254780901

254780901

single-stranded-DNA-specific exonuclease protein

GeneID in NCBI database:8209921Locus tag:CLIBASIA_04000
Protein GI in NCBI database:254780901Protein Accession:YP_003065314.1
Gene range:+(878507, 880309)Protein Length:600aa
Gene description:single-stranded-DNA-specific exonuclease protein
COG prediction:[L] Single-stranded DNA-specific exonuclease
KEGG prediction:recJ; single-stranded-DNA-specific exonuclease protein; K07462 single-stranded-DNA-specific exonuclease [EC:3.1.-.-]
SEED prediction:Single-stranded-DNA-specific exonuclease RecJ (EC 3.1.-.-)
Pathway involved in KEGG:Base excision repair [PATH:las03410]
Mismatch repair [PATH:las03430]
Homologous recombination [PATH:las03440]
Subsystem involved in SEED:DNA Repair Base Excision;
DNA-replication;
DNA repair, bacterial RecFOR pathway
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600
MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK
ccccccccHHHHHcccccccccccccHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHcHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHHccccEEEccccHHccccccHHHHHHHHHccccEEEEEccccccHHHHHHHHHcccEEEEEcccccccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHEEEccccHHHHHHHHHHHHHccccccHHHHHHHHcccccccHHHHHHHHccccHHccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccccccHHHHHHHHHHHHHcccEEEEEEccccEEEEEEEccccccHHHHHHHHcccccEEccccccHHccccccHHHHHHHHHHHHHHHHHHccHHHccccEEEcccccHHHccHHHHHHHHHcccccccccccEEEccccEEEEEEEEcccEEEEEEEcccccEEEEEEEcccccccHHHHHcccccEEEEEEEEEEEEEccccEEEEEEEEccccHHHHHccc
cccHHHccccccccccEEEHccccccHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHcHHHHHccccHHHHHHHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHHHccccccEEccccccccccccHHHHHHHHHcccEEEEEEcccHcHHHHHHHHHHccccEEEEccccccccccccEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHccccccHHHccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEcccccccHHEEEHHHHHHHccccEEEEEEccccEEEEcccccccccHHHHHHHccccccEEcccccHHHccccccHHcHHHHHHHHHHHHHHHHcHHHcccEEEEcccccHHHccHHHHHHHHHcccccccccccEEEcccEEEEEEEHHccccEEEEEccccccEEEEEEEEccccccHHHHHcccccEEEEEEEEEEcccccccccEEEEEccccHHHHHHccc
MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSidyakdflnpsirllmpdpliltdCDKAARRIVQAIYNSekimifgdydvdGAASVALMMRFLSHCsvnanmyipdrivdgygpnpslMEKFINEGAQLIITvdcgstsyDALQYATNQGIDVIVIDhhqvkseeipayalvnpnrlddlsgqghLCAAGVVFLVLVLIYRILRqdnkvplnfdLLSLLDLVALATvcdvvpliglNRAYVVKGLMVARRQGNPGLKALIERVnisspitaenlgymigpsinaggrigesnlgsrllisdDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKekfgrpsfaisfeedgkgigsgrsiegfdiGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHnivpalittpvfkidgVLNASAVNIALIDMLesagpygagnpnpvfafpnhklqsIRVVNLAHLQMTFESQDSETLQAIAFRVYGtplgeflmqsrgkrmhvTGHLCVnywrgskrcqlrvldaspveghhfakk
MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDflnpsirllmpdPLILTDCDKAARRIVQAIynsekimifGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSfaisfeedgkgigsgRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLdaspveghhfakk
MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPlnfdllslldlvalaTVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK
**DQAFLGVECSISGFRWVSLLGQEG**R*LAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFA**
MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK
*NDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK
MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK
MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGHHFAKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target600 single-stranded-DNA-specific exonuclease protein [Candi
315122680596 single-stranded-DNA-specific exonuclease protein [Candi 1 0.0
222085813604 single-stranded-DNA-specific exonuclease protein [Agrob 1 0.0
327190809600 single-stranded-DNA-specific exonuclease protein [Rhizo 1 0.0
209549146600 single-stranded-DNA-specific exonuclease RecJ [Rhizobiu 1 0.0
86357505600 single-stranded-DNA-specific exonuclease protein [Rhizo 1 0.0
241204470600 single-stranded-DNA-specific exonuclease RecJ [Rhizobiu 1 0.0
325292975602 single-stranded-DNA-specific exonuclease [Agrobacterium 1 0.0
190891568600 single-stranded-DNA-specific exonuclease [Rhizobium etl 1 0.0
15888900602 single-stranded-DNA-specific exonuclease [Agrobacterium 1 0.0
116251859586 single-stranded-DNA-specific exonuclease [Rhizobium leg 1 0.0
>gi|315122680|ref|YP_004063169.1| single-stranded-DNA-specific exonuclease protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 596 Back     alignment and organism information
 Score =  985 bits (2546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/596 (82%), Positives = 544/596 (91%), Gaps = 1/596 (0%)

Query: 1   MNDQAFLGVECSISGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDF 60
           MN QAFLGVE SISGFRW+SLLGQE INRALAITQKHAIPD+VARVLV R+VSID A++F
Sbjct: 1   MNYQAFLGVERSISGFRWLSLLGQEEINRALAITQKHAIPDLVARVLVGRHVSIDCAEEF 60

Query: 61  LNPSIRLLMPDPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCS 120
           LNPSIR LMP+PL LTDCDKAARRIVQAIYNSEKI I GDYDVDGAASVALMMRF S+  
Sbjct: 61  LNPSIRSLMPNPLTLTDCDKAARRIVQAIYNSEKIAILGDYDVDGAASVALMMRFFSYYG 120

Query: 121 VNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVID 180
           V++NMYIPDRI+DGYGPNP LM+K I+EGAQLIITVDCGSTS++ALQ+++NQGIDVIVID
Sbjct: 121 VDSNMYIPDRILDGYGPNPDLMKKIIDEGAQLIITVDCGSTSHEALQFSSNQGIDVIVID 180

Query: 181 HHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLN-FDLL 239
           HHQ+K+EE PAYALVNPNR DDLSGQGHLCAAGVVFLVLV+I RIL+QDNK+P+  FDLL
Sbjct: 181 HHQMKTEETPAYALVNPNRSDDLSGQGHLCAAGVVFLVLVMICRILQQDNKIPIKYFDLL 240

Query: 240 SLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGY 299
           SLLDLVALATVCDVVPLI LNRAYV KGL+V+R+QGNPGLKALIER+N+S+PITA+NLG+
Sbjct: 241 SLLDLVALATVCDVVPLIDLNRAYVTKGLLVSRKQGNPGLKALIERINLSAPITADNLGF 300

Query: 300 MIGPSINAGGRIGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVL 359
           MIGP INAGGRIGE+NLGSRLLISDD QELE +AMKLDVLNQNRRLMESAMLEQAE +VL
Sbjct: 301 MIGPCINAGGRIGEANLGSRLLISDDPQELEAIAMKLDVLNQNRRLMESAMLEQAEVEVL 360

Query: 360 TQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGF 419
            Q + +QQAS+IVV GD+WHPGIVGLLAARLKEKF RPSFAISF+E GKGIGSGRSIEGF
Sbjct: 361 AQYEHMQQASIIVVAGDQWHPGIVGLLAARLKEKFDRPSFAISFDESGKGIGSGRSIEGF 420

Query: 420 DIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKI 479
           DIGKMVSFA EEGIL+KGGGHAMAAGLTVERVNF RL DFFQ FA+  + +L++ PV KI
Sbjct: 421 DIGKMVSFAFEEGILLKGGGHAMAAGLTVERVNFNRLRDFFQAFANKRMSSLVSMPVLKI 480

Query: 480 DGVLNASAVNIALIDMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSE 539
           DG LNASAVNI LI+MLESAGPYG+GNP PVFAFP+HKL+++R+V L HLQMTF+SQDSE
Sbjct: 481 DGALNASAVNIKLIEMLESAGPYGSGNPRPVFAFPSHKLENVRIVKLNHLQMTFKSQDSE 540

Query: 540 TLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVEGH 595
            LQ IAFRVYGTPLGEFLMQS GK MHV GHLCVN+WRGSKR QLRVLDA+PVE H
Sbjct: 541 VLQGIAFRVYGTPLGEFLMQSHGKWMHVIGHLCVNHWRGSKRAQLRVLDAAPVENH 596


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085813|ref|YP_002544343.1| single-stranded-DNA-specific exonuclease protein [Agrobacterium radiobacter K84] Length = 604 Back     alignment and organism information
>gi|327190809|gb|EGE57877.1| single-stranded-DNA-specific exonuclease protein [Rhizobium etli CNPAF512] Length = 600 Back     alignment and organism information
>gi|209549146|ref|YP_002281063.1| single-stranded-DNA-specific exonuclease RecJ [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 600 Back     alignment and organism information
>gi|86357505|ref|YP_469397.1| single-stranded-DNA-specific exonuclease protein [Rhizobium etli CFN 42] Length = 600 Back     alignment and organism information
>gi|241204470|ref|YP_002975566.1| single-stranded-DNA-specific exonuclease RecJ [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 600 Back     alignment and organism information
>gi|325292975|ref|YP_004278839.1| single-stranded-DNA-specific exonuclease [Agrobacterium sp. H13-3] Length = 602 Back     alignment and organism information
>gi|190891568|ref|YP_001978110.1| single-stranded-DNA-specific exonuclease [Rhizobium etli CIAT 652] Length = 600 Back     alignment and organism information
>gi|15888900|ref|NP_354581.1| single-stranded-DNA-specific exonuclease [Agrobacterium tumefaciens str. C58] Length = 602 Back     alignment and organism information
>gi|116251859|ref|YP_767697.1| single-stranded-DNA-specific exonuclease [Rhizobium leguminosarum bv. viciae 3841] Length = 586 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target600 single-stranded-DNA-specific exonuclease protein [Candi
TIGR00644539 TIGR00644, recJ, single-stranded-DNA-specific exonuclea 1e-153
PRK11070575 PRK11070, PRK11070, ssDNA exonuclease RecJ; Provisional 3e-79
COG0608491 COG0608, RecJ, Single-stranded DNA-specific exonuclease 1e-101
pfam01368156 pfam01368, DHH, DHH family 7e-31
COG1107715 COG1107, COG1107, Archaea-specific RecJ-like exonucleas 2e-06
COG0618332 COG0618, COG0618, Exopolyphosphatase-related proteins [ 5e-05
pfam0227269 pfam02272, DHHA1, DHHA1 domain 3e-05
pfam01784238 pfam01784, NIF3, NIF3 (NGG1p interacting factor 3) 0.003
>gnl|CDD|161976 TIGR00644, recJ, single-stranded-DNA-specific exonuclease RecJ Back     alignment and domain information
>gnl|CDD|182944 PRK11070, PRK11070, ssDNA exonuclease RecJ; Provisional Back     alignment and domain information
>gnl|CDD|30953 COG0608, RecJ, Single-stranded DNA-specific exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|144819 pfam01368, DHH, DHH family Back     alignment and domain information
>gnl|CDD|31304 COG1107, COG1107, Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|30963 COG0618, COG0618, Exopolyphosphatase-related proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|145431 pfam02272, DHHA1, DHHA1 domain Back     alignment and domain information
>gnl|CDD|145115 pfam01784, NIF3, NIF3 (NGG1p interacting factor 3) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 600 single-stranded-DNA-specific exonuclease protein [Candi
TIGR00644705 recJ single-stranded-DNA-specific exonuclease RecJ; Int 100.0
PRK11070574 ssDNA exonuclease RecJ; Provisional 100.0
COG0608491 RecJ Single-stranded DNA-specific exonuclease [DNA repl 100.0
pfam01368156 DHH DHH family. It is predicted that this family of pro 99.74
PRK02947247 hypothetical protein; Provisional 95.94
COG0052252 RpsB Ribosomal protein S2 [Translation, ribosomal struc 92.34
COG1107715 Archaea-specific RecJ-like exonuclease, contains DnaJ-t 99.48
COG0618332 Exopolyphosphatase-related proteins [General function p 99.26
COG2404339 Predicted phosphohydrolase (DHH superfamily) [General f 98.59
COG3887655 Predicted signaling protein consisting of a modified GG 98.27
TIGR02188643 Ac_CoA_lig_AcsA acetate--CoA ligase; InterPro: IPR01190 92.13
pfam0227269 DHHA1 DHHA1 domain. This domain is often found adjacent 98.12
pfam02724584 CDC45 CDC45-like protein. CDC45 is an essential gene re 96.05
LOAD_cdc45578 consensus 95.58
pfam03345439 DDOST_48kD Oligosaccharyltransferase 48 kDa subunit bet 94.01
PTZ00254242 40S ribosomal protein SA; Provisional 93.15
KOG2475587 consensus 92.06
cd01539303 PBP1_GGBP Periplasmic glucose/galactose-binding protein 91.36
cd00079131 HELICc Helicase superfamily c-terminal domain; associat 90.62
PRK13936197 phosphoheptose isomerase; Provisional 90.21
PRK05427311 putative manganese-dependent inorganic pyrophosphatase; 90.11
cd0449283 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB folds si 95.87
cd0448978 ExoVII_LU_OBF ExoVII_LU_OBF: A subfamily of OB folds co 95.25
KOG3108 265 consensus 92.37
PRK00286443 xseA exodeoxyribonuclease VII large subunit; Reviewed 95.73
TIGR03316357 ygeW probable carbamoyltransferase YgeW. Members of thi 94.8
PRK11840327 bifunctional sulfur carrier protein/thiazole synthase p 93.95
PRK07200395 aspartate/ornithine carbamoyltransferase family protein 90.56
CHL00162267 thiG thiamin biosynthesis protein G; Validated 94.72
PRK00208256 thiG thiazole synthase; Reviewed 94.38
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme 94.17
pfam05690246 ThiG Thiazole biosynthesis protein ThiG. This family co 93.97
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthesis [N 93.39
TIGR00486325 TIGR00486 conserved hypothetical protein TIGR00486; Int 93.88
PRK13480314 3'-5' exoribonuclease YhaM; Provisional 93.71
COG1570440 XseA Exonuclease VII, large subunit [DNA replication, r 93.42
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 92.78
pfam06506169 PrpR_N Propionate catabolism activator. This domain is 90.29
PRK00252864 alaS alanyl-tRNA synthetase; Reviewed 90.63
>TIGR00644 recJ single-stranded-DNA-specific exonuclease RecJ; InterPro: IPR004610 All proteins in this family are 5'-3' single-strand DNA exonucleases Back     alignment and domain information
>PRK11070 ssDNA exonuclease RecJ; Provisional Back     alignment and domain information
>COG0608 RecJ Single-stranded DNA-specific exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam01368 DHH DHH family Back     alignment and domain information
>PRK02947 hypothetical protein; Provisional Back     alignment and domain information
>COG0052 RpsB Ribosomal protein S2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0618 Exopolyphosphatase-related proteins [General function prediction only] Back     alignment and domain information
>COG2404 Predicted phosphohydrolase (DHH superfamily) [General function prediction only] Back     alignment and domain information
>COG3887 Predicted signaling protein consisting of a modified GGDEF domain and a DHH domain [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02188 Ac_CoA_lig_AcsA acetate--CoA ligase; InterPro: IPR011904 Acetyl-CoA synthetase (also known as acetate-CoA ligase and acetyl-activating enzyme) is a ubiquitous enzyme, found in both prokaryotes and eukaryotes, which catalyses the formation of acetyl-CoA from acetate, coenzyme A (CoA) and ATP as shown below : ATP + acetate + CoA = AMP + diphosphate + acetyl-CoA The activity of this enzyme is crucial for maintaining the required levels of acetyl-CoA, a key intermediate in many important biosynthetic and catabolic processes Back     alignment and domain information
>pfam02272 DHHA1 DHHA1 domain Back     alignment and domain information
>pfam02724 CDC45 CDC45-like protein Back     alignment and domain information
>LOAD_cdc45 consensus Back     alignment and domain information
>pfam03345 DDOST_48kD Oligosaccharyltransferase 48 kDa subunit beta Back     alignment and domain information
>PTZ00254 40S ribosomal protein SA; Provisional Back     alignment and domain information
>KOG2475 consensus Back     alignment and domain information
>cd01539 PBP1_GGBP Periplasmic glucose/galactose-binding protein (GGBP) involved in chemotaxis towards, and active transport of, glucose and galactose in various bacterial species Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK13936 phosphoheptose isomerase; Provisional Back     alignment and domain information
>PRK05427 putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>cd04492 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB folds similar to that found in Bacillus subtilis YhaM and Staphylococcus aureus cmp-binding factor-1 (SaCBF1) Back     alignment and domain information
>cd04489 ExoVII_LU_OBF ExoVII_LU_OBF: A subfamily of OB folds corresponding to the N-terminal OB-fold domain of Escherichia coli exodeoxyribonuclease VII (ExoVII) large subunit Back     alignment and domain information
>KOG3108 consensus Back     alignment and domain information
>PRK00286 xseA exodeoxyribonuclease VII large subunit; Reviewed Back     alignment and domain information
>TIGR03316 ygeW probable carbamoyltransferase YgeW Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>PRK07200 aspartate/ornithine carbamoyltransferase family protein; Validated Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>pfam05690 ThiG Thiazole biosynthesis protein ThiG Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00486 TIGR00486 conserved hypothetical protein TIGR00486; InterPro: IPR002678 This family contains several NIF3 (NGG1p interacting factor 3) protein homologues Back     alignment and domain information
>PRK13480 3'-5' exoribonuclease YhaM; Provisional Back     alignment and domain information
>COG1570 XseA Exonuclease VII, large subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY; InterPro: IPR004390 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>pfam06506 PrpR_N Propionate catabolism activator Back     alignment and domain information
>PRK00252 alaS alanyl-tRNA synthetase; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target600 single-stranded-DNA-specific exonuclease protein [Candi
2zxo_A 666 Crystal Structure Of Recj From Thermus Thermophilus 1e-57
1ir6_A424 Crystal Structure Of Exonuclease Recj Bound To Mang 2e-49
gi|283135302|pdb|2ZXO|A Chain A, Crystal Structure Of Recj From Thermus Thermophilus Hb8 Length = 666 Back     alignment and structure
 Score =  229 bits (583), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 133/505 (26%), Positives = 216/505 (42%), Gaps = 44/505 (8%)

Query: 91  NSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGA 150
             ++I + GDYD DG    A+++R L+    + + +IP R+ +GYG     + + +   +
Sbjct: 71  QGKRIRVHGDYDADGLTGTAILVRGLAALGADVHPFIPHRLEEGYGVLMERVPEHLE-AS 129

Query: 151 QLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLC 210
            L +TVDCG T++  L+     G++VIV DHH       P   +      D    +    
Sbjct: 130 DLFLTVDCGITNHAELRELLENGVEVIVTDHHTPGKTPPPGLVVHPALTPD---LKEKPT 186

Query: 211 AAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMV 270
            AGV FL+L  ++  L            L   DL A+ T+ DV PL G NRA V +GL  
Sbjct: 187 GAGVAFLLLWALHERLGL-------PPPLEYADLAAVGTIADVAPLWGWNRALVKEGLAR 239

Query: 271 ARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELE 330
                  GL+ L E V  +       + + I P INA  R+GE+    RLL++DD+ E +
Sbjct: 240 IPASSWVGLRLLAEAVGYTGKAVE--VAFRIAPRINAASRLGEAEKALRLLLTDDAAEAQ 297

Query: 331 MLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARL 390
            L  +L  LN  R+ +E AML +   +         +A  IV+     HPG++G++A+R+
Sbjct: 298 ALVGELHRLNARRQTLEEAMLRKLLPQA------DPEAKAIVLLDPEGHPGVMGIVASRI 351

Query: 391 KEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVER 450
            E   RP F ++        G G       I  + +    E +L++ GGH  AAG  ++ 
Sbjct: 352 LEATLRPVFLVAQ-------GKGTVRSLAPISAVEALRSAEDLLLRYGGHKEAAGFAMDE 404

Query: 451 VNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDMLESAGPYGAGNPNPV 510
             F       + +A      +    +  +   L    +   +   L    PYG GNP P+
Sbjct: 405 ALFPAFKARVEAYAARFPDPVREVALLDL---LPEPGLLPQVFRELALLEPYGEGNPEPL 461

Query: 511 FAFPNHKLQSIRVVNL-AHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTG 569
           F       +  R +    HL    +      ++ +A++     L           + V G
Sbjct: 462 FLLFGAP-EEARRLGEGRHLAFRLKG-----VRVLAWKQGDLALPP--------EVEVAG 507

Query: 570 HLCVNYWRGSKRCQLRVLDASPVEG 594
            L  N W G    +++ +D    E 
Sbjct: 508 LLSENAWNGHLAYEVQAVDLRKPEA 532


>gi|21465637|pdb|1IR6|A Chain A, Crystal Structure Of Exonuclease Recj Bound To Manganese Length = 424 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target600 single-stranded-DNA-specific exonuclease protein [Candi
2zxr_A 666 Single-stranded DNA specific exonuclease RECJ; DNA repa 1e-119
3dma_A343 Exopolyphosphatase-related protein; structural genomics 1e-18
3dev_A320 SH1221; alpha-beta protein., structural genomics, PSI-2 4e-12
3dev_A320 SH1221; alpha-beta protein., structural genomics, PSI-2 1e-05
>2zxr_A Single-stranded DNA specific exonuclease RECJ; DNA repair, hydrolase; 2.15A {Thermus thermophilus} PDB: 2zxo_A 2zxp_A 1ir6_A Length = 666 Back     alignment and structure
 Score =  423 bits (1088), Expect = e-119
 Identities = 151/578 (26%), Positives = 252/578 (43%), Gaps = 51/578 (8%)

Query: 16  FRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLIL 75
            RW  +L    + +   +     +    A    +R       K+ L+P + LL      L
Sbjct: 5   VRWR-VLSLPPLAQWREVMAALEVGPEAALAYWHRGFR---RKEDLDPPLALLP-----L 55

Query: 76  TDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGY 135
               +AA  + +A+   ++I + GDYD DG    A+++R L+    + + +IP R+ +GY
Sbjct: 56  KGLREAAALLEEALRQGKRIRVHGDYDADGLTGTAILVRGLAALGADVHPFIPHRLEEGY 115

Query: 136 GPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALV 195
           G     + + + E + L +TVDCG T++  L+     G++VIV DHH    +  P   +V
Sbjct: 116 GVLMERVPEHL-EASDLFLTVDCGITNHAELRELLENGVEVIVTDHHTP-GKTPPPGLVV 173

Query: 196 NPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDVVP 255
           +P    DL  +     AGV F        +L   ++       L   DL A+ T+ DV P
Sbjct: 174 HPALTPDL--KEKPTGAGVAF-------LLLWALHERLGLPPPLEYADLAAVGTIADVAP 224

Query: 256 LIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESN 315
           L G NRA V +GL         GL+ L E V       A  + + I P INA  R+GE+ 
Sbjct: 225 LWGWNRALVKEGLARIPASSWVGLRLLAEAVGY--TGKAVEVAFRIAPRINAASRLGEAE 282

Query: 316 LGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEG 375
              RLL++DD+ E + L  +L  LN  R+ +E AML +             +A  IV+  
Sbjct: 283 KALRLLLTDDAAEAQALVGELHRLNARRQTLEEAMLRKL------LPQADPEAKAIVLLD 336

Query: 376 DRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILV 435
              HPG++G++A+R+ E   RP F ++     +G G+ RS+      + +  A +  +L+
Sbjct: 337 PEGHPGVMGIVASRILEATLRPVFLVA-----QGKGTVRSLAPISAVEALRSAED--LLL 389

Query: 436 KGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALIDM 495
           + GGH  AAG  ++   F       + +A      +       +  +L    +   +   
Sbjct: 390 RYGGHKEAAGFAMDEALFPAFKARVEAYAARFPDPVREV---ALLDLLPEPGLLPQVFRE 446

Query: 496 LESAGPYGAGNPNPVFAFPNHKLQSIRVVNLAHLQMTFESQDSETLQAIAFRVYGTPLGE 555
           L    PYG GNP P+F       ++ R+    HL    +      ++ +A++     L  
Sbjct: 447 LALLEPYGEGNPEPLFLLFGAPEEARRLGEGRHLAFRLKG-----VRVLAWKQGDLAL-- 499

Query: 556 FLMQSRGKRMHVTGHLCVNYWRGSKRCQLRVLDASPVE 593
                    + V G L  N W G    +++ +D    E
Sbjct: 500 ------PPEVEVAGLLSENAWNGHLAYEVQAVDLRKPE 531


>3dma_A Exopolyphosphatase-related protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.25A {Bacteroides fragilis} Length = 343 Back     alignment and structure
>3dev_A SH1221; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.10A {Staphylococcus haemolyticus JCSC1435} Length = 320 Back     alignment and structure
>3dev_A SH1221; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.10A {Staphylococcus haemolyticus JCSC1435} Length = 320 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target600 single-stranded-DNA-specific exonuclease protein [Candi
2zxr_A 666 Single-stranded DNA specific exonuclease RECJ; DNA repa 100.0
3dev_A320 SH1221; alpha-beta protein., structural genomics, PSI-2 99.89
3dma_A343 Exopolyphosphatase-related protein; structural genomics 99.77
1wpn_A188 Manganese-dependent inorganic pyrophosphatase; metal bi 97.8
2haw_A309 Manganese-dependent inorganic pyrophosphatase; substrat 97.69
1k20_A310 Manganese-dependent inorganic pyrophosphatase; family I 96.57
2eb0_A307 Manganese-dependent inorganic pyrophosphatase; DHH doma 95.93
1nri_A306 Hypothetical protein HI0754; structural genomics, PSI, 95.4
3kdf_D132 Replication protein A 32 kDa subunit; wheat GERM cell f 95.58
2pi2_A 270 Replication protein A 32 kDa subunit; FULL-length RPA14 94.02
3kf6_A159 Protein STN1; OB fold, chromosomal protein, DNA-binding 93.93
2i2w_A212 Phosphoheptose isomerase; lipopolysaccharide biosynthes 95.39
1iuk_A140 Hypothetical protein TT1466; structural genomics, riken 93.27
2yva_A196 DNAA initiator-associating protein DIAA; intermolecular 92.14
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosynthesi 91.29
1xm3_A264 Thiazole biosynthesis protein THIG; structural genomics 90.84
2zvf_A171 Alanyl-tRNA synthetase; C-terminal, oligomerization dom 94.0
1nmo_A247 Hypothetical protein YBGI; toroidal structure, structur 90.9
>2zxr_A Single-stranded DNA specific exonuclease RECJ; DNA repair, hydrolase; 2.15A {Thermus thermophilus} PDB: 2zxo_A 2zxp_A 1ir6_A Back     alignment and structure
Probab=100.00  E-value=0  Score=1136.46  Aligned_cols=532  Identities=28%  Similarity=0.421  Sum_probs=480.8

Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHCCCCHHHHHHHCCCCHHHCCCCHHHCCCHHHHHHHHHHHHHCCC
Q ss_conf             88734115788898899999988199999999999678897898866196677718995561487999999999997799
Q gi|254780901|r   14 SGFRWVSLLGQEGINRALAITQKHAIPDIVARVLVNRNVSIDYAKDFLNPSIRLLMPDPLILTDCDKAARRIVQAIYNSE   93 (600)
Q Consensus        14 ~~~rW~~~~~~~~~~~~~~l~~~~~~~~~~a~iL~~Rgi~~~~~~~fL~p~l~~l~~dP~~l~dm~~A~~ri~~ai~~~e   93 (600)
                      +..||+..+. +..+.+..+++++|+|+++|++|++|||+..   ++|+|.+     +|+.|+||++||+||.+||+++|
T Consensus         3 ~~~rW~~~~~-~~~~~~~~l~~~~~i~~~~a~~L~~Rgi~~~---e~l~p~l-----~~~~l~dm~~Av~ri~~Ai~~~e   73 (666)
T 2zxr_A            3 DRVRWRVLSL-PPLAQWREVMAALEVGPEAALAYWHRGFRRK---EDLDPPL-----ALLPLKGLREAAALLEEALRQGK   73 (666)
T ss_dssp             TTEEEEECCC-CCHHHHHHHHHHHTCCHHHHHHHHHTTCCSG---GGTSCCC-----CCCCCTTHHHHHHHHHHHHHTTC
T ss_pred             CCCEEEECCC-CCHHHHHHHHHHCCCCHHHHHHHHHCCCCCH---HHHCCCC-----CCCCCCCHHHHHHHHHHHHHCCC
T ss_conf             7863656699-9889999999981979999999996799997---8959554-----43774489999999999997699


Q ss_pred             CEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHCC
Q ss_conf             79999407886152899999999976994799807874336688978988742026868999648876234555554179
Q gi|254780901|r   94 KIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQG  173 (600)
Q Consensus        94 kI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~LiItvD~Gi~~~e~i~~a~~~G  173 (600)
                      ||+|||||||||+||||||+++|+.+|++|.||||||++||||+|.+.++++++ |++|||||||||+++++|++|+++|
T Consensus        74 kI~I~GDYDvDGiTStaIL~~~L~~lg~~v~~yIP~R~~eGYGl~~~~i~~~~e-g~~LiITvDcGi~a~e~i~~a~~~G  152 (666)
T 2zxr_A           74 RIRVHGDYDADGLTGTAILVRGLAALGADVHPFIPHRLEEGYGVLMERVPEHLE-ASDLFLTVDCGITNHAELRELLENG  152 (666)
T ss_dssp             EEEEECCSSHHHHHHHHHHHHHHHHTTCEEEECCC---------------------CCEEEESCCC--------------
T ss_pred             EEEEEEECCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHHH-CCCEEEEECCCCCCHHHHHHHHHCC
T ss_conf             899997468416899999999999889965998889765688869999999860-8998999648823399999888679


Q ss_pred             CCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCC
Q ss_conf             82799615447655567256523788886433443047889999999999970214887640779999999877542011
Q gi|254780901|r  174 IDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATVCDV  253 (600)
Q Consensus       174 idvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~~l~~~~~~~~~~~l~~~ldlvaiGTvaD~  253 (600)
                      |||||||||+| ++.|++.++|||++.++  ++++||||||||||++++.+.++..       ++.+|||||||||||||
T Consensus       153 idvIVtDHH~p-~~~p~~~~iinp~~~~~--~~~~L~GaGVafkl~~~l~~~~~~~-------~~~~~ldLvalgTIADv  222 (666)
T 2zxr_A          153 VEVIVTDHHTP-GKTPPPGLVVHPALTPD--LKEKPTGAGVAFLLLWALHERLGLP-------PPLEYADLAAVGTIADV  222 (666)
T ss_dssp             CEEEEECCCC---------CEECGGGSTT--CCCCCCHHHHHHHHHHHHHHHTTCC-------CCGGGHHHHHHHHHHTT
T ss_pred             CEEEEECCCCC-CCCCCCCEEECCCCCCC--CCCCCCHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHCCC
T ss_conf             98999498999-87788757975676676--5333404589999999975511220-------18999889866651032


Q ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHCCHHHHHCCCCCCCEEEECCCHHHHHHHH
Q ss_conf             11444118999987887751688743578987088864242345666774306233312122221002034258999999
Q gi|254780901|r  254 VPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRIGESNLGSRLLISDDSQELEMLA  333 (600)
Q Consensus       254 vpL~~eNR~lvk~GL~~l~~~~~~gl~~L~~~~~~~~~i~~~di~f~iaPrINAaGRl~~a~~av~lL~~~d~~~a~~la  333 (600)
                      |||.+|||+||++||+.+++++|+|+++|++.++.+  +++.||||.|||||||+|||++|+.+++||+++|+.+|..+|
T Consensus       223 vpL~~eNR~lVk~GL~~l~~~~~~gl~~L~~~~~~~--~~~~dIgF~IaPrINAaGRl~~a~~av~LLls~d~~~a~~la  300 (666)
T 2zxr_A          223 APLWGWNRALVKEGLARIPASSWVGLRLLAEAVGYT--GKAVEVAFRIAPRINAASRLGEAEKALRLLLTDDAAEAQALV  300 (666)
T ss_dssp             CCCSHHHHHHHHHHHHHGGGCSSHHHHHHHHHTTCC--SCHHHHHHTHHHHHHHHHHTTCHHHHHHHHHCCCHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCC--CCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHCCCHHHHHHHH
T ss_conf             364267899998746654224540478874322127--867786777765533545444244544555137889999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHCEEEEEEECCCCEEEEEE
Q ss_conf             99998999999999999999999987521124347502620578581222222789988420107998863798379998
Q gi|254780901|r  334 MKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSG  413 (600)
Q Consensus       334 ~~L~~lN~~Rk~~e~~i~~~a~~~~~~~~~~~~~~~~ivv~~~~wh~GViGIVAsrL~e~y~kP~iv~s~~~dg~~kGS~  413 (600)
                      .+|+++|++||++|+++++++.++.      .++.++||+++++||+||+|||||||+|+|+|||||++.     .|||+
T Consensus       301 ~~L~~lN~~Rk~ie~~i~~ea~~~~------~~~~~~ivl~~~~wh~GViGIVAsRL~e~y~rP~iVls~-----~kGS~  369 (666)
T 2zxr_A          301 GELHRLNARRQTLEEAMLRKLLPQA------DPEAKAIVLLDPEGHPGVMGIVASRILEATLRPVFLVAQ-----GKGTV  369 (666)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTTSS------CTTCSSEEEECTTCCHHHHHHHHHHHHHHHCSCEEEEET-----TEEEE
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH------HCCCCEEEEECCCCCCCHHHHHHHHHHHHCCCCEEEEEC-----CEEEE
T ss_conf             9998889999999999999987654------135637999878776116889999999863897899976-----63888


Q ss_pred             ECCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCHHHHHHHHHHHHHHHCCHHHCCCCEEEEEEECHHHCCHHHH
Q ss_conf             64898618888885303353011565322231464222158899999999986226443377147604434689799999
Q gi|254780901|r  414 RSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKIDGVLNASAVNIALI  493 (600)
Q Consensus       414 RSi~g~~l~~~l~~~~~~~ll~~~GGH~~AaG~ti~~~~l~~f~~~l~~~~~~~~~~~~~~~~l~iD~el~~~~i~~~l~  493 (600)
                      ||++|||++++|..|++  +|.+||||+||||||++++++++|++++++++.+...   ..+.+.+|.++++++++.+++
T Consensus       370 RSi~g~~l~~aL~~~~~--lL~~fGGH~~AAG~sl~~~~l~~F~~~l~~~~~~~~~---~~~~~~~dd~l~~~~i~~~l~  444 (666)
T 2zxr_A          370 RSLAPISAVEALRSAED--LLLRYGGHKEAAGFAMDEALFPAFKARVEAYAARFPD---PVREVALLDLLPEPGLLPQVF  444 (666)
T ss_dssp             ECCTTCCHHHHHHHTGG--GCSEEEECSSEEEEECCGGGHHHHHHHHHHHHHTSCC---CCEEEEECEECCCGGGHHHHH
T ss_pred             ECCCCCCHHHHHHHHHH--HHHHCCCHHHCCCCEECHHHHHHHHHHHHHHHHHCCC---CCCCHHEEEECCCCCCHHHHH
T ss_conf             78887683889976655--6652796331672367652159999999999985430---012200110037030229999


Q ss_pred             HHHHHCCCCCCCCCCCEEEECCEEEEEEEEECC-CEEEEEEECCCCCEEEEEEECCCCCCHHHHHHCCCCCEEEEEEEEE
Q ss_conf             999851846789998468427809988888479-6499999849987799999778787012355306998799999976
Q gi|254780901|r  494 DMLESAGPYGAGNPNPVFAFPNHKLQSIRVVNL-AHLQMTFESQDSETLQAIAFRVYGTPLGEFLMQSRGKRMHVTGHLC  572 (600)
Q Consensus       494 ~~L~~lePFG~gNpeP~F~~~~~~i~~~r~vGk-~Hlkl~l~~~~g~~i~aI~Fn~~~~~~~~~~~~~~g~~idii~~l~  572 (600)
                      ++|++|+|||+|||+|+|+++++.+ +.+.+|+ +|+||.++     .+++||||+.+.        ..+..+|++|+|+
T Consensus       445 ~~L~~LePFG~gNp~P~F~~~~~~~-~~~~vg~gkHlkl~l~-----~~~aI~F~~~~~--------~~~~~vdi~~~l~  510 (666)
T 2zxr_A          445 RELALLEPYGEGNPEPLFLLFGAPE-EARRLGEGRHLAFRLK-----GVRVLAWKQGDL--------ALPPEVEVAGLLS  510 (666)
T ss_dssp             HHHGGGCSCSSSSCCCCEEEEECCE-EEEESSSSSEEEEEET-----TEEEEEECCSSC--------SCCSSEEEEEEEE
T ss_pred             HHHHHCCCCCCCCCCCEEEECCCEE-EEEEECCCCEEEEEEE-----CCCEEEECCCCC--------CCCCEEEEEEEEE
T ss_conf             9999639888999986798338589-9878627847999995-----788899889765--------7798799999974


Q ss_pred             EEEECCCCEEEEEEEEEEECCCCCC
Q ss_conf             6545781105899998011131126
Q gi|254780901|r  573 VNYWRGSKRCQLRVLDASPVEGHHF  597 (600)
Q Consensus       573 ~N~~~G~~s~QL~I~Di~p~e~~~~  597 (600)
                      +|+|+|++++||+|+|||+.++...
T Consensus       511 ~N~w~G~~~~QL~I~Dir~~~~~~~  535 (666)
T 2zxr_A          511 ENAWNGHLAYEVQAVDLRKPEALEG  535 (666)
T ss_dssp             EEEETTEEEEEEEEEEEESCCCCBC
T ss_pred             EEEECCEEEEEEEEEEECCCCCCCC
T ss_conf             7877997559999998067654002



>3dev_A SH1221; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.10A {Staphylococcus haemolyticus JCSC1435} Back     alignment and structure
>3dma_A Exopolyphosphatase-related protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.25A {Bacteroides fragilis} Back     alignment and structure
>1wpn_A Manganese-dependent inorganic pyrophosphatase; metal binding, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.107.1.1 Back     alignment and structure
>2haw_A Manganese-dependent inorganic pyrophosphatase; substrate complex, hydrolase; HET: 1PE PG4; 1.75A {Bacillus subtilis} SCOP: c.107.1.1 PDB: 1k23_A* 1wpm_A* 2iw4_A* Back     alignment and structure
>1k20_A Manganese-dependent inorganic pyrophosphatase; family II ppase, binuclear metal centre, hydrolase; 1.50A {Streptococcus gordonii} SCOP: c.107.1.1 PDB: 1wpp_A 2enx_A* 1i74_A Back     alignment and structure
>2eb0_A Manganese-dependent inorganic pyrophosphatase; DHH domain, DHHA2 domain, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>1nri_A Hypothetical protein HI0754; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 1.90A {Haemophilus influenzae} SCOP: c.80.1.3 Back     alignment and structure
>3kdf_D Replication protein A 32 kDa subunit; wheat GERM cell free, protein complex, center for eukaryotic structural genomics, PSI; HET: MSE; 1.98A {Homo sapiens} PDB: 2pqa_A 1quq_A 1l1o_B Back     alignment and structure
>2pi2_A Replication protein A 32 kDa subunit; FULL-length RPA14/32, ssDNA binding protein, OB-fold, dioxane, DNA binding protein; 2.00A {Homo sapiens} SCOP: b.40.4.3 PDB: 2z6k_A 1dpu_A 1z1d_A Back     alignment and structure
>3kf6_A Protein STN1; OB fold, chromosomal protein, DNA-binding, nucleus, telomere; 1.65A {Schizosaccharomyces pombe} Back     alignment and structure
>2i2w_A Phosphoheptose isomerase; lipopolysaccharide biosynthesis; 1.95A {Escherichia coli} PDB: 2i22_A 1x94_A Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>2yva_A DNAA initiator-associating protein DIAA; intermolecular disulfide bonding, putative phosphosugar binding protein, DNAA binding protein; 1.85A {Escherichia coli} Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A Back     alignment and structure
>2zvf_A Alanyl-tRNA synthetase; C-terminal, oligomerization domain, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding; 3.20A {Archaeoglobus fulgidus} Back     alignment and structure
>1nmo_A Hypothetical protein YBGI; toroidal structure, structure 2 function project, S2F, structural genomics, unknown functio; 2.20A {Escherichia coli} SCOP: c.135.1.1 PDB: 1nmp_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 600 single-stranded-DNA-specific exonuclease protein [Candi
d1ir6a_385 c.107.1.2 (A:) Exonuclease RecJ {Thermus thermophilus [ 1e-63
>d1ir6a_ c.107.1.2 (A:) Exonuclease RecJ {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: DHH phosphoesterases
superfamily: DHH phosphoesterases
family: Exonuclease RecJ
domain: Exonuclease RecJ
species: Thermus thermophilus [TaxId: 274]
 Score =  237 bits (606), Expect = 1e-63
 Identities = 120/410 (29%), Positives = 192/410 (46%), Gaps = 28/410 (6%)

Query: 71  DPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR 130
             L L    +AA  + +A+   ++I + GDYD DG    A+++R L+    + + +IP R
Sbjct: 3   ALLPLKGLREAAALLEEALRQGKRIRVHGDYDADGLTGTAILVRGLAALGADVHPFIPHR 62

Query: 131 IVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP 190
           + +GYG     + + + E + L +TVDCG T++  L+     G++VIV DHH       P
Sbjct: 63  LEEGYGVLMERVPEHL-EASDLFLTVDCGITNHAELRELLENGVEVIVTDHHTPGKTPPP 121

Query: 191 AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATV 250
              +      D    +     AGV FL+L  ++  L            L   DL A+ T+
Sbjct: 122 GLVVHPALTPDL---KEKPTGAGVAFLLLWALHERLGL-------PPPLEYADLAAVGTI 171

Query: 251 CDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGR 310
            DV PL G NRA V +GL         GL+ L E V  +       + + I P INA  R
Sbjct: 172 ADVAPLWGWNRALVKEGLARIPASSWVGLRLLAEAVGYTGKAV--EVAFRIAPRINAASR 229

Query: 311 IGESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASV 370
           +GE+    RLL++DD+ E + L  +L  LN  R+ +E AML +             +A  
Sbjct: 230 LGEAEKALRLLLTDDAAEAQALVGELHRLNARRQTLEEAMLRK------LLPQADPEAKA 283

Query: 371 IVVEGDRWHPGIVGLLAARLKEKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVE 430
           IV+     HPG++G++A+R+ E   RP F ++     +G G+ RS+      + +  A  
Sbjct: 284 IVLLDPEGHPGVMGIVASRILEATLRPVFLVA-----QGKGTVRSLAPISAVEALRSA-- 336

Query: 431 EGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPALITTPVFKID 480
           E +L++ GGH  AAG  ++   F       + +A      +    V  +D
Sbjct: 337 EDLLLRYGGHKEAAGFAMDEALFPAFKARVEAYAARFPDPVR--EVALLD 384


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target600 single-stranded-DNA-specific exonuclease protein [Candi
d1ir6a_385 Exonuclease RecJ {Thermus thermophilus [TaxId: 274]} 100.0
d1wpna_187 Manganese-dependent inorganic pyrophosphatase (family I 97.93
d1k20a_310 Manganese-dependent inorganic pyrophosphatase (family I 96.63
d2pi2a1128 Replication protein A 32 KDa subunit (RPA32) fragment { 95.8
d1x94a_191 Phosphoheptose isomerase GmhA1 {Vibrio cholerae [TaxId: 92.28
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD 90.68
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subtilis [ 90.48
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus [TaxI 91.48
>d1ir6a_ c.107.1.2 (A:) Exonuclease RecJ {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: DHH phosphoesterases
superfamily: DHH phosphoesterases
family: Exonuclease RecJ
domain: Exonuclease RecJ
species: Thermus thermophilus [TaxId: 274]
Probab=100.00  E-value=0  Score=802.87  Aligned_cols=381  Identities=31%  Similarity=0.470  Sum_probs=346.7

Q ss_pred             HHHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCCC
Q ss_conf             55614879999999999977997999940788615289999999997699479980787433668897898874202686
Q gi|254780901|r   72 PLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGAQ  151 (600)
Q Consensus        72 P~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~~  151 (600)
                      ++.|+||++|++||.+||+++|+|+|||||||||+||||||+++|+++|+++.||||+|++||||+|.+.++++.+ +++
T Consensus         4 ~~~l~~m~~A~~~i~~ai~~~e~I~I~gDyD~DGitS~aIl~~~L~~~g~~~~~~Ip~R~~eGyGl~~~~i~~~~~-~~~   82 (385)
T d1ir6a_           4 LLPLKGLREAAALLEEALRQGKRIRVHGDYDADGLTGTAILVRGLAALGADVHPFIPHRLEEGYGVLMERVPEHLE-ASD   82 (385)
T ss_dssp             CCCCTTHHHHHHHHHHHHHTTCEEEEECCSSHHHHHHHHHHHHHHHHTTCEEEEECCCTTTSCSSCCGGGHHHHHT-TCS
T ss_pred             CCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHHH-CCC
T ss_conf             7673589999999999997799799992778606799999999999889975998778665699868999999853-377


Q ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCC
Q ss_conf             89996488762345555541798279961544765556725652378888643344304788999999999997021488
Q gi|254780901|r  152 LIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNK  231 (600)
Q Consensus       152 LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~~l~~~~~  231 (600)
                      |||||||||++++++++++++|+||||||||+| .+.|++.+++||++.+  ++++++|||||||+|++++.+.+...  
T Consensus        83 LiItvD~G~~~~e~i~~~~~~gi~vIv~DHH~~-~~~~~~~~iv~~~~~~--~~~~~~~gaGva~~l~~~l~~~~~~~--  157 (385)
T d1ir6a_          83 LFLTVDCGITNHAELRELLENGVEVIVTDHHTP-GKTPPPGLVVHPALTP--DLKEKPTGAGVAFLLLWALHERLGLP--  157 (385)
T ss_dssp             EEEESSCCTTCGGGHHHHTTSCCEEEEECCSCC-CSSCCSSEEECGGGST--TCCCCCCHHHHHHHHHHHHHHTTTCC--
T ss_pred             EEEEECCCCCCHHHHHHHHHCCCCEECCCCCCC-CCCCCHHHHHCCCCCC--CCHHCCCHHHHHHHHHHHHHHHHHHH--
T ss_conf             699823652203667667632872321465465-6574012121576788--50101302578999999886432442--


Q ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCCCHHHHHHHHHHHCCHHHHH
Q ss_conf             76407799999998775420111144411899998788775168874357898708886424234566677430623331
Q gi|254780901|r  232 VPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARRQGNPGLKALIERVNISSPITAENLGYMIGPSINAGGRI  311 (600)
Q Consensus       232 ~~~~~~l~~~ldlvaiGTvaD~vpL~~eNR~lvk~GL~~l~~~~~~gl~~L~~~~~~~~~i~~~di~f~iaPrINAaGRl  311 (600)
                           ++.+|++|||+|||||||||.++||++|+.||+.+++++++|+++|++..+.+  .+++||+|.|+|||||+|||
T Consensus       158 -----~~~~~l~L~aiGtiaD~~pL~~eNR~lv~~gl~~~~~~~~~g~~~L~~~~~~~--~~~~di~f~i~P~iNA~GRl  230 (385)
T d1ir6a_         158 -----PPLEYADLAAVGTIADVAPLWGWNRALVKEGLARIPASSWVGLRLLAEAVGYT--GKAVEVAFRIAPRINAASRL  230 (385)
T ss_dssp             -----CCGGGHHHHHHHHHHTTCCCSSHHHHHHHHHHHHCTTCSCHHHHHHHHHTTCC--SCSHHHHHTHHHHHHHHHHT
T ss_pred             -----CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCC--CCHHHHHHHHHHHHCCCCCC
T ss_conf             -----20244455456455455401367889987777785114558899997542213--20122111113111333444


Q ss_pred             CCCCCCCEEEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCHHHHHHHHHHHH
Q ss_conf             21222210020342589999999999899999999999999999998752112434750262057858122222278998
Q gi|254780901|r  312 GESNLGSRLLISDDSQELEMLAMKLDVLNQNRRLMESAMLEQAEAKVLTQCDDIQQASVIVVEGDRWHPGIVGLLAARLK  391 (600)
Q Consensus       312 ~~a~~av~lL~~~d~~~a~~la~~L~~lN~~Rk~~e~~i~~~a~~~~~~~~~~~~~~~~ivv~~~~wh~GViGIVAsrL~  391 (600)
                      +++..+++||+++|.+++..++.+|+.+|++||+++++++++|.++..      +...++++++++||+||+|||||||+
T Consensus       231 ~~a~~a~~lL~~~~~~~a~~~a~~l~~~N~~Rk~~~~~i~~~a~~~~~------~~~~~i~~~~~~~~~GviGivAsrl~  304 (385)
T d1ir6a_         231 GEAEKALRLLLTDDAAEAQALVGELHRLNARRQTLEEAMLRKLLPQAD------PEAKAIVLLDPEGHPGVMGIVASRIL  304 (385)
T ss_dssp             TCHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHGGGCC------TTSSSEEEECTTCCHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------CCCCEEEEECCCCCCCHHHHHHHHHH
T ss_conf             431021244441236789999999887777899999999999875430------33515999537766202204589999


Q ss_pred             HHHHCEEEEEEECCCCEEEEEEECCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCHHHHHHHHHHHHHHHCCHH
Q ss_conf             84201079988637983799986489861888888530335301156532223146422215889999999998622644
Q gi|254780901|r  392 EKFGRPSFAISFEEDGKGIGSGRSIEGFDIGKMVSFAVEEGILVKGGGHAMAAGLTVERVNFGRLCDFFQKFAHNIVPAL  471 (600)
Q Consensus       392 e~y~kP~iv~s~~~dg~~kGS~RSi~g~~l~~~l~~~~~~~ll~~~GGH~~AaG~ti~~~~l~~f~~~l~~~~~~~~~~~  471 (600)
                      ++|+||+++++.     .|||+||++|+|+.++|+.|++  +|.+||||++|||||++++++++|+++|++++++..  +
T Consensus       305 ~~~~kP~iv~~~-----~kGS~Rs~~g~~l~~~l~~~~~--~l~~~GGH~~AaG~~i~~~~~~~F~~~l~~~~~~~~--~  375 (385)
T d1ir6a_         305 EATLRPVFLVAQ-----GKGTVRSLAPISAVEALRSAED--LLLRYGGHKEAAGFAMDEALFPAFKARVEAYAARFP--D  375 (385)
T ss_dssp             HHHCSCEEEEET-----TEEEEECCSSCCHHHHHHTTGG--GCSEEEECSSEEEEECCGGGHHHHHHHHHHHHHSSC--C
T ss_pred             HHCCCCEEEEEC-----CEEEEECCCCCCHHHHHHHHHC--HHHCCCCHHHCCEEEECHHHHHHHHHHHHHHHHHCC--C
T ss_conf             972997899966-----7387768999789999998745--301379916704679749899999999999998563--5


Q ss_pred             HCCCCEEEE
Q ss_conf             337714760
Q gi|254780901|r  472 ITTPVFKID  480 (600)
Q Consensus       472 ~~~~~l~iD  480 (600)
                      ..++...+|
T Consensus       376 ~~~~~~~~d  384 (385)
T d1ir6a_         376 PVREVALLD  384 (385)
T ss_dssp             TTTTCCSTT
T ss_pred             CCCHHHHCC
T ss_conf             322044247



>d1wpna_ c.107.1.1 (A:) Manganese-dependent inorganic pyrophosphatase (family II) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1k20a_ c.107.1.1 (A:) Manganese-dependent inorganic pyrophosphatase (family II) {Streptococcus gordonii [TaxId: 1302]} Back     information, alignment and structure
>d2pi2a1 b.40.4.3 (A:44-171) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x94a_ c.80.1.3 (A:) Phosphoheptose isomerase GmhA1 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 600 single-stranded-DNA-specific exonuclease protein [
2zxr_A_49-242194 (A:49-242) Single-stranded DNA specific exonucleas 2e-39
3dev_A_1-196196 (A:1-196) SH1221; alpha-beta protein., structural 5e-30
3dma_A_1-214214 (A:1-214) Exopolyphosphatase-related protein; stru 1e-25
2eb0_A_1-191191 (A:1-191) Manganese-dependent inorganic pyrophosph 4e-19
2zxr_A_327-42296 (A:327-422) Single-stranded DNA specific exonuclea 1e-22
2zxr_A_1-48_423-534160 (A:1-48,A:423-534) Single-stranded DNA specific ex 3e-22
2zxr_A_243-32684 (A:243-326) Single-stranded DNA specific exonuclea 5e-20
2haw_A_1-192192 (A:1-192) Manganese-dependent inorganic pyrophosph 1e-04
1wpn_A_188 (A:) Manganese-dependent inorganic pyrophosphatase 1e-04
>2zxr_A (A:49-242) Single-stranded DNA specific exonuclease RECJ; DNA repair, hydrolase; 2.15A {Thermus thermophilus} PDB: 2zxo_A 2zxp_A 1ir6_ALength = 194 Back     alignment and structure
 Score =  158 bits (400), Expect = 2e-39
 Identities = 65/198 (32%), Positives = 100/198 (50%), Gaps = 11/198 (5%)

Query: 71  DPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDR 130
             L L    +AA  + +A+   ++I + GDYD DG    A+++R L+    + + +IP R
Sbjct: 3   ALLPLKGLREAAALLEEALRQGKRIRVHGDYDADGLTGTAILVRGLAALGADVHPFIPHR 62

Query: 131 IVDGYGPNPSLMEKFINEGAQLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIP 190
           + +GYG     + + + E + L +TVDCG T++  L+     G++VIV DHH    +  P
Sbjct: 63  LEEGYGVLMERVPEHL-EASDLFLTVDCGITNHAELRELLENGVEVIVTDHHTP-GKTPP 120

Query: 191 AYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDNKVPLNFDLLSLLDLVALATV 250
              +V+P    DL        AGV FL+L  ++  L            L   DL A+ T+
Sbjct: 121 PGLVVHPALTPDLK--EKPTGAGVAFLLLWALHERLGLP-------PPLEYADLAAVGTI 171

Query: 251 CDVVPLIGLNRAYVVKGL 268
            DV PL G NRA V +GL
Sbjct: 172 ADVAPLWGWNRALVKEGL 189


>3dev_A (A:1-196) SH1221; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.10A {Staphylococcus haemolyticus JCSC1435}Length = 196 Back     alignment and structure
>3dma_A (A:1-214) Exopolyphosphatase-related protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.25A {Bacteroides fragilis}Length = 214 Back     alignment and structure
>2eb0_A (A:1-191) Manganese-dependent inorganic pyrophosphatase; DHH domain, DHHA2 domain, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661}Length = 191 Back     alignment and structure
>2zxr_A (A:327-422) Single-stranded DNA specific exonuclease RECJ; DNA repair, hydrolase; 2.15A {Thermus thermophilus} PDB: 2zxo_A 2zxp_A 1ir6_ALength = 96 Back     alignment and structure
>2zxr_A (A:1-48,A:423-534) Single-stranded DNA specific exonuclease RECJ; DNA repair, hydrolase; 2.15A {Thermus thermophilus} PDB: 2zxo_A 2zxp_A 1ir6_ALength = 160 Back     alignment and structure
>2zxr_A (A:243-326) Single-stranded DNA specific exonuclease RECJ; DNA repair, hydrolase; 2.15A {Thermus thermophilus} PDB: 2zxo_A 2zxp_A 1ir6_ALength = 84 Back     alignment and structure
>2haw_A (A:1-192) Manganese-dependent inorganic pyrophosphatase; substrate complex, hydrolase; HET: 1PE PG4; 1.75A {Bacillus subtilis}Length = 192 Back     alignment and structure
>1wpn_A (A:) Manganese-dependent inorganic pyrophosphatase; metal binding, hydrolase; 1.30A {Bacillus subtilis}Length = 188 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target600 single-stranded-DNA-specific exonuclease protein [Candi
2zxr_A_49-242194 Single-stranded DNA specific exonuclease RECJ; DNA 99.96
3dma_A_1-214214 Exopolyphosphatase-related protein; structural gen 99.81
3dev_A_1-196196 SH1221; alpha-beta protein., structural genomics, 99.77
2eb0_A_1-191191 Manganese-dependent inorganic pyrophosphatase; DHH 99.6
2haw_A_1-192192 Manganese-dependent inorganic pyrophosphatase; sub 98.82
1wpn_A_188 Manganese-dependent inorganic pyrophosphatase; met 98.79
1k20_A_1-192192 Manganese-dependent inorganic pyrophosphatase; fam 98.13
2qb7_A_1-255255 Exopolyphosphatase; A/B/A structure, DHH family ph 97.27
2zxr_A_327-42296 Single-stranded DNA specific exonuclease RECJ; DNA 99.9
3dev_A_197-320124 SH1221; alpha-beta protein., structural genomics, 98.17
3dma_A_215-343129 Exopolyphosphatase-related protein; structural gen 98.04
2zxr_A_1-48_423-534160 Single-stranded DNA specific exonuclease RECJ; DNA 99.87
2zxr_A_243-32684 Single-stranded DNA specific exonuclease RECJ; DNA 99.7
2zvf_A_27-171145 Alanyl-tRNA synthetase; C-terminal, oligomerizatio 96.18
2pi2_A_ 270 Replication protein A 32 kDa subunit; FULL-length 96.16
3kf6_A_159 Protein STN1; OB fold, chromosomal protein, DNA-bi 94.58
3kdf_D_132 Replication protein A 32 kDa subunit; wheat GERM c 93.05
1gm5_A_160-24889 RECG; helicase, replication restart; HET: DNA ADP; 92.18
3f2b_A_1-110110 DNA-directed DNA polymerase III alpha chain; DNA p 91.49
2zj3_A_217-375159 Glucosamine--fructose-6-phosphate aminotransferase 94.66
1x92_A_199 APC5045, phosphoheptose isomerase; midwest centre 94.44
2poc_A_207-367161 D-fructose-6-, isomerase domain of glutamine-fruct 93.89
1moq_A_211-368158 Glucosamine 6-phosphate synthase; glutamine amidot 93.84
2bpl_A_450-608159 Glucosamine--fructose-6-phosphate aminotransferase 93.59
2c31_A_194-372179 Oxalyl-COA decarboxylase; oxalate, thiamin diphosp 93.53
2yva_A_196 DNAA initiator-associating protein DIAA; intermole 92.27
2vbc_A_324-425_465-481119 Dengue 4 NS3 FULL-length protein; transmembrane, R 92.26
2vk2_A_1-108_251-276134 YTFQ, ABC transporter periplasmic-binding protein 91.25
1usg_A_122-254_330-346150 Leucine-specific binding protein; leucine-binding 90.52
2fn9_A_1-106_247-290150 Ribose ABC transporter, periplasmic ribose- bindin 93.17
3lkb_A_125-258_355-392172 Probable branched-chain amino acid ABC transporter 92.99
2e5f_A_12-157146 Hypothetical protein PH0510; structural genomics, 92.91
2dri_A_1-104_237-271139 D-ribose-binding protein; sugar transport; HET: RI 92.54
1f0k_A_1-171_340-364196 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 92.49
3g1w_A_1-108_243-305171 Sugar ABC transporter; sugar-binding protein, targ 92.18
1dbq_A_1-109_242-289157 Purine repressor; transcription regulation, DNA-bi 91.58
1ml4_A_153-276124 Aspartate transcarbamoylase; beta pleated sheet, p 91.35
2i2w_A_212 Phosphoheptose isomerase; lipopolysaccharide biosy 90.64
3d8u_A_1-102_224-275154 PURR transcriptional regulator; APC91343.1, vibrio 90.64
3brs_A_1-112_246-289156 Periplasmic binding protein/LACI transcriptional r 90.36
3h5l_A_140-279_378-419182 Putative branched-chain amino acid ABC transporter 90.08
2zxr_A_1-48_423-534160 Single-stranded DNA specific exonuclease RECJ; DNA 91.33
3i10_A_1-65_105-278239 Putative glycerophosphoryl diester phosphodiestera 90.21
>2zxr_A (A:49-242) Single-stranded DNA specific exonuclease RECJ; DNA repair, hydrolase; 2.15A {Thermus thermophilus} PDB: 2zxo_A 2zxp_A 1ir6_A Back     alignment and structure
Probab=99.96  E-value=2.9e-28  Score=240.47  Aligned_cols=192  Identities=32%  Similarity=0.477  Sum_probs=174.0

Q ss_pred             CHHHCCCHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCHHHHHHHHHCCC
Q ss_conf             95561487999999999997799799994078861528999999999769947998078743366889789887420268
Q gi|254780901|r   71 DPLILTDCDKAARRIVQAIYNSEKIMIFGDYDVDGAASVALMMRFLSHCSVNANMYIPDRIVDGYGPNPSLMEKFINEGA  150 (600)
Q Consensus        71 dP~~l~dm~~A~~ri~~ai~~~ekI~I~gDyD~DGitstail~~~L~~~g~~v~~~IP~R~~eGYGl~~~~i~~~~~~g~  150 (600)
                      +|++|++|+++++++.++++++++|+|++|+|+||.+++++|..+|...|..+.+++|++..++||++...+++..++ +
T Consensus         3 ~~~~~~~m~~~~~~l~~~l~~~~~i~I~~H~d~Dgda~~s~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~   81 (194)
T 2zxr_A            3 ALLPLKGLREAAALLEEALRQGKRIRVHGDYDADGLTGTAILVRGLAALGADVHPFIPHRLEEGYGVLMERVPEHLEA-S   81 (194)
T ss_dssp             CCCCCTTHHHHHHHHHHHHHTTCEEEEECCSSHHHHHHHHHHHHHHHHTTCEEEECCC---------------------C
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHHHC-C
T ss_conf             338865899999999999976997999960585077999999999998899769987786656888799999998608-9


Q ss_pred             CEEEEECCCCCCHHHHHHHHHCCCCEEEECCCCCCCCCCCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             68999648876234555554179827996154476555672565237888864334430478899999999999702148
Q gi|254780901|r  151 QLIITVDCGSTSYDALQYATNQGIDVIVIDHHQVKSEEIPAYALVNPNRLDDLSGQGHLCAAGVVFLVLVLIYRILRQDN  230 (600)
Q Consensus       151 ~LiItvD~Gi~~~e~i~~a~~~GidvIVtDHH~~~~~~p~a~aivNP~~~~~~~p~~~l~gaGvaf~l~~al~~~l~~~~  230 (600)
                      +++|+||||+.+..+...+++.|.++||+|||.+++..+ ..+++||++.+  ++++.+|++|++|.+++.+.+.++...
T Consensus        82 d~vi~vD~~~~~~~~~~~~~~~~~~viiIDHH~~~~~~~-~~~~vn~~~~~--~~~~~~~~~~~~~~l~~~~~~~~~~~~  158 (194)
T 2zxr_A           82 DLFLTVDCGITNHAELRELLENGVEVIVTDHHTPGKTPP-PGLVVHPALTP--DLKEKPTGAGVAFLLLWALHERLGLPP  158 (194)
T ss_dssp             CEEEESCCC--------------CEEEEECCCC---------CEECGGGST--TCCCCCCHHHHHHHHHHHHHHHTTCCC
T ss_pred             CEEEEECCCCCCHHHHHHHHHCCCEEEEECCCCCCCCCC-CCEEECCCCCC--CCCCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             989997488334899998986799899949799987787-54576456577--653345221799999999874344433


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             8764077999999987754201111444118999987887751
Q gi|254780901|r  231 KVPLNFDLLSLLDLVALATVCDVVPLIGLNRAYVVKGLMVARR  273 (600)
Q Consensus       231 ~~~~~~~l~~~ldlvaiGTvaD~vpL~~eNR~lvk~GL~~l~~  273 (600)
                      .       .++.+++++|.++|.+++.++||.++++|++.|+.
T Consensus       159 ~-------~~~a~~l~~Gi~~Dt~~f~~~~~~~~~~a~~~L~a  194 (194)
T 2zxr_A          159 P-------LEYADLAAVGTIADVAPLWGWNRALVKEGLARIPA  194 (194)
T ss_dssp             C-------GGGHHHHHHHHHHTTCCCSHHHHHHHHHHHHHGGG
T ss_pred             H-------HHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHC
T ss_conf             9-------99998977765324435407789998756665303



>3dma_A (A:1-214) Exopolyphosphatase-related protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.25A {Bacteroides fragilis} Back     alignment and structure
>3dev_A (A:1-196) SH1221; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.10A {Staphylococcus haemolyticus JCSC1435} Back     alignment and structure
>2eb0_A (A:1-191) Manganese-dependent inorganic pyrophosphatase; DHH domain, DHHA2 domain, structural genomics, NPPSFA; 2.20A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>2haw_A (A:1-192) Manganese-dependent inorganic pyrophosphatase; substrate complex, hydrolase; HET: 1PE PG4; 1.75A {Bacillus subtilis} Back     alignment and structure
>1wpn_A (A:) Manganese-dependent inorganic pyrophosphatase; metal binding, hydrolase; 1.30A {Bacillus subtilis} Back     alignment and structure
>1k20_A (A:1-192) Manganese-dependent inorganic pyrophosphatase; family II ppase, binuclear metal centre, hydrolase; 1.50A {Streptococcus gordonii} Back     alignment and structure
>2qb7_A (A:1-255) Exopolyphosphatase; A/B/A structure, DHH family phosphatase, hydrolase; 1.60A {Saccharomyces cerevisiae} PDB: 2qb6_A 2qb8_A* Back     alignment and structure
>2zxr_A (A:327-422) Single-stranded DNA specific exonuclease RECJ; DNA repair, hydrolase; 2.15A {Thermus thermophilus} PDB: 2zxo_A 2zxp_A 1ir6_A Back     alignment and structure
>3dev_A (A:197-320) SH1221; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.10A {Staphylococcus haemolyticus JCSC1435} Back     alignment and structure
>3dma_A (A:215-343) Exopolyphosphatase-related protein; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.25A {Bacteroides fragilis} Back     alignment and structure
>2zxr_A (A:1-48,A:423-534) Single-stranded DNA specific exonuclease RECJ; DNA repair, hydrolase; 2.15A {Thermus thermophilus} PDB: 2zxo_A 2zxp_A 1ir6_A Back     alignment and structure
>2zxr_A (A:243-326) Single-stranded DNA specific exonuclease RECJ; DNA repair, hydrolase; 2.15A {Thermus thermophilus} PDB: 2zxo_A 2zxp_A 1ir6_A Back     alignment and structure
>2zvf_A (A:27-171) Alanyl-tRNA synthetase; C-terminal, oligomerization domain, aminoacyl-tRNA synthetase, ATP-binding, cytoplasm, ligase, nucleotide-binding; 3.20A {Archaeoglobus fulgidus} Back     alignment and structure
>2pi2_A (A:) Replication protein A 32 kDa subunit; FULL-length RPA14/32, ssDNA binding protein, OB-fold, dioxane, DNA binding protein; 2.00A {Homo sapiens} Back     alignment and structure
>3kf6_A (A:) Protein STN1; OB fold, chromosomal protein, DNA-binding, nucleus, telomere; 1.65A {Schizosaccharomyces pombe} Back     alignment and structure
>3kdf_D (D:) Replication protein A 32 kDa subunit; wheat GERM cell free, protein complex, center for eukaryotic structural genomics, PSI; HET: MSE; 1.98A {Homo sapiens} PDB: 2pqa_A 1quq_A 1l1o_B Back     alignment and structure
>1gm5_A (A:160-248) RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} Back     alignment and structure
>3f2b_A (A:1-110) DNA-directed DNA polymerase III alpha chain; DNA polymerase C; HET: DGT; 2.39A {Geobacillus kaustophilus} PDB: 3f2c_A* 3f2d_A* Back     alignment and structure
>2zj3_A (A:217-375) Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] 1; glucosamine-6-phosphate synthase, aldose/ketose isomerase, rossmann-like fold; HET: G6P; 1.90A {Homo sapiens} PDB: 2zj4_A* 2v4m_A* Back     alignment and structure
>1x92_A (A:) APC5045, phosphoheptose isomerase; midwest centre for structural genomics, SIS domain, A/B protein, lipopolysaccharide biosynthesis, PSI; HET: M7P; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2poc_A (A:207-367) D-fructose-6-, isomerase domain of glutamine-fructose-6- phosphate transaminase (isomerizing); glucosamine-6-phosphate synthase; HET: BG6 UD1; 1.80A {Candida albicans SC5314} PDB: 2put_A* 2puv_A* 2puw_A* Back     alignment and structure
>1moq_A (A:211-368) Glucosamine 6-phosphate synthase; glutamine amidotransferase; HET: GLP MES; 1.57A {Escherichia coli} Back     alignment and structure
>2bpl_A (A:450-608) Glucosamine--fructose-6-phosphate aminotransferase [isomerizing]; amidotransferase, ammonia channeling, glucosamine 6- phosphate synthase; HET: F6R; 2.05A {Escherichia coli} Back     alignment and structure
>2c31_A (A:194-372) Oxalyl-COA decarboxylase; oxalate, thiamin diphosphate, flavoprotein, lyase, thiamine pyrophosphate; HET: TZD ADP; 1.73A {Oxalobacter formigenes} Back     alignment and structure
>2yva_A (A:) DNAA initiator-associating protein DIAA; intermolecular disulfide bonding, putative phosphosugar binding protein, DNAA binding protein; 1.85A {Escherichia coli} Back     alignment and structure
>2vbc_A (A:324-425,A:465-481) Dengue 4 NS3 FULL-length protein; transmembrane, RNA replication, NS2B-NS3 protease; 3.15A {Dengue virus type 4} Back     alignment and structure
>2vk2_A (A:1-108,A:251-276) YTFQ, ABC transporter periplasmic-binding protein YTFQ; transport protein, galactofuranose; HET: GZL; 1.20A {Escherichia coli} Back     alignment and structure
>1usg_A (A:122-254,A:330-346) Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} Back     alignment and structure
>2fn9_A (A:1-106,A:247-290) Ribose ABC transporter, periplasmic ribose- binding protein; RBP, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima MSB8} PDB: 2fn8_A* Back     alignment and structure
>3lkb_A (A:125-258,A:355-392) Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} Back     alignment and structure
>2e5f_A (A:12-157) Hypothetical protein PH0510; structural genomics, sugar binding protein, NPPSFA; 1.35A {Pyrococcus horikoshii OT3} PDB: 2dec_A* 2df8_A 2cb0_A* Back     alignment and structure
>2dri_A (A:1-104,A:237-271) D-ribose-binding protein; sugar transport; HET: RIP; 1.60A {Escherichia coli} Back     alignment and structure
>1f0k_A (A:1-171,A:340-364) MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} Back     alignment and structure
>3g1w_A (A:1-108,A:243-305) Sugar ABC transporter; sugar-binding protein, target 11229F, transport protein, structural genomics, PSI-2; 2.02A {Bacillus halodurans c-125} Back     alignment and structure
>1dbq_A (A:1-109,A:242-289) Purine repressor; transcription regulation, DNA-binding regulatory protein; 2.20A {Escherichia coli} Back     alignment and structure
>1ml4_A (A:153-276) Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} Back     alignment and structure
>2i2w_A (A:) Phosphoheptose isomerase; lipopolysaccharide biosynthesis; 1.95A {Escherichia coli} PDB: 2i22_A 1x94_A Back     alignment and structure
>3d8u_A (A:1-102,A:224-275) PURR transcriptional regulator; APC91343.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; HET: MSE; 2.88A {Vibrio parahaemolyticus} Back     alignment and structure
>3brs_A (A:1-112,A:246-289) Periplasmic binding protein/LACI transcriptional regulator; structural genomics, protein structure initiative; 2.00A {Clostridium phytofermentans isdg} Back     alignment and structure
>3h5l_A (A:140-279,A:378-419) Putative branched-chain amino acid ABC transporter; structural genomics, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} Back     alignment and structure
>2zxr_A (A:1-48,A:423-534) Single-stranded DNA specific exonuclease RECJ; DNA repair, hydrolase; 2.15A {Thermus thermophilus} PDB: 2zxo_A 2zxp_A 1ir6_A Back     alignment and structure
>3i10_A (A:1-65,A:105-278) Putative glycerophosphoryl diester phosphodiesterase; NP_812074.1, structural genomics; HET: MSE; 1.35A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure