114 | cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains | 2e-05 | |
cd04604 | 114 | cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two | 4e-05 | |
cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after human CB | 1e-04 | |
cd04621 | 135 | cd04621, CBS_pair_8, The CBS domain, named after human | 1e-04 | |
cd04612 | 111 | cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains | 3e-04 | |
cd04802 | 112 | cd04802, CBS_pair_3, The CBS domain, named after human | 3e-04 | |
cd04634 | 143 | cd04634, CBS_pair_21, The CBS domain, named after human | 4e-04 | |
cd04586 | 135 | cd04586, CBS_pair_BON_assoc, This cd contains two tande | 4e-04 | |
cd04638 | 106 | cd04638, CBS_pair_25, The CBS domain, named after human | 6e-04 | |
cd04606 | 109 | cd04606, CBS_pair_Mg_transporter, This cd contains two | 8e-04 | |
cd04636 | 132 | cd04636, CBS_pair_23, The CBS domain, named after human | 8e-04 | |
cd04623 | 113 | cd04623, CBS_pair_10, The CBS domain, named after human | 0.001 | |
cd04597 | 113 | cd04597, CBS_pair_DRTGG_assoc2, This cd contains two ta | 0.001 | |
cd04583 | 109 | cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains tw | 0.002 | |
cd04622 | 113 | cd04622, CBS_pair_9, The CBS domain, named after human | 0.003 | |
cd04607 | 113 | cd04607, CBS_pair_NTP_transferase_assoc, This cd contai | 0.003 | |
cd04605 | 110 | cd04605, CBS_pair_MET2_assoc, This cd contains two tand | 0.004 | |
pfam01070 | 301 | pfam01070, FMN_dh, FMN-dependent dehydrogenase | 4e-07 | |
cd04730 | 236 | cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), on | 2e-05 | |
COG0069 | 485 | COG0069, GltB, Glutamate synthase domain 2 [Amino acid | 3e-04 | |
pfam03060 | 330 | pfam03060, NPD, 2-nitropropane dioxygenase | 4e-04 | |
COG1304 | 360 | COG1304, LldD, L-lactate dehydrogenase (FMN-dependent) | 5e-04 | |
pfam01645 | 367 | pfam01645, Glu_synthase, Conserved region in glutamate | 0.002 | |
TIGR00393 | 268 | TIGR00393, kpsF, KpsF/GutQ family protein | 2e-06 | |
cd04600 | 124 | cd04600, CBS_pair_HPP_assoc, This cd contains two tande | 9e-06 | |
COG3448 | 382 | COG3448, COG3448, CBS-domain-containing membrane protei | 6e-04 | |
cd04585 | 122 | cd04585, CBS_pair_ACT_assoc2, This cd contains two tand | 0.003 | |
TIGR03151 | 307 | TIGR03151, enACPred_II, putative enoyl-(acyl-carrier-pr | 3e-04 | |
cd04730 | 236 | cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), on | 4e-04 | |
cd04599 | 105 | cd04599, CBS_pair_GGDEF_assoc2, This cd contains two ta | 0.002 | |
TIGR00400 | 449 | TIGR00400, mgtE, Mg2+ transporter (mgtE) | 0.004 |
>gnl|CDD|180134 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
---|
>gnl|CDD|185550 PTZ00314, PTZ00314, inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
---|
>gnl|CDD|37761 KOG2550, KOG2550, KOG2550, IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
---|
>gnl|CDD|177913 PLN02274, PLN02274, inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
---|
>gnl|CDD|181127 PRK07807, PRK07807, inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
---|
>gnl|CDD|180842 PRK07107, PRK07107, inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
---|
>gnl|CDD|130370 TIGR01303, IMP_DH_rel_1, IMP dehydrogenase family protein | Back alignment and domain information |
---|
>gnl|CDD|144171 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain | Back alignment and domain information |
---|
>gnl|CDD|162293 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
---|
>gnl|CDD|73364 cd00381, IMPDH, IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase | Back alignment and domain information |
---|
>gnl|CDD|180725 PRK06843, PRK06843, inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
---|
>gnl|CDD|130372 TIGR01305, GMP_reduct_1, guanosine monophosphate reductase, eukaryotic | Back alignment and domain information |
---|
>gnl|CDD|180097 PRK05458, PRK05458, guanosine 5'-monophosphate oxidoreductase; Provisional | Back alignment and domain information |
---|
>gnl|CDD|130373 TIGR01306, GMP_reduct_2, guanosine monophosphate reductase, bacterial | Back alignment and domain information |
---|
>gnl|CDD|181521 PRK08649, PRK08649, inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
---|
>gnl|CDD|179935 PRK05096, PRK05096, guanosine 5'-monophosphate oxidoreductase; Provisional | Back alignment and domain information |
---|
>gnl|CDD|30862 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
---|
>gnl|CDD|73101 cd04601, CBS_pair_IMPDH, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
---|
>gnl|CDD|73102 cd04602, CBS_pair_IMPDH_2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
---|
>gnl|CDD|73099 cd04599, CBS_pair_GGDEF_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
---|
>gnl|CDD|73085 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
---|
>gnl|CDD|73084 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
---|
>gnl|CDD|73111 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
---|
>gnl|CDD|73081 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|30863 COG0517, COG0517, FOG: CBS domain [General function prediction only] | Back alignment and domain information |
---|
>gnl|CDD|73121 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73129 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73142 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
---|
>gnl|CDD|73122 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73088 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
---|
>gnl|CDD|73145 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73136 cd04638, CBS_pair_25, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|32593 COG2524, COG2524, Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
---|
>gnl|CDD|73105 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
---|
>gnl|CDD|73119 cd04620, CBS_pair_7, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73123 cd04624, CBS_pair_11, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73104 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
---|
>gnl|CDD|73112 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
---|
>gnl|CDD|73083 cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
---|
>gnl|CDD|73095 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
---|
>gnl|CDD|73135 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73132 cd04634, CBS_pair_21, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73131 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73090 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
---|
>gnl|CDD|73107 cd04607, CBS_pair_NTP_transferase_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
---|
>gnl|CDD|73140 cd04642, CBS_pair_29, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73128 cd04630, CBS_pair_17, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73100 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
---|
>gnl|CDD|73106 cd04606, CBS_pair_Mg_transporter, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
---|
>gnl|CDD|73127 cd04629, CBS_pair_16, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73096 cd04596, CBS_pair_DRTGG_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
---|
>gnl|CDD|73086 cd04586, CBS_pair_BON_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
---|
>gnl|CDD|73110 cd04610, CBS_pair_ParBc_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
---|
>gnl|CDD|73109 cd04609, CBS_pair_PALP_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
---|
>gnl|CDD|73087 cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
---|
>gnl|CDD|73115 cd04615, CBS_pair_2, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73144 cd04802, CBS_pair_3, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73130 cd04632, CBS_pair_19, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73082 cd04582, CBS_pair_ABC_OpuCA_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
---|
>gnl|CDD|73134 cd04636, CBS_pair_23, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|36975 KOG1764, KOG1764, KOG1764, 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
---|
>gnl|CDD|31445 COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
---|
>gnl|CDD|73143 cd04801, CBS_pair_M50_like, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
---|
>gnl|CDD|73133 cd04635, CBS_pair_22, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|33419 COG3620, COG3620, Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
---|
>gnl|CDD|73126 cd04627, CBS_pair_14, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73141 cd04643, CBS_pair_30, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|33866 COG4109, COG4109, Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
---|
>gnl|CDD|33251 COG3448, COG3448, CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
---|
>gnl|CDD|73113 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
---|
>gnl|CDD|73137 cd04639, CBS_pair_26, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73120 cd04621, CBS_pair_8, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73089 cd04589, CBS_pair_CAP-ED_DUF294_assoc_bac, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
---|
>gnl|CDD|73125 cd04626, CBS_pair_13, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
---|
>gnl|CDD|162220 TIGR01137, cysta_beta, cystathionine beta-synthase | Back alignment and domain information |
---|
>gnl|CDD|73139 cd04641, CBS_pair_28, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73094 cd04594, CBS_pair_EriC_assoc_archaea, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
---|
>gnl|CDD|36975 KOG1764, KOG1764, KOG1764, 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
---|
>gnl|CDD|183186 PRK11543, gutQ, D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
---|
>gnl|CDD|73098 cd04598, CBS_pair_GGDEF_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
---|
>gnl|CDD|73114 cd04614, CBS_pair_1, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73364 cd00381, IMPDH, IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase | Back alignment and domain information |
---|
>gnl|CDD|180725 PRK06843, PRK06843, inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
---|
>gnl|CDD|30862 COG0516, GuaB, IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
---|
>gnl|CDD|181521 PRK08649, PRK08649, inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
---|
>gnl|CDD|32253 COG2070, COG2070, Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] | Back alignment and domain information |
---|
>gnl|CDD|162294 TIGR01304, IMP_DH_rel_2, IMP dehydrogenase family protein | Back alignment and domain information |
---|
>gnl|CDD|179935 PRK05096, PRK05096, guanosine 5'-monophosphate oxidoreductase; Provisional | Back alignment and domain information |
---|
>gnl|CDD|130372 TIGR01305, GMP_reduct_1, guanosine monophosphate reductase, eukaryotic | Back alignment and domain information |
---|
>gnl|CDD|162294 TIGR01304, IMP_DH_rel_2, IMP dehydrogenase family protein | Back alignment and domain information |
---|
>gnl|CDD|32729 COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
---|
>gnl|CDD|32420 COG2239, MgtE, Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
---|
>gnl|CDD|73371 cd02809, alpha_hydroxyacid_oxid_FMN, Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes | Back alignment and domain information |
---|
>gnl|CDD|73399 cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain | Back alignment and domain information |
---|
>gnl|CDD|73384 cd04722, TIM_phosphate_binding, TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure | Back alignment and domain information |
---|
>gnl|CDD|73370 cd02808, GltS_FMN, Glutamate synthase (GltS) FMN-binding domain | Back alignment and domain information |
---|
>gnl|CDD|32253 COG2070, COG2070, Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] | Back alignment and domain information |
---|
>gnl|CDD|179231 PRK01130, PRK01130, N-acetylmannosamine-6-phosphate 2-epimerase; Provisional | Back alignment and domain information |
---|
>gnl|CDD|73391 cd04729, NanE, N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate | Back alignment and domain information |
---|
>gnl|CDD|73398 cd04736, MDH_FMN, Mandelate dehydrogenase (MDH)-like FMN-binding domain | Back alignment and domain information |
---|
>gnl|CDD|144238 pfam00571, CBS, CBS domain | Back alignment and domain information |
---|
>gnl|CDD|184871 PRK14869, PRK14869, putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
---|
>gnl|CDD|73097 cd04597, CBS_pair_DRTGG_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
---|
>gnl|CDD|73084 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
---|
>gnl|CDD|73145 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73092 cd04592, CBS_pair_EriC_assoc_euk, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
---|
>gnl|CDD|128426 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
---|
>gnl|CDD|73135 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|144238 pfam00571, CBS, CBS domain | Back alignment and domain information |
---|
>gnl|CDD|73085 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
---|
>gnl|CDD|73084 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
---|
>gnl|CDD|73129 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|128426 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
---|
>gnl|CDD|184871 PRK14869, PRK14869, putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
---|
>gnl|CDD|73142 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
---|
>gnl|CDD|73131 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73113 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
---|
>gnl|CDD|73104 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
---|
>gnl|CDD|73081 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73120 cd04621, CBS_pair_8, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73112 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
---|
>gnl|CDD|73144 cd04802, CBS_pair_3, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73132 cd04634, CBS_pair_21, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73086 cd04586, CBS_pair_BON_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
---|
>gnl|CDD|73136 cd04638, CBS_pair_25, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73106 cd04606, CBS_pair_Mg_transporter, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
---|
>gnl|CDD|73134 cd04636, CBS_pair_23, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73122 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73097 cd04597, CBS_pair_DRTGG_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
---|
>gnl|CDD|73083 cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
---|
>gnl|CDD|73121 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
---|
>gnl|CDD|73107 cd04607, CBS_pair_NTP_transferase_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
---|
>gnl|CDD|73105 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
---|
>gnl|CDD|144604 pfam01070, FMN_dh, FMN-dependent dehydrogenase | Back alignment and domain information |
---|
>gnl|CDD|73392 cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites | Back alignment and domain information |
---|
>gnl|CDD|30418 COG0069, GltB, Glutamate synthase domain 2 [Amino acid transport and metabolism] | Back alignment and domain information |
---|
>gnl|CDD|145943 pfam03060, NPD, 2-nitropropane dioxygenase | Back alignment and domain information |
---|
>gnl|CDD|31495 COG1304, LldD, L-lactate dehydrogenase (FMN-dependent) and related alpha-hydroxy acid dehydrogenases [Energy production and conversion] | Back alignment and domain information |
---|
>gnl|CDD|110632 pfam01645, Glu_synthase, Conserved region in glutamate synthase | Back alignment and domain information |
---|
>gnl|CDD|129488 TIGR00393, kpsF, KpsF/GutQ family protein | Back alignment and domain information |
---|
>gnl|CDD|73100 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
---|
>gnl|CDD|33251 COG3448, COG3448, CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
---|
>gnl|CDD|73085 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
---|
>gnl|CDD|132195 TIGR03151, enACPred_II, putative enoyl-(acyl-carrier-protein) reductase II | Back alignment and domain information |
---|
>gnl|CDD|73392 cd04730, NPD_like, 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites | Back alignment and domain information |
---|
>gnl|CDD|73099 cd04599, CBS_pair_GGDEF_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
---|
>gnl|CDD|129495 TIGR00400, mgtE, Mg2+ transporter (mgtE) | Back alignment and domain information |
---|
Conserved Domains in CDD Database Detected by HHsearch
Original result of HHsearch against CDD database
Identity | Alignment graph | Length | Definition | Probability |
Target | 493 | inosine 5'-monophosphate dehydrogenase [Candidatus Libe | ||
TIGR01302 | 476 | IMP_dehydrog inosine-5'-monophosphate dehydrogenase; In | 100.0 | |
PTZ00314 | 499 | inosine-5'-monophosphate dehydrogenase; Provisional | 100.0 | |
PRK07807 | 479 | inositol-5-monophosphate dehydrogenase; Validated | 100.0 | |
pfam00478 | 467 | IMPDH IMP dehydrogenase / GMP reductase domain. This fa | 100.0 | |
KOG2550 | 503 | consensus | 100.0 | |
PRK06843 | 404 | inositol-5-monophosphate dehydrogenase; Validated | 100.0 | |
cd00381 | 325 | IMPDH IMPDH: The catalytic domain of the inosine monoph | 100.0 | |
PRK05096 | 347 | guanosine 5'-monophosphate oxidoreductase; Provisional | 100.0 | |
PRK08649 | 368 | inositol-5-monophosphate dehydrogenase; Validated | 100.0 | |
PRK05458 | 326 | guanosine 5'-monophosphate oxidoreductase; Provisional | 100.0 | |
TIGR01303 | 476 | IMP_DH_rel_1 IMP dehydrogenase family protein; InterPro | 100.0 | |
TIGR01305 | 343 | GMP_reduct_1 guanosine monophosphate reductase; InterPr | 100.0 | |
TIGR01304 | 376 | IMP_DH_rel_2 IMP dehydrogenase family protein; InterPro | 100.0 | |
TIGR01306 | 321 | GMP_reduct_2 guanosine monophosphate reductase; InterPr | 100.0 | |
cd02922 | 344 | FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain. | 99.65 | |
cd04737 | 351 | LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain | 99.63 | |
cd04736 | 361 | MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding | 99.63 | |
PRK11197 | 381 | lldD L-lactate dehydrogenase; Provisional | 99.59 | |
TIGR02151 | 349 | IPP_isom_2 isopentenyl-diphosphate delta-isomerase, typ | 99.57 | |
cd03332 | 383 | LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding dom | 99.56 | |
KOG0538 | 363 | consensus | 99.12 | |
TIGR01303 | 476 | IMP_DH_rel_1 IMP dehydrogenase family protein; InterPro | 96.7 | |
PRK05567 | 486 | inositol-5'-monophosphate dehydrogenase; Reviewed | 100.0 | |
PRK07107 | 497 | inositol-5-monophosphate dehydrogenase; Validated | 100.0 | |
COG0516 | 170 | GuaB IMP dehydrogenase/GMP reductase [Nucleotide transp | 99.97 | |
cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repeats of | 99.9 | |
cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem repeat | 99.87 | |
cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two tandem | 99.86 | |
cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, is a | 99.86 | |
cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem repeat | 99.86 | |
cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats of t | 99.86 | |
cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, is a | 99.85 | |
cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, is a | 99.85 | |
cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, is a | 99.85 | |
cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem r | 99.85 | |
cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, is a | 99.85 | |
cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, is a | 99.84 | |
cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem repea | 99.84 | |
cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, is a | 99.84 | |
cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, is a | 99.84 | |
cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, is a | 99.84 | |
cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem repeats | 99.84 | |
cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two t | 99.83 | |
cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, is a | 99.83 | |
cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem repeats | 99.83 | |
cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem repeats | 99.83 | |
cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, is a | 99.83 | |
cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, is a | 99.83 | |
cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tandem re | 99.83 | |
cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two | 99.83 | |
cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem repeats | 99.83 | |
cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, is a | 99.82 | |
cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, is a | 99.82 | |
cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem repeats | 99.82 | |
cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two tande | 99.82 | |
cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem | 99.81 | |
cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, is a | 99.81 | |
cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, is a | 99.81 | |
cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tande | 99.81 | |
cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, is a | 99.81 | |
cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, is a | 99.81 | |
cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, is a | 99.81 | |
cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, is a | 99.81 | |
cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains two tan | 99.81 | |
cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, is a | 99.81 | |
cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, is a | 99.81 | |
cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tand | 99.8 | |
cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, is a | 99.8 | |
cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two tande | 99.8 | |
cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, is a | 99.8 | |
cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, is a | 99.8 | |
cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, is a | 99.79 | |
cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tandem re | 99.79 | |
cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, is a | 99.79 | |
cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two | 99.78 | |
cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two t | 99.76 | |
cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repeats o | 99.76 | |
cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, is a | 99.75 | |
cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem repeats | 99.75 | |
COG2524 | 294 | Predicted transcriptional regulator, contains C-termina | 99.74 | |
cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem repeat | 99.74 | |
cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, is a | 99.73 | |
cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tandem rep | 99.69 | |
cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem repeat | 99.67 | |
cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tandem re | 99.61 | |
cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two tandem | 99.6 | |
cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem repeats | 99.59 | |
PRK01862 | 583 | putative voltage-gated ClC-type chloride channel ClcB; | 99.58 | |
cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is a sm | 99.5 | |
cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tandem rep | 99.38 | |
COG3620 | 187 | Predicted transcriptional regulator with C-terminal CBS | 99.34 | |
COG0517 | 117 | FOG: CBS domain [General function prediction only] | 99.33 | |
TIGR00393 | 272 | kpsF sugar isomerase, KpsF/GutQ family; InterPro: IPR00 | 99.22 | |
PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; Provis | 99.22 | |
COG1253 | 429 | TlyC Hemolysins and related proteins containing CBS dom | 99.18 | |
KOG1764 | 381 | consensus | 99.01 | |
TIGR01137 | 527 | cysta_beta cystathionine beta-synthase; InterPro: IPR00 | 98.69 | |
cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, is a | 98.56 | |
COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic | 98.46 | |
KOG1764 | 381 | consensus | 98.45 | |
COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic | 98.43 | |
PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; Provis | 97.53 | |
TIGR00400 | 460 | mgtE magnesium transporter; InterPro: IPR006669 This is | 96.67 | |
cd04730 | 236 | NPD_like 2-Nitropropane dioxygenase (NPD), one of the n | 99.87 | |
pfam03060 | 330 | NPD 2-nitropropane dioxygenase. Members of this family | 99.81 | |
TIGR03151 | 307 | enACPred_II putative enoyl-(acyl-carrier-protein) reduc | 99.75 | |
COG2070 | 336 | Dioxygenases related to 2-nitropropane dioxygenase [Gen | 99.35 | |
pfam04551 | 345 | GcpE GcpE protein. In a variety of organisms, including | 96.51 | |
PRK05437 | 351 | isopentenyl pyrophosphate isomerase; Provisional | 99.79 | |
cd02811 | 326 | IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosp | 99.73 | |
COG1304 | 360 | idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 a | 99.48 | |
COG0516 | 170 | GuaB IMP dehydrogenase/GMP reductase [Nucleotide transp | 99.42 | |
cd02808 | 392 | GltS_FMN Glutamate synthase (GltS) FMN-binding domain. | 98.79 | |
TIGR02708 | 368 | L_lactate_ox L-lactate oxidase; InterPro: IPR014080 Mem | 98.67 | |
COG0069 | 485 | GltB Glutamate synthase domain 2 [Amino acid transport | 98.66 | |
pfam01070 | 301 | FMN_dh FMN-dependent dehydrogenase. | 99.75 | |
cd02809 | 299 | alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dep | 99.7 | |
PRK08318 | 413 | dihydropyrimidine dehydrogenase; Validated | 99.24 | |
PRK07565 | 333 | dihydroorotate dehydrogenase 2; Reviewed | 99.23 | |
cd04739 | 325 | DHOD_like Dihydroorotate dehydrogenase (DHOD) like prot | 99.23 | |
cd04740 | 296 | DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class | 98.72 | |
PRK07259 | 301 | dihydroorotate dehydrogenase 1B; Reviewed | 98.69 | |
pfam01645 | 367 | Glu_synthase Conserved region in glutamate synthase. Th | 98.59 | |
PRK02506 | 308 | dihydroorotate dehydrogenase 1A; Reviewed | 98.12 | |
COG0167 | 310 | PyrD Dihydroorotate dehydrogenase [Nucleotide transport | 98.06 | |
COG4109 | 432 | Predicted transcriptional regulator containing CBS doma | 99.73 | |
PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisional | 99.65 | |
COG3448 | 382 | CBS-domain-containing membrane protein [Signal transduc | 99.59 | |
PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 99.58 | |
TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Members | 99.43 | |
PRK11573 | 413 | hypothetical protein; Provisional | 99.24 | |
TIGR01186 | 372 | proV glycine betaine/L-proline transport ATP binding su | 99.23 | |
KOG0475 | 696 | consensus | 98.7 | |
KOG0474 | 762 | consensus | 98.51 | |
KOG2118 | 498 | consensus | 96.26 | |
TIGR01137 | 527 | cysta_beta cystathionine beta-synthase; InterPro: IPR00 | 96.24 | |
COG2905 | 610 | Predicted signal-transduction protein containing cAMP-b | 99.69 | |
TIGR01186 | 372 | proV glycine betaine/L-proline transport ATP binding su | 95.94 | |
COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [I | 99.28 | |
pfam00478 | 467 | IMPDH IMP dehydrogenase / GMP reductase domain. This fa | 98.76 | |
COG2513 | 289 | PrpB PEP phosphonomutase and related enzymes [Carbohydr | 93.84 | |
cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem repea | 98.95 | |
PTZ00314 | 499 | inosine-5'-monophosphate dehydrogenase; Provisional | 98.92 | |
cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, is a | 98.66 | |
cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, is a | 98.6 | |
cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, is a | 98.59 | |
cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, is a | 98.59 | |
cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, is a | 98.56 | |
smart00116 | 49 | CBS Domain in cystathionine beta-synthase and other pro | 98.56 | |
cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tande | 98.55 | |
cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem repeats | 98.54 | |
cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem repeats | 98.53 | |
cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem repeats | 98.53 | |
cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tandem re | 98.52 | |
cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, is a | 98.51 | |
cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, is a | 98.5 | |
cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, is a | 98.49 | |
cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, is a | 98.49 | |
cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem repeats | 98.48 | |
cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, is a | 98.48 | |
cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, is a | 98.47 | |
cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, is a | 98.47 | |
cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, is a | 98.46 | |
cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, is a | 98.46 | |
cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, is a | 98.45 | |
cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem r | 98.45 | |
cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two tande | 98.44 | |
cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem repeats | 98.41 | |
cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repeats of | 98.4 | |
cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, is a | 98.39 | |
cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, is a | 98.39 | |
cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, is a | 98.36 | |
cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem repeats | 98.35 | |
cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem repeat | 98.34 | |
cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two | 98.32 | |
cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, is a | 98.31 | |
cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, is a | 98.29 | |
cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem | 98.29 | |
cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains two tan | 98.26 | |
cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem repeat | 98.25 | |
cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two tande | 98.24 | |
cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats of t | 98.23 | |
cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, is a | 98.23 | |
cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem repeat | 98.22 | |
cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tandem rep | 98.2 | |
pfam00571 | 57 | CBS CBS domain. CBS domains are small intracellular mod | 98.2 | |
cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem repeats | 98.15 | |
cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repeats o | 98.12 | |
cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two | 98.03 | |
PRK01862 | 583 | putative voltage-gated ClC-type chloride channel ClcB; | 98.0 | |
cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem repeat | 97.85 | |
cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tandem re | 97.85 | |
cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is a sm | 97.6 | |
COG2905 | 610 | Predicted signal-transduction protein containing cAMP-b | 97.5 | |
COG3620 | 187 | Predicted transcriptional regulator with C-terminal CBS | 97.36 | |
COG1253 | 429 | TlyC Hemolysins and related proteins containing CBS dom | 97.16 | |
COG0517 | 117 | FOG: CBS domain [General function prediction only] | 97.01 | |
TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Members | 96.96 | |
COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [I | 96.86 | |
PRK11573 | 413 | hypothetical protein; Provisional | 96.55 | |
KOG0474 | 762 | consensus | 94.7 | |
PRK05567 | 486 | inositol-5'-monophosphate dehydrogenase; Reviewed | 98.93 | |
TIGR01302 | 476 | IMP_dehydrog inosine-5'-monophosphate dehydrogenase; In | 98.81 | |
TIGR01108 | 616 | oadA oxaloacetate decarboxylase alpha subunit; InterPro | 94.11 | |
PRK13122 | 242 | consensus | 93.92 | |
cd04729 | 219 | NanE N-acetylmannosamine-6-phosphate epimerase (NanE) c | 98.92 | |
PRK01130 | 222 | N-acetylmannosamine-6-phosphate 2-epimerase; Provisiona | 98.84 | |
pfam04131 | 192 | NanE Putative N-acetylmannosamine-6-phosphate epimerase | 98.82 | |
cd04722 | 200 | TIM_phosphate_binding TIM barrel proteins share a struc | 98.69 | |
pfam01180 | 290 | DHO_dh Dihydroorotate dehydrogenase. | 98.62 | |
PRK07455 | 210 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon | 98.36 | |
PRK05718 | 212 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon | 98.34 | |
cd02810 | 289 | DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and D | 98.33 | |
PRK08104 | 212 | consensus | 98.33 | |
PRK06015 | 212 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon | 98.32 | |
cd04734 | 343 | OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN bind | 98.3 | |
PRK08782 | 219 | consensus | 98.24 | |
PRK06552 | 209 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon | 98.23 | |
cd02930 | 353 | DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding dom | 98.2 | |
PRK08904 | 207 | consensus | 98.19 | |
cd00452 | 190 | KDPG_aldolase KDPG and KHG aldolase. This family belong | 98.19 | |
pfam01081 | 196 | Aldolase KDPG and KHG aldolase. This family includes th | 98.11 | |
COG3010 | 229 | NanE Putative N-acetylmannosamine-6-phosphate epimerase | 98.11 | |
TIGR01182 | 205 | eda 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydrox | 98.11 | |
cd02931 | 382 | ER_like_FMN Enoate reductase (ER)-like FMN-binding doma | 98.1 | |
PRK09140 | 206 | 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Review | 98.09 | |
cd04735 | 353 | OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN bind | 98.05 | |
PRK07114 | 223 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon | 98.03 | |
cd02932 | 336 | OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN bind | 98.0 | |
COG0800 |