254780917

254780917

ABC transporter, nucleotide binding/ATPase protein

GeneID in NCBI database:8209937Locus tag:CLIBASIA_04080
Protein GI in NCBI database:254780917Protein Accession:YP_003065330.1
Gene range:+(897303, 899093)Protein Length:596aa
Gene description:ABC transporter, nucleotide binding/ATPase protein
COG prediction:[V] ABC-type multidrug transport system, ATPase and permease components
KEGG prediction:mdlB; ABC transporter, nucleotide binding/ATPase protein; K06147 ATP-binding cassette, subfamily B, bacterial
SEED prediction:Y4gM
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM5 TM-Helix
TOPPRED5 TM-Helix
HMMTOP7 TM-Helix
MEMSAT6 TM-Helix
MEMSAT_SVM6 TM-Helix
PHOBIUS6 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590------
MRNFFFVLDKVMSPSDREMLSRLIRENIHKHVTWYSMSIVAMITVSLMTSCSAWIMRDVMNAMVASTDIFHVIVVSSTVAGIFIVKGIASFVQNYYLSCAGNSIIAEQQRKIYRRLLQYGMEFYDSNQSSELQVRFTHATQSVRSVVDIFITSFLRDFLTLVGLIVVMFLQEPTLSLCTIIIGPLCILGVRILVKRVRHIMEQGMVAIGHIIQNLQETVIGIRIVKSFAMEEVMNQRMCNMIKEVEDRLNKVAKIESATSPIMETISGLSIAGIILFSGFLMSKKGTSNAGEIMSFITALLMAYEPAKRIARTRIILEGGMVGVRCMFSLLDHPIMIEESPHAVNLPVGKGTTVFRDVFFSYKQGHPVLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINIRDITFSSLRERISYVGQDVFLFSNTVRYNILIGRPMATEEEMIEIAKSANAHDFIMSLPQGYDTYVGENGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQALSRLMQGRTTIVIAHRISTIIEADHIIFIEDGKVSESGDQKYLLQQKDGSLYKKMYASQLLENLS
cHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEEEEEEccccccccccccEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHHHHHEEEEccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccHHHHHHHccccHHHccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHccEEEEEEccEEEEEccHHHHHHccccHHHHHHHHHHHHHHcc
ccccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEEEEEEccccEEcEEEEEEEEccccEEEEEccccccHHHHHHHHcccccccEEEEEEccEEHHHEcHHHHHHHEEEEcccccccccEHHHHHHcccccccHHHHHHHHHHHccHHHHHccccHHHcEcccccccccHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHccccEEEEEEHHHHHcccEEEEEEccEEEEEccHHHHHHHccccHHHHHHHHHHccccc
MRNFFFVLDKVMSPSDREMLSRLIRENIHKHVTWYSMSIVAMITVSLMTSCSAWIMRDVMNAMVASTDIFHVIVVSSTVAGIFIVKGIASFVQNYYLSCAGNSIIAEQQRKIYRRLLQYGMefydsnqsselQVRFTHATQSVRSVVDIFITSFLRDFLTLVGLIVVMFlqeptlslctiiigplcILGVRILVKRVRHIMEQGMVAIGHIIQNLQETVIGIRIVKSFAMEEVMNQRMCNMIKEVEDRLNKVAKiesatspimeTISGLSIAGIILFSGFlmskkgtsnAGEIMSFITALLMAYEPAKRIARTRIILEGGMVGVRCMFslldhpimieesphavnlpvgkgttVFRDVFFSykqghpvlsGINLCfksgkmtalvgpsgsgkSTIINLLMRmydpssgsieidginirdiTFSSLRERISYVGQDVFLFSNTVRYNiligrpmatEEEMIEIAKSAnahdfimslpqgydtyvgengsnlsggQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQALSRLMQGRTTIVIAHRISTIIEADHIifiedgkvsesgdQKYLLQQKDGSLYKKMYASQLLENLS
mrnfffvldkvmspsdrEMLSRLIRENIHKHVTWYSMSIVAMITVSLMTSCSAWIMRDVMNAMVASTDIFHVIVVSSTVAGIFIVKGIASFVQNYYLSCAGNSIIAEQQRKIYRRLLQYGMEFYDSNQSSELQVRFTHATQSVRSVVDIFITSFLRDFLTLVGLIVVMFLQEPTLSLCTIIIGPLCILGVRILVKRVRHIMEQGMVAIGHIIQNLQETVIGIRIVKSFAMEEVMNQRMCNMIKEVEDRLNKVAKIEsatspimetiSGLSIAGIILFSGFLMSKKGTSNAGEIMSFITALLMAYEPAKRIARTRIILEGGMVGVRCMFSLLDHPIMIEESPHAVNLPVGKGTTVFRDVFFSYKQGHPVLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINIRDITFSSLRERISYVgqdvflfsntVRYNILIGRPMATEEEMIEIAKSANAHDFIMSLPQGYDTYVGENGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQALSRLMQGRTTIVIAHRISTIIEADHIIFIEDGKVSESGDQKYLLqqkdgslyKKMYASQLLENLS
MRNFFFVLDKVMSPSDREMLSRLIRENIHKHVTWYSMSIVAMITVSLMTSCSAWIMRDVMNAMVASTDIFHVIVVSSTVAGIFIVKGIASFVQNYYLSCAGNSIIAEQQRKIYRRLLQYGMEFYDSNQSSELQVRFTHATQSVRSVVDIFITSFLRDFLTLVGLIVVMFLQEPTLSLCTIIIGPLCILGVRILVKRVRHIMEQGMVAIGHIIQNLQETVIGIRIVKSFAMEEVMNQRMCNMIKEVEDRLNKVAKIESATSPIMETISGLSIAGIILFSGFLMSKKGTSNAGEIMSFITALLMAYEPAKRIARTRIILEGGMVGVRCMFSLLDHPIMIEESPHAVNLPVGKGTTVFRDVFFSYKQGHPVLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINIRDITFSSLRERISYVGQDVFLFSNTVRYNILIGRPMATEEEMIEIAKSANAHDFIMSLPQGYDTYVGENGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQALSRLMQGRTTIVIAHRISTIIEADHIIFIEDGKVSESGDQKYLLQQKDGSLYKKMYASQLLENLS
*****************EMLSRLIRENIHKHVTWYSMSIVAMITVSLMTSCSAWIMRDVMNAMVASTDIFHVIVVSSTVAGIFIVKGIASFVQNYYLSCAGNSIIAEQQRKIYRRLLQYGMEFYDSNQSSELQVRFTHATQSVRSVVDIFITSFLRDFLTLVGLIVVMFLQEPTLSLCTIIIGPLCILGVRILVKRVRHI*********HIIQNLQETVIGIRIVKSFAMEEVMNQRMCNMIKEVEDRLNKVAKIESATSPIMETISGLSIAGIILFSGFLMSKKGTSNAGEIMSFITALLMAYEPAKRIARTRIILEGGMVGVRCMFSLLDHPIM***********VGKGTTVFRDVFFSYKQGHPVLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINIRDITFSSLRERISYVGQDVFLFSNTVRYNILIGRPMATEEEMIEIAKSANAHDFIMSLPQGYDTYVGENGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQALSRLMQGRTTIVIAHRISTIIEADHIIFIEDGKVSESGDQKYLLQQKDGSLYKKMYASQLL****
MRNFFFVLDKVMSPSDREMLSRLIRENIHKHVTWYSMSIVAMITVSLMTSCSAWIMRDVMNAMVASTDIFHVIVVSSTVAGIFIVKGIASFVQNYYLSCAGNSIIAEQQRKIYRRLLQYGMEFYDSNQSSELQVRFTHATQSVRSVVDIFITSFLRDFLTLVGLIVVMFLQEPTLSLCTIIIGPLCILGVRILVKRVRHIMEQGMVAIGHIIQNLQETVIGIRIVKSFAMEEVMNQRMCNMIKEVEDRLNKVAKIESATSPIMETISGLSIAGIILFSGFLMSKKGTSNAGEIMSFITALLMAYEPAKRIARTRIILEGGMVGVRCMFSLLDHPIMIEESPHAVNLPVGKGTTVFRDVFFSYKQGHPVLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINIRDITFSSLRERISYVGQDVFLFSNTVRYNILIGRPMATEEEMIEIAKSANAHDFIMSLPQGYDTYVGENGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQALSRLMQGRTTIVIAHRISTIIEADHIIFIEDGKVSESGDQKYLLQQKDGSLYKKMYASQLLENLS
*****FVLDKVMSPSDREMLSRLIRENIHKHVTWYSMSIVAMITVSLMTSCSAWIMRDVMNAMVASTDIFHVIVVSSTVAGIFIVKGIASFVQNYYLSCAGNSIIAEQQRKIYRRLLQYGMEFYDSNQSSELQVRFTHATQSVRSVVDIFITSFLRDFLTLVGLIVVMFLQEPTLSLCTIIIGPLCILGVRILVKRVRHIMEQGMVAIGHIIQNLQETVIGIRIVKSFAMEEVMNQRMCNMIKEVEDRLNKVAKIESATSPIMETISGLSIAGIILFSGFLMSKKGTSNAGEIMSFITALLMAYEPAKRIARTRIILEGGMVGVRCMFSLLDHPIMIEESPHAVNLPVGKGTTVFRDVFFSYKQGHPVLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINIRDITFSSLRERISYVGQDVFLFSNTVRYNILIGRPMATEEEMIEIAKSANAHDFIMSLPQGYDTYVGENGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQALSRLMQGRTTIVIAHRISTIIEADHIIFIEDGKVSESGDQKYLLQQKDGSLYKKMYASQLLE***
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRNFFFVLDKVMSPSDREMLSRLIRENIHKHVTWYSMSIVAMITVSLMTSCSAWIMRDVMNAMVASTDIFHVIVVSSTVAGIFIVKGIASFVQNYYLSCAGNSIIAEQQRKIYRRLLQYGMEFYDSNQSSELQVRFTHATQSVRSVVDIFITSFLRDFLTLVGLIVVMFLQEPTLSLCTIIIGPLCILGVRILVKRVRHIMEQGMVAIGHIIQNLQETVIGIRIVKSFAMEEVMNQRMCNMIKEVEDRLNKVAKIESATSPIMETISGLSIAGIILFSGFLMSKKGTSNAGEIMSFITALLMAYEPAKRIARTRIILEGGMVGVRCMFSLLDHPIMIEESPHAVNLPVGKGTTVFRDVFFSYKQGHPVLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINIRDITFSSLRERISYVGQDVFLFSNTVRYNILIGRPMATEEEMIEIAKSANAHDFIMSLPQGYDTYVGENGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQALSRLMQGRTTIVIAHRISTIIEADHIIFIEDGKVSESGDQKYLLQQKDGSLYKKMYASQLLENLS
MRNFFFVLDKVMSPSDREMLSRLIRENIHKHVTWYSMSIVAMITVSLMTSCSAWIMRDVMNAMVASTDIFHVIVVSSTVAGIFIVKGIASFVQNYYLSCAGNSIIAEQQRKIYRRLLQYGMEFYDSNQSSELQVRFTHATQSVRSVVDIFITSFLRDFLTLVGLIVVMFLQEPTLSLCTIIIGPLCILGVRILVKRVRHIMEQGMVAIGHIIQNLQETVIGIRIVKSFAMEEVMNQRMCNMIKEVEDRLNKVAKIESATSPIMETISGLSIAGIILFSGFLMSKKGTSNAGEIMSFITALLMAYEPAKRIARTRIILEGGMVGVRCMFSLLDHPIMIEESPHAVNLPVGKGTTVFRDVFFSYKQGHPVLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINIRDITFSSLRERISYVGQDVFLFSNTVRYNILIGRPMATEEEMIEIAKSANAHDFIMSLPQGYDTYVGENGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQALSRLMQGRTTIVIAHRISTIIEADHIIFIEDGKVSESGDQKYLLQQKDGSLYKKMYASQLLENLS
MRNFFFVLDKVMSPSDREMLSRLIRENIHKHVTWYSMSIVAMITVSLMTSCSAWIMRDVMNAMVASTDIFHVIVVSSTVAGIFIVKGIASFVQNYYLSCAGNSIIAEQQRKIYRRLLQYGMEFYDSNQSSELQVRFTHATQSVRSVVDIFITSFLRDFLTLVGLIVVMFLQEPTLSLCTIIIGPLCILGVRILVKRVRHIMEQGMVAIGHIIQNLQETVIGIRIVKSFAMEEVMNQRMCNMIKEVEDRLNKVAKIESATSPIMETISGLSIAGIILFSGFLMSKKGTSNAGEIMSFITALLMAYEPAKRIARTRIILEGGMVGVRCMFSLLDHPIMIEESPHAVNLPVGKGTTVFRDVFFSYKQGHPVLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINIRDITFSSLRERISYVGQDVFLFSNTVRYNILIGRPMATEEEMIEIAKSANAHDFIMSLPQGYDTYVGENGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQALSRLMQGRTTIVIAHRISTIIEADHIIFIEDGKVSESGDQKYLLQQKDGSLYKKMYASQLLENLS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target596 ABC transporter, nucleotide binding/ATPase protein [Can
254780576597 ABC transporter related protein [Candidatus Liberi 1e-63
254780193528 lipid A ABC exporter family, fused ATPase and inne 1e-48
254780193528 lipid A ABC exporter family, fused ATPase and inne 0.037
254780871227 lipoprotein-releasing system ATP-binding protein l 1e-15
254780704254 ABC transporter, nucleotide binding/ATPase protein 2e-15
254780596 438 ABC transporter nucleotide binding/ATPase protein 7e-15
254780559234 thiamine transporter ATP-binding subunit [Candidat 1e-14
254780718240 putative high-affinity zinc uptake system ATP-bind 7e-14
255764467565 Type I secretion system ATPase, PrtD [Candidatus L 1e-13
254780744262 ABC transporter nucleotide binding/ATPase protein 2e-13
254780538280 ABC transporter, nucleotide binding/ATPase protein 5e-12
254780173257 ABC transporter related protein [Candidatus Liberi 6e-12
254781060249 ABC transporter, nucleotide binding/ATPase protein 1e-09
254781123610 putative ABC transporter, ATP-binding protein [Can 2e-09
254781123 610 putative ABC transporter, ATP-binding protein [Can 7e-07
254780273539 putative ABC transporter ATP-binding protein [Cand 8e-09
254780273 539 putative ABC transporter ATP-binding protein [Cand 1e-04
254780340348 proline/glycine betaine ABC transporter, ATP-bindi 2e-08
254780139257 putative ATP-binding component of ABC transporter 4e-06
254780184959 excinuclease ABC subunit A [Candidatus Liberibacte 2e-05
254780184 959 excinuclease ABC subunit A [Candidatus Liberibacte 0.002
>gi|254780576|ref|YP_003064989.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 597 Back     alignment
 Score =  235 bits (600), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 120/264 (45%), Positives = 171/264 (64%), Gaps = 2/264 (0%)

Query: 327 MFSLLDHPIMIEESPHAVNLPVGKGTTVFRDVFFSYKQGHPVLSGINLCFKSGKMTALVG 386
           + ++L+  I I+ + ++ +L +  G  VF +V FSY   + +  GI+      K TAL+G
Sbjct: 331 LLNILNEKIEIQNAVNSKDLKIKNGHIVFNNVSFSYNHHNCIFKGISFEIAPSKKTALIG 390

Query: 387 PSGSGKSTIINLLMRMYDPSSGSIEIDGINIRDITFSSLRERISYVGQDVFLFSNTVRYN 446
            SG GKST+  LL R+YD   G I IDG +I+ IT  SLR+ I  + QD  LF++T+RYN
Sbjct: 391 ESGVGKSTVAKLLYRLYDIKGGIITIDGQDIKKITKESLRQTIGIIPQDTILFNDTLRYN 450

Query: 447 ILIGRPMATEEEMIEIAKSANAHDFIMSLPQGYDTYVGENGSNLSGGQKQRIAIARAMLR 506
           IL G P A+++E+    + A    FIM LP GYDT VGE G  LSGG+KQR++IARA+L+
Sbjct: 451 ILYGNPNASDQELCAAVEVAQLKSFIMKLPNGYDTVVGERGLKLSGGEKQRVSIARAILK 510

Query: 507 DGHILVLDEATSALDTHTENLVRQALSRLMQGRTTIVIAHRISTIIEADHIIFIEDGKVS 566
           +  I++ DEATS+LD  TE  ++ AL+ L + RTT+VIAHR+STI +AD+II  + G V 
Sbjct: 511 NPPIIIFDEATSSLDIITERHIQTALATLSKNRTTLVIAHRLSTITDADNIIVFDQGTVV 570

Query: 567 ESGDQKYLLQQKDGSLYKKMYASQ 590
           ESG  + L+ Q  G +Y  M+  Q
Sbjct: 571 ESGSHENLISQ--GGIYTSMWKKQ 592

>gi|254780193|ref|YP_003064606.1| lipid A ABC exporter family, fused ATPase and inner membrane subunits [Candidatus Liberibacter asiaticus str. psy62] Length = 528 Back     alignment
 Score =  186 bits (471), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 98/229 (42%), Positives = 142/229 (62%), Gaps = 2/229 (0%)

Query: 351 GTTVFRDVFFSY--KQGHPVLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSG 408
           G+  FR V F Y  K    +L  +N   + G+  ALVG SG+GK++I +L++R YDP SG
Sbjct: 286 GSVSFRSVSFVYPGKSKRSILKNVNFTVQPGETIALVGDSGAGKTSIFSLILRFYDPCSG 345

Query: 409 SIEIDGINIRDITFSSLRERISYVGQDVFLFSNTVRYNILIGRPMATEEEMIEIAKSANA 468
           S+EI+GI++R ++   +R  I++V Q   + + +V  NI IG P AT +E+   A  A A
Sbjct: 346 SVEIEGIDLRLLSLEEIRRFIAWVPQHPIMIAASVYDNIAIGCPHATRKEIQNAAMLAQA 405

Query: 469 HDFIMSLPQGYDTYVGENGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLV 528
           H+FI  L  GYDT +G+   +LS GQ QRIAIARA+L+D  IL+LDE  SALD   E  +
Sbjct: 406 HEFIGCLENGYDTILGDGAVHLSTGQIQRIAIARAILKDSPILLLDEMGSALDIENEQKI 465

Query: 529 RQALSRLMQGRTTIVIAHRISTIIEADHIIFIEDGKVSESGDQKYLLQQ 577
            + L    +GRTTI  +HR+S I +AD +  + D  + E G  + LL++
Sbjct: 466 WKVLREQRRGRTTIFASHRLSAIQDADMVFVLHDQVIVEKGVHEELLKK 514

>gi|254780193|ref|YP_003064606.1| lipid A ABC exporter family, fused ATPase and inner membrane subunits [Candidatus Liberibacter asiaticus str. psy62] Length = 528 Back     alignment
 Score = 31.6 bits (70), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 44/92 (47%), Gaps = 5/92 (5%)

Query: 94  NYYLSCA---GNSIIAEQQRKIYRRLLQYGMEFYDSNQSSELQVRFTHATQSVRSVVDIF 150
            YY  CA   G  +I   QR +  ++++    F++S    E+       T+ +++++ I 
Sbjct: 31  RYY--CATMLGERMILFMQRDVIAKIIKLSPSFFNSRGHGEIFSILVKDTERIKAIIGIG 88

Query: 151 ITSFLRDFLTLVGLIVVMFLQEPTLSLCTIII 182
           ++  LR  L   G + +MF+    LSL  + I
Sbjct: 89  MSIVLRSLLMGFGAMCMMFVISIKLSLIVVSI 120

>gi|254780871|ref|YP_003065284.1| lipoprotein-releasing system ATP-binding protein lolD [Candidatus Liberibacter asiaticus str. psy62] Length = 227 Back     alignment
 Score = 76.3 bits (186), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 110/224 (49%), Gaps = 15/224 (6%)

Query: 354 VFRDVFFSYKQ---GHPVLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSI 410
           + ++V  SY+Q     PVL  ++L  K G++ ALV PSG+GKSTI+++   +  P  G++
Sbjct: 8   LLQNVKHSYRQVGKPFPVLENVHLSLKKGEIVALVSPSGTGKSTILHIAGLLEVPDQGNV 67

Query: 411 EIDGI---NIRDITFSSLR-ERISYVGQDVFLFSN-TVRYNILIGRPMATEEEMIEIAKS 465
            I       + D   S LR  +I +V Q+  L  + +V  NI+  + +A         ++
Sbjct: 68  IIANQLCNKLSDDKKSFLRCSKIGFVYQEHRLLMDFSVIENIIFPQIIAGINHKTAYQRA 127

Query: 466 ANAHDFIMSLPQGYDTYVGENGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTE 525
            +   + M + Q    Y     S++SGG++QR+AI RA+     I++ DE T  LD  T 
Sbjct: 128 MDLLSY-MDMSQ----YANRRSSDISGGEQQRVAICRAIANKPLIILADEPTGNLDLKTA 182

Query: 526 NLVRQALSRLM--QGRTTIVIAHRISTIIEADHIIFIEDGKVSE 567
             V   L  L+   G   ++  H      + D  I I DG +++
Sbjct: 183 QQVFSILKYLVVRSGLAALIATHNHDLASQMDRQITIRDGMIAD 226

>gi|254780704|ref|YP_003065117.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 254 Back     alignment
 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/194 (30%), Positives = 94/194 (48%), Gaps = 22/194 (11%)

Query: 368 VLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDP-----SSGSIEIDGINI--RDI 420
            L  INL      +TAL+GPSG GKST +  L RM +       +G I +DG NI    +
Sbjct: 21  ALFDINLKIPQNSVTALIGPSGCGKSTFLRCLNRMNETIDNCVFTGEIILDGKNIYQSSV 80

Query: 421 TFSSLRERISYVGQDVFLFSNTVRYNIL-------IGRPMATEEEMIEIA-KSANAHDFI 472
               LR R+  V Q    F  ++  N+        +G   A  ++++E++ K A      
Sbjct: 81  DVVRLRARVGMVFQRPNPFPKSIYDNVAYGPRIHGLGNNKADIDQIVEMSLKKA------ 134

Query: 473 MSLPQGYDTYVGENGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQAL 532
            SL       +  + S LSGGQ+QR+ IARA+  +  ++++DE  SALD      V + +
Sbjct: 135 -SLFNEVKDRLFHDASLLSGGQQQRVCIARALAVNPEVILMDEPCSALDPIATASVEELI 193

Query: 533 SRLMQGRTTIVIAH 546
             L +  T +++ H
Sbjct: 194 HELRESLTIVIVTH 207

>gi|254780596|ref|YP_003065009.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 438 Back     alignment
 Score = 73.9 bits (180), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 103/209 (49%), Gaps = 19/209 (9%)

Query: 368 VLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINIRDITFSSLRE 427
           VL  +N    SG++  L+G SGSGKST++ ++  +  PSSG +   G  I+D       +
Sbjct: 32  VLDKVNFNVSSGEIVGLLGRSGSGKSTLLRIIAGLVSPSSGQVLFKGKKIKDPP-----K 86

Query: 428 RISYVGQDVFLFSN-TVRYNILIGRPMATEEEMIEIAKSANAHDFIMSLPQGYDTYVGEN 486
            IS V Q   LF   TV  N+ +G      ++     ++ +A D I     G D +   +
Sbjct: 87  DISVVFQTFALFPWLTVLENVELGLKAKGIDKEERRKRALSAIDLI-----GLDGFESAH 141

Query: 487 GSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHT-ENLVRQALSRLMQGRTTI--- 542
            + +SGG  QR+  ARA +    +L++DE  SALD  T ENL    +   ++GR  I   
Sbjct: 142 TTEISGGMLQRVGFARAFVVFPSLLLMDEPFSALDVLTAENLRTDLIDLWIEGRLPIESM 201

Query: 543 -VIAHRI-STIIEADHIIFI--EDGKVSE 567
            ++ H I   ++  D ++      G+++E
Sbjct: 202 LMVTHNIEEAVLMCDRVLVFSSNPGRIAE 230

>gi|254780559|ref|YP_003064972.1| thiamine transporter ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 234 Back     alignment
 Score = 73.2 bits (178), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 104/206 (50%), Gaps = 31/206 (15%)

Query: 384 LVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINIRDITFSSLRER-ISYVGQDVFLFSN- 441
           ++GPSG+GKST+++L+     P+ GSI ++G N    T SS  +R +S + Q+  LFS+ 
Sbjct: 30  ILGPSGAGKSTLLSLMAGFKYPTRGSIFLNGQNH---TRSSPSKRPLSILFQENNLFSHL 86

Query: 442 TVRYNILIG---------RPMATEEEMIEIAKSANAHDFIMSLPQGYDTYVGENGSNLSG 492
           TV  NI +G            A  ++M+E        DF    P           S +SG
Sbjct: 87  TVWQNIALGIAPNLRLDHYQHAQVKQMLE---KVFLEDFFNRFP-----------SQMSG 132

Query: 493 GQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQALSRLMQGR--TTIVIAHRIST 550
           GQ+QR+A+AR ++R   IL+LDE  +  D    + +   L ++   R  T ++I+H +  
Sbjct: 133 GQRQRVALARCLIRQKPILLLDEPFAVFDPALRHEILGLLKQVCDERQLTLLMISHNLED 192

Query: 551 IIE-ADHIIFIEDGKVSESGDQKYLL 575
            ++ A   I I  G++   GD   L+
Sbjct: 193 SMQIATRFIVIAGGQIVYDGDPDRLM 218

>gi|254780718|ref|YP_003065131.1| putative high-affinity zinc uptake system ATP-binding component of ABC transporter protein [Candidatus Liberibacter asiaticus str. psy62] Length = 240 Back     alignment
 Score = 70.5 bits (171), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 120/241 (49%), Gaps = 33/241 (13%)

Query: 362 YKQGHPVLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINIRDIT 421
           +K G+ +L  IN   K  ++  L+GP+GSGKSTI  L+  +  P+ GS++     I    
Sbjct: 19  HKNGYKILQDINFTIKPNEIVTLIGPNGSGKSTIAKLITGIIKPTIGSVKRHPQLI---- 74

Query: 422 FSSLRERISYVGQDVFLFSNTVRYNIL----IGRPMATEEEMIEIAKSANAHDFIMSLPQ 477
                  + YV Q V +  NT+  +++    +  P ++ +++++I    N       L  
Sbjct: 75  -------VGYVPQKVTI-ENTLPLSLMRFMTLSMP-SSRDDVLQILDRVN-------LIG 118

Query: 478 GYDTYVGENGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQALSRLMQ 537
            Y+     N  +LSGG+ QR  +A+A+LR  ++LVLDE    +D   E  + + ++ + Q
Sbjct: 119 KYN----RNIKDLSGGEFQRALLAKALLRKPNLLVLDEPLQGIDFPGELSLYELITSVRQ 174

Query: 538 --GRTTIVIAHRISTIIEADHIIFIEDGKVSESGDQKYLLQQKDGSLYKKMYASQLLENL 595
             G   ++I+H +  ++ +   +   + ++   G  + +   KD + Y +++ ++  E L
Sbjct: 175 STGCGILLISHNLHMVMASTDTVICLNNRICYQGPPQTI---KDNAEYIRLFGTRATEIL 231

Query: 596 S 596
           +
Sbjct: 232 A 232

>gi|255764467|ref|YP_003064798.2| Type I secretion system ATPase, PrtD [Candidatus Liberibacter asiaticus str. psy62] Length = 565 Back     alignment
 Score = 69.7 bits (169), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 64/270 (23%), Positives = 117/270 (43%), Gaps = 10/270 (3%)

Query: 289 NAGEIM--SFITALLMAYEPAKRIARTRIILEGGMVGVRCMFSLLDHPIMIEES---PHA 343
           +AG I+  S ITA  MA  P ++I  ++  L  G+  ++ + +L D   ++  S      
Sbjct: 264 SAGAIIATSIITARAMA--PLEQIINSKKSLNVGLKSLKYLINLNDFTTLLNSSDSKKEP 321

Query: 344 VNLPVGKGTTVFRDVFFSYKQ-GHPVLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRM 402
           +++ +   T   +++ F  K+    +   ++     G    + GPSG GKS  +  ++ +
Sbjct: 322 ISMRLSNNTITAKNIVFRDKKTSRLICQNLSFTIPEGSCCIIAGPSGCGKSNFLLCMLGL 381

Query: 403 YDPSSGSIEIDGINIRDITFSSLRERISYVGQDVFLFSNTVRYNILIGRPMATEEEMIEI 462
                G+I      I          +I Y+ Q   LF  ++  NI++     +     + 
Sbjct: 382 LTLEKGTISFGDRQISRDFIEKFSAQIGYLSQHCSLFPISITENIILSHDQNSLHIAQKT 441

Query: 463 AKSANAHDFIMSLPQGYDTYVGENGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDT 522
           AK    H+ I+SL  GY T    +   +     Q+I ++R +  +  IL++DE    LD 
Sbjct: 442 AKIVGCHEDILSLKNGYQTTYCSD--EIPYNIVQKIRLSRIIANNPAILLMDEPLYHLDN 499

Query: 523 HTENLVRQALSRLMQGRTTIVIAHRISTII 552
             +N     L +  + + TIVI     TII
Sbjct: 500 EAKNNFYTLLKQFKENKKTIVIISHDPTII 529

>gi|254780744|ref|YP_003065157.1| ABC transporter nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 262 Back     alignment
 Score = 68.9 bits (167), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/199 (30%), Positives = 103/199 (51%), Gaps = 15/199 (7%)

Query: 368 VLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINIRDIT-FSSLR 426
           V+ G++L  K G++  L+GP+G+GK+T   ++  +    SGSI+IDG +I  +  +   R
Sbjct: 40  VVKGVDLYVKPGEIVGLLGPNGAGKTTFFYMMTGLICADSGSIKIDGNDITKMPMYRRAR 99

Query: 427 ERISYVGQDVFLFSN-TVRYNILIGRPMATEEEMIEIAKSANAHDFIMSLPQGYDTYVGE 485
             ISY+ Q+  +F   TV  NIL         E+ E  K    H+ + SL + ++     
Sbjct: 100 LGISYLPQEASIFRGLTVEENIL------AVLEVYEKDKKKR-HEKLDSLLKEFNITKWR 152

Query: 486 N--GSNLSGGQKQRIAIARAMLRDGHILVLDEATSALD----THTENLVRQALSRLMQGR 539
           +     LSGGQ++R+ IAR+++     ++LDE  + +D    +    L+R   SR +   
Sbjct: 153 HVLAPLLSGGQRRRLEIARSLVSFPSYILLDEPFAGVDPVAISDIHVLIRDLASRGIGIL 212

Query: 540 TTIVIAHRISTIIEADHII 558
            T    H I T+I+  +II
Sbjct: 213 ITDHNVHEILTLIDRAYII 231

>gi|254780538|ref|YP_003064951.1| ABC transporter, nucleotide binding/ATPase protein (iron) [Candidatus Liberibacter asiaticus str. psy62] Length = 280 Back     alignment
 Score = 64.3 bits (155), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 61/227 (26%), Positives = 108/227 (47%), Gaps = 29/227 (12%)

Query: 350 KGTTVFRDVFFSYKQGHPVLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGS 409
           KG    +D+  +Y  G+  L  +NL      +TAL+G +G+GKST+   +M +     GS
Sbjct: 9   KGGLELKDISVTYPNGYCALEDVNLFIPENTITALIGLNGAGKSTLFQAIMGLIPLDKGS 68

Query: 410 IEIDGINIRDITFSSLRERISYVGQ-------------DVFLFSNTVRYNILIGRPMATE 456
           I I    + +   + L   I+Y+ Q             DV +     RY  +  R +A+ 
Sbjct: 69  ISIFNQTVENALKADL---IAYIPQTESIDWTFPILVEDVVMMG---RYKHMNWRRVASN 122

Query: 457 EEMIEIAKSANAHDFIMSLPQGYDTYVGENGSNLSGGQKQRIAIARAMLRDGHILVLDEA 516
            +   I   A  +  + S+ Q     +GE    LS GQ++R+ +ARA+ +   ++++DE 
Sbjct: 123 NDY-RIVTEALENVGMSSMRQ---RQIGE----LSIGQQKRVFLARALAQKSQVIIMDEP 174

Query: 517 TSALDTHTENLVRQALSRLMQGRTTIVIA-HRISTIIE-ADHIIFIE 561
            +A+D  TE  +   L  L+     I+++ H I++I    D  IF++
Sbjct: 175 FAAIDFKTEREMIFLLKSLLNEDIMILVSTHNINSIPSFCDRTIFLK 221

>gi|254780173|ref|YP_003064586.1| ABC transporter related protein [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Back     alignment
 Score = 64.3 bits (155), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 106/209 (50%), Gaps = 15/209 (7%)

Query: 369 LSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINIRDI--TFSSLR 426
           L  INL    G+   + GPSGSGKST+I  +  +    +G I I+GI + D       +R
Sbjct: 33  LRDINLNVLRGERVIIAGPSGSGKSTLIRCINHIEKHQAGEIIINGIPLNDDIRNIHEVR 92

Query: 427 ERISYVGQDVFLFSN-TVRYNILIGRPMATEEEMIEIAKSANAHDFIMSLPQGYDTYVGE 485
             +  V Q   LFSN +V  N  +G P+   +   + A+    H ++  +     ++   
Sbjct: 93  RDVGMVFQHFNLFSNLSVLENCTLG-PIWVRKMPKKDAEELAMH-YLNKVKIADKSH--R 148

Query: 486 NGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQALSRLM----QGRTT 541
           + S LSGG+ QR AIAR++     I++ DE TSALD     +V++ L  ++    +G T 
Sbjct: 149 SSSLLSGGESQRAAIARSLCMQPKIMLFDEPTSALDPE---MVKEVLDIMIELAEEGMTM 205

Query: 542 IVIAHRISTIIE-ADHIIFIEDGKVSESG 569
           + + H +    + AD ++F++ G++ E  
Sbjct: 206 VCVTHEMGFARQVADRVVFMDQGQIVEQN 234

>gi|254781060|ref|YP_003065473.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 249 Back     alignment
 Score = 56.2 bits (134), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 62/225 (27%), Positives = 110/225 (48%), Gaps = 33/225 (14%)

Query: 368 VLSGINLCFKSGKMTALVGPSGSGKSTIINLL--MRMYDPSSGSIEIDGINIRDITFSSL 425
           ++ G+NL  +  ++ A++GP+GSGKST+  LL   + Y+ ++G I   G +I D    S+
Sbjct: 18  IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILD---WSI 74

Query: 426 RERISYVGQDVFLFSNTVRYNILIGRPMATEEEMIEIA-----KSANAHDFIM-SLPQGY 479
            ER S   + +FL     +Y + I  P     + ++IA     K+ N  + ++    +  
Sbjct: 75  VERAS---KGIFL---AFQYPVEI--PGIIMMQFLKIALNEQRKARNEKELLIPDFTRKV 126

Query: 480 DTYVGENGSNL-----------SGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLV 528
                E G N+           SGG+K+   I +  L +  + +LDE  S LD     + 
Sbjct: 127 RKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIA 186

Query: 529 RQALSRLM-QGRTTIVIAH--RISTIIEADHIIFIEDGKVSESGD 570
            Q ++ L  Q R+ ++I H  R+   I+ D I  + +GK+ ++GD
Sbjct: 187 AQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGD 231

>gi|254781123|ref|YP_003065536.1| putative ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 610 Back     alignment
 Score = 55.5 bits (132), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/179 (27%), Positives = 86/179 (48%), Gaps = 16/179 (8%)

Query: 368 VLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINIRDITFSSLRE 427
           V+   +L    G+   +VGP+G+GK+T++ LL     P  G I + G N++  T    RE
Sbjct: 299 VVKDFSLRIHYGECIGIVGPNGAGKTTLLKLLTGKIKPDCGFITL-GTNLKIATIDQKRE 357

Query: 428 RISYVGQDVFLFSNTVRYNILIGRPMATEEEMIEIAKSANAHDFIMSLPQGYDTYVGENG 487
            I     D  L S     +   G  +    E   +A      DF+    Q +        
Sbjct: 358 DID---PDKSLASYLTGSS---GDSLMVRGESRHVA--GYIKDFLFHPDQAHSLM----- 404

Query: 488 SNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQALSRLMQGRTTIVIAH 546
            +LSGG+K R  +AR + +  + L++DE T+ LD  T + + + +++L QG T ++++H
Sbjct: 405 KHLSGGEKMRAIVARVLAQPFNFLIMDEPTNDLDFETLDFLERTITQL-QG-TILIVSH 461

>gi|254781123|ref|YP_003065536.1| putative ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 610 Back     alignment
 Score = 47.4 bits (111), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 79/170 (46%), Gaps = 25/170 (14%)

Query: 368 VLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINIRDITFSSLRE 427
           +L  + L  K  +   LVG +GSGKST++ +   + +P SG++           F     
Sbjct: 20  LLQDVCLSIKPKERICLVGCNGSGKSTLLKIAAGITEPQSGNV-----------FLHSSS 68

Query: 428 RISYVGQ--DVFLFSNTVRYNILIGRPMATEEEMIEIAKSANAHDFIMSLPQGYDTYVGE 485
           R+ Y+ Q  D+  FS   +Y         T ++ IE   S        SL + ++    +
Sbjct: 69  RLGYLEQNPDLSHFSTISQY------IDDTIKDTIEAPYSP------YSLLKKFNLREQD 116

Query: 486 NGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQALSRL 535
              NLS GQ + +A+ + ++    IL+LDE T+ LD  T + + Q L ++
Sbjct: 117 RIENLSVGQTRCVALMKMLISRPDILILDEPTNHLDFRTIHWMEQELLKI 166

>gi|254780273|ref|YP_003064686.1| putative ABC transporter ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 539 Back     alignment
 Score = 53.9 bits (128), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 94/197 (47%), Gaps = 30/197 (15%)

Query: 373 NLCFK--SGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINIRDITFSSLRERIS 430
           NL FK   G +  ++GP+G+GK+T+  +L     P SG+I + G  +           +S
Sbjct: 335 NLSFKLPPGGIVGVIGPNGAGKTTLFRMLTGDESPDSGTIHV-GETVC----------LS 383

Query: 431 YVGQ--DVFLFSNTVRYNILIGRPMATEEEMIEIAKSANAHDF-IMSLPQGYDTYVGENG 487
           YV Q  D      TV  +I  G      ++++++    N H+    +    ++   G+  
Sbjct: 384 YVDQSRDSLEAEKTVWEDISGG------DDIVKL----NGHEINSRAYCSAFNFKGGDQQ 433

Query: 488 ---SNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQALSRLMQGRTTIVI 544
               +LSGGQ+ R+ +A+ +   G++++LDE T+ LDT T + +  AL     G   I+ 
Sbjct: 434 QRIGSLSGGQRGRVHLAKILKSGGNVILLDEPTNDLDTETLSALEDALENFA-GCAVIIS 492

Query: 545 AHRISTIIEADHIIFIE 561
             R+     A HI+  E
Sbjct: 493 HDRMFLDRLATHILAFE 509

>gi|254780273|ref|YP_003064686.1| putative ABC transporter ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 539 Back     alignment
 Score = 40.0 bits (92), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 87/195 (44%), Gaps = 46/195 (23%)

Query: 358 VFFSYKQGHPVLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINI 417
           VF S K    VL  INL F       ++GP+G+GKSTI+ ++  +        E +G   
Sbjct: 15  VFGSKK----VLDDINLSFYPDAKIGILGPNGAGKSTILRIMAGI------DKEYNGEAW 64

Query: 418 RDITFSSLRERISYVGQDVFL-FSNTVRYNILIG-----------------RPMATEEEM 459
               F+     + Y+ Q+  L  S TV+ NI+ G                     TEEE+
Sbjct: 65  LATGFT-----VGYLPQEPQLDLSKTVKENIIEGVAHKQAILDRYNELMMNYSEKTEEEI 119

Query: 460 I---EIAKSANAHDF-------IMSLPQGYDTYVGENGSNLSGGQKQRIAIARAMLRDGH 509
               +I  S    D        I SL    D   G N ++LSGG+K+R+A+ + +L    
Sbjct: 120 AKLQDIIDSKGLWDLETEVQVAIESLHCPAD---GLNITSLSGGEKRRVALCKLLLSSPD 176

Query: 510 ILVLDEATSALDTHT 524
           +L+LDE T+ LD  T
Sbjct: 177 LLLLDEPTNHLDAET 191

>gi|254780340|ref|YP_003064753.1| proline/glycine betaine ABC transporter, ATP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 348 Back     alignment
 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 110/238 (46%), Gaps = 26/238 (10%)

Query: 373 NLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDG----INIRDITFSSLRE- 427
           NL  K G++  L+G SG+GKST++  +  +     G + +D     +N      + LR+ 
Sbjct: 49  NLEVKKGEILVLMGLSGAGKSTLLRSINGLAPVVRGEVLVDTDKGFVNPYAADANVLRKL 108

Query: 428 ---RISYVGQDVFLFS-NTVRYNILIGRPMATEEEMIEIAKSANAHDFIMSLPQGYDTYV 483
               +S V Q   L    TV  N+ +G       + +E       H  I++L +  D  +
Sbjct: 109 RMHTVSMVFQQFALLPWRTVARNVELGLEFLDIPD-VERKSRVAEHLEIVNLTKWADCKI 167

Query: 484 GENGSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQ---ALSRLMQGRT 540
               + LSGG KQR+  ARA      IL++DE  S+LD      ++    AL R ++ +T
Sbjct: 168 ----NMLSGGMKQRVGFARAFATGAPILLMDEPFSSLDPLIRMRLQDELLALQRKLK-KT 222

Query: 541 TIVIAHRISTIIE-ADHIIFIEDGKVSESG-DQKYLLQQKDGSLYKKMYASQLLENLS 596
            + ++H I+      + I  +E G++ + G  Q+ +L   +       Y S+ ++ L+
Sbjct: 223 IVFVSHDINEAFRLGNRIAIMEGGRIIQCGTPQEIILHPAN------CYVSEFIQKLN 274

>gi|254780139|ref|YP_003064552.1| putative ATP-binding component of ABC transporter [Candidatus Liberibacter asiaticus str. psy62] Length = 257 Back     alignment
 Score = 44.7 bits (104), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 51/186 (27%), Positives = 93/186 (50%), Gaps = 21/186 (11%)

Query: 379 GKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINI------RDITFSSLRERISYV 432
           G++  ++G SG+GKS ++  ++ +    SG +++ G ++      ++  FS+   ++  +
Sbjct: 39  GEILGVIGSSGTGKSILMRGILGLIPRVSGEVKVLGEHLNLAKGKQNFAFSA---KLGVL 95

Query: 433 GQDVFLFSN-TVRYNI--LIGRPMATEEEMIE-IAKSANAHDFIMSLPQGYDTYVGENGS 488
            Q   LFS+ TV+ NI   I   +    ++IE I  +  A   I+ LP      +     
Sbjct: 96  FQHGALFSSMTVQENISMPIKEHLNLPADLIEHIVHTKIA---IVGLPPETANLMP---F 149

Query: 489 NLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQALSRLMQ--GRTTIVIAH 546
            LSGG  +R+++ARA+  D  +L LDE TS LD        + L +L    G +  +I H
Sbjct: 150 QLSGGMIKRVSLARALAIDPDLLFLDEPTSGLDPIAAEEFDKLLIKLRHSLGLSVYMITH 209

Query: 547 RISTII 552
            ++ +I
Sbjct: 210 DLNNLI 215

>gi|254780184|ref|YP_003064597.1| excinuclease ABC subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 959 Back     alignment
 Score = 42.7 bits (99), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 59/113 (52%), Gaps = 8/113 (7%)

Query: 453 MATEEEMIEIAKSANAHDFIMSLPQ---GYDTYVGENGSNLSGGQKQRIAIARAMLRD-- 507
           M  +E +   A     H+ + +L +   GY   +G++ + LSGG+ QR+ +A+ + +   
Sbjct: 807 MTVDESLDFFAAIPTIHNKLTTLKEVGLGY-IKIGQSANTLSGGESQRVKLAKELSKQAT 865

Query: 508 GHIL-VLDEATSALDTHTENLVRQALSRLM-QGRTTIVIAHRISTIIEADHII 558
           G+ L +LDE T+ L  H    +   L  L+ +G + IVI H +  I  AD I+
Sbjct: 866 GNTLYILDEPTTGLHYHDIAKLLNILHTLVDRGNSIIVIEHNLEVIKTADWIL 918

>gi|254780184|ref|YP_003064597.1| excinuclease ABC subunit A [Candidatus Liberibacter asiaticus str. psy62] Length = 959 Back     alignment
 Score = 36.2 bits (82), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 38/78 (48%), Gaps = 3/78 (3%)

Query: 486 NGSNLSGGQKQRIAIARAM--LRDGHILVLDEATSALDTHTENLVRQALSRLMQ-GRTTI 542
           N + LS G+ QRI +A  +     G + +LDE +  L       +   L  L   G T I
Sbjct: 500 NSNMLSNGESQRIRLASQIGSALTGVLYILDEPSIGLHQRDNTKLINTLKHLRDTGNTVI 559

Query: 543 VIAHRISTIIEADHIIFI 560
           V+ H   T++ ADHI+ I
Sbjct: 560 VVEHDEETMLAADHIVDI 577

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target596 ABC transporter, nucleotide binding/ATPase protein [Can
315122657590 ABC transporter, nucleotide binding/ATPase protein [Can 1 0.0
16519755586 ABC transporter ATP-binding protein y4gM [Sinorhizobium 1 0.0
15890388587 ABC transporter, nucleotide binding/ATPase protein [Agr 1 0.0
332715635587 ABC transporter nucleotide binding/ATPase protein [Agro 1 0.0
121602516588 ABC transporter, permease/ATP-binding protein [Bartonel 1 1e-180
319404956588 ABC transporter, ATP-binding protein [Bartonella sp. AR 1 1e-180
49473726588 ABC transporter, ATP-binding protein [Bartonella quinta 1 1e-178
240849724590 ABC transporter, ATP-binding protein [Bartonella graham 1 1e-178
163867350588 ABC transporter, ATP-binding protein [Bartonella triboc 1 1e-177
319403530588 ABC transporter, ATP-binding protein [Bartonella rochal 1 1e-177
>gi|315122657|ref|YP_004063146.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 590 Back     alignment and organism information
 Score = 1003 bits (2593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/590 (80%), Positives = 540/590 (91%)

Query: 7   VLDKVMSPSDREMLSRLIRENIHKHVTWYSMSIVAMITVSLMTSCSAWIMRDVMNAMVAS 66
           +LDK++S SDR+ LSRLI+EN+ KH  WYS SI+AM+TVS MTSCSAWIMRDVM+AMV+ 
Sbjct: 1   MLDKILSVSDRQTLSRLIKENVRKHAKWYSFSILAMVTVSFMTSCSAWIMRDVMDAMVSK 60

Query: 67  TDIFHVIVVSSTVAGIFIVKGIASFVQNYYLSCAGNSIIAEQQRKIYRRLLQYGMEFYDS 126
            D F ++ VSSTVA IF++KGIASFVQNYYLSCAGNSIIAEQQ+KIY RLLQYGM+FYD+
Sbjct: 61  NDFFRIVTVSSTVAAIFLIKGIASFVQNYYLSCAGNSIIAEQQKKIYHRLLQYGMDFYDN 120

Query: 127 NQSSELQVRFTHATQSVRSVVDIFITSFLRDFLTLVGLIVVMFLQEPTLSLCTIIIGPLC 186
           NQSSELQVRF HATQ++RSV+DI ITSF+RD L+L GL++VMF+QE TLSL T+IIGPLC
Sbjct: 121 NQSSELQVRFIHATQAIRSVLDILITSFVRDLLSLFGLVIVMFMQESTLSLFTLIIGPLC 180

Query: 187 ILGVRILVKRVRHIMEQGMVAIGHIIQNLQETVIGIRIVKSFAMEEVMNQRMCNMIKEVE 246
           I G+RILVK+VR IMEQGM AIG+IIQ LQET+IGIR+VKSFAMEE M++RMC+MIKEVE
Sbjct: 181 IFGIRILVKKVRRIMEQGMAAIGNIIQVLQETIIGIRVVKSFAMEESMSKRMCHMIKEVE 240

Query: 247 DRLNKVAKIESATSPIMETISGLSIAGIILFSGFLMSKKGTSNAGEIMSFITALLMAYEP 306
           +RLN V++IESATSPIMETISGLSIAGIILFSGFLMS +G+SN+G IMSFITALLMAYEP
Sbjct: 241 NRLNSVSRIESATSPIMETISGLSIAGIILFSGFLMSHQGSSNSGTIMSFITALLMAYEP 300

Query: 307 AKRIARTRIILEGGMVGVRCMFSLLDHPIMIEESPHAVNLPVGKGTTVFRDVFFSYKQGH 366
           AKRIARTRI+LEGGMVGVRCMFS+LDHPI I+ESP+A++LPVG+G  VFRDV FSYK  H
Sbjct: 301 AKRIARTRIVLEGGMVGVRCMFSILDHPITIKESPNAIDLPVGEGKIVFRDVSFSYKPEH 360

Query: 367 PVLSGINLCFKSGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGINIRDITFSSLR 426
           PVLSGINLCF  GKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDG N+RDITFSSLR
Sbjct: 361 PVLSGINLCFHPGKMTALVGPSGSGKSTIINLLMRMYDPSSGSIEIDGHNVRDITFSSLR 420

Query: 427 ERISYVGQDVFLFSNTVRYNILIGRPMATEEEMIEIAKSANAHDFIMSLPQGYDTYVGEN 486
           ERISYVGQDVFLFSNTVRYNI++GR  ATEEEMIEI+K ANAHDFIM+LPQGYDT VGEN
Sbjct: 421 ERISYVGQDVFLFSNTVRYNIMVGRSTATEEEMIEISKFANAHDFIMNLPQGYDTQVGEN 480

Query: 487 GSNLSGGQKQRIAIARAMLRDGHILVLDEATSALDTHTENLVRQALSRLMQGRTTIVIAH 546
           GS LSGGQKQRIAIARAMLR+GHIL+LDEATSALDTH ENL+RQAL+RLM+GRTTIVIAH
Sbjct: 481 GSALSGGQKQRIAIARAMLRNGHILLLDEATSALDTHAENLIRQALARLMKGRTTIVIAH 540

Query: 547 RISTIIEADHIIFIEDGKVSESGDQKYLLQQKDGSLYKKMYASQLLENLS 596
           R+STI +AD I+FIE+G+VSE+GDQK LLQQK   LYKKMY SQ+++NLS
Sbjct: 541 RVSTITDADQIVFIENGRVSETGDQKNLLQQKSDGLYKKMYVSQVIDNLS 590


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|16519755|ref|NP_443875.1| ABC transporter ATP-binding protein y4gM [Sinorhizobium fredii NGR234] Length = 586 Back     alignment and organism information
>gi|15890388|ref|NP_356060.1| ABC transporter, nucleotide binding/ATPase protein [Agrobacterium tumefaciens str. C58] Length = 587 Back     alignment and organism information
>gi|332715635|ref|YP_004443101.1| ABC transporter nucleotide binding/ATPase protein [Agrobacterium sp. H13-3] Length = 587 Back     alignment and organism information
>gi|121602516|ref|YP_989589.1| ABC transporter, permease/ATP-binding protein [Bartonella bacilliformis KC583] Length = 588 Back     alignment and organism information
>gi|319404956|emb|CBI78558.1| ABC transporter, ATP-binding protein [Bartonella sp. AR 15-3] Length = 588 Back     alignment and organism information
>gi|49473726|ref|YP_031768.1| ABC transporter, ATP-binding protein [Bartonella quintana str. Toulouse] Length = 588 Back     alignment and organism information
>gi|240849724|ref|YP_002971112.1| ABC transporter, ATP-binding protein [Bartonella grahamii as4aup] Length = 590 Back     alignment and organism information
>gi|163867350|ref|YP_001608544.1| ABC transporter, ATP-binding protein [Bartonella tribocorum CIP 105476] Length = 588 Back     alignment and organism information
>gi|319403530|emb|CBI77111.1| ABC transporter, ATP-binding protein [Bartonella rochalimae ATCC BAA-1498] Length = 588 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target596 ABC transporter, nucleotide binding/ATPase protein [Can
TIGR02203571 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-bin 1e-116
KOG0058716 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superf 1e-113
KOG00551228 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter 1e-102
COG2274709 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporte 2e-93
COG4988559 COG4988, CydD, ABC-type transport system involved in cy 7e-80
TIGR01846694 TIGR01846, type_I_sec_HlyB, type I secretion system ABC 6e-78
KOG0057591 KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster e 1e-72
KOG00541381 KOG0054, KOG0054, KOG0054, Multidrug resistance-associa 7e-72
COG4987573 COG4987, CydC, ABC-type transport system involved in cy 6e-66
TIGR01193708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transp 2e-62
COG4618580 COG4618, ArpD, ABC-type protease/lipase transport syste 1e-51
TIGR009571522 TIGR00957, MRP_assoc_pro, multi drug resistance-associa 6e-48
PTZ002651466 PTZ00265, PTZ00265, multidrug resistance protein (mdr1) 2e-35
COG1132567 COG1132, MdlB, ABC-type multidrug transport system, ATP 1e-119
TIGR02204576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-bind 2e-99
KOG0055 1228 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter 6e-94
PRK11176582 PRK11176, PRK11176, lipid transporter ATP-binding/perme 3e-90
KOG0056790 KOG0056, KOG0056, KOG0056, Heavy metal exporter HMT1, A 7e-85
TIGR00958711 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Famil 4e-84
COG5265497 COG5265, ATM1, ABC-type transport system involved in Fe 7e-73
PRK10789569 PRK10789, PRK10789, putative multidrug transporter memb 7e-72
TIGR03375694 TIGR03375, type_I_sec_LssB, type I secretion system ATP 9e-69
TIGR03796710 TIGR03796, NHPM_micro_ABC1, NHPM bacteriocin system ABC 1e-65
TIGR03797686 TIGR03797, NHPM_micro_ABC2, NHPM bacteriocin system ABC 1e-46
KOG0054 1381 KOG0054, KOG0054, KOG0054, Multidrug resistance-associa 1e-45
PTZ00265 1466 PTZ00265, PTZ00265, multidrug resistance protein (mdr1) 1e-43
COG4615546 COG4615, PvdE, ABC-type siderophore export system, fuse 2e-24
TIGR01194555 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter 8e-20
cd03251234 cd03251, ABCC_MsbA, MsbA is an essential ABC transporte 1e-86
cd03249238 cd03249, ABC_MTABC3_MDL1_MDL2, MTABC3 (also known as AB 4e-86
cd03254229 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP 5e-84
cd03253236 cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transpor 8e-84
cd03228171 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Pr 8e-61
cd03248226 cd03248, ABCC_TAP, TAP, the Transporter Associated with 3e-60
cd03252237 cd03252, ABCC_Hemolysin, The ABC-transporter hemolysin 9e-60
PRK11174588 PRK11174, PRK11174, cysteine/glutathione ABC transporte 6e-57
cd03245220 cd03245, ABCC_bacteriocin_exporters, ABC-type bacterioc 1e-56
PRK11160574 PRK11160, PRK11160, cysteine/glutathione ABC transporte 3e-56
cd03244221 cd03244, ABCC_MRP_domain2, Domain 2 of the ABC subfamil 5e-55
TIGR01842544 TIGR01842, type_I_sec_PrtD, type I secretion system ABC 4e-51
cd03250204 cd03250, ABCC_MRP_domain1, Domain 1 of the ABC subfamil 3e-40
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family member; Pr 3e-39
cd03246173 cd03246, ABCC_Protease_Secretion, This family represent 2e-37
PLN032321495 PLN03232, PLN03232, ABC transporter C family member; Pr 7e-37
cd03288257 cd03288, ABCC_SUR2, The SUR domain 2 8e-36
cd03369207 cd03369, ABCC_NFT1, Domain 2 of NFT1 (New full-length M 2e-35
cd03225211 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC c 2e-35
COG1122235 COG1122, CbiO, ABC-type cobalt transport system, ATPase 6e-35
COG1131293 COG1131, CcmA, ABC-type multidrug transport system, ATP 1e-34
COG1136226 COG1136, SalX, ABC-type antimicrobial peptide transport 2e-34
cd03247178 cd03247, ABCC_cytochrome_bd, The CYD subfamily implicat 1e-33
COG1126240 COG1126, GlnQ, ABC-type polar amino acid transport syst 2e-33
cd03255218 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is compris 6e-33
COG1120258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores tra 8e-33
cd03295242 cd03295, ABC_OpuCA_Osmoprotection, OpuCA is a the ATP b 1e-32
cd03229178 cd03229, ABC_Class3, This class is comprised of all BPD 5e-32
cd03259213 cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and So 7e-32
cd03260227 cd03260, ABC_PstB_phosphate_transporter, Phosphate upta 9e-32
COG3842 352 COG3842, PotA, ABC-type spermidine/putrescine transport 2e-31
cd03258233 cd03258, ABC_MetN_methionine_transporter, MetN (also kn 6e-31
cd00267157 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transpo 9e-31
cd03261235 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding ca 2e-30
COG1121254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase 2e-30
PTZ002431560 PTZ00243, PTZ00243, ABC transporter; Provisional 2e-30
cd03262213 cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the 4e-30
COG1125309 COG1125, OpuBA, ABC-type proline/glycine betaine transp 5e-30
TIGR03608206 TIGR03608, L_ocin_972_ABC, putative bacteriocin export 5e-30
cd03214180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transport 1e-29
COG1116248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate t 2e-29
PRK14250241 PRK14250, PRK14250, phosphate ABC transporter ATP-bindi 3e-29
COG3839338 COG3839, MalK, ABC-type sugar transport systems, ATPase 8e-29
cd03256241 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosp 8e-29
COG1135339 COG1135, AbcC, ABC-type metal ion transport system, ATP 8e-29
cd03235213 cd03235, ABC_Metallic_Cations, ABC component of the met 8e-29
COG1123539 COG1123, COG1123, ATPase components of various ABC-type 1e-28
COG1118345 COG1118, CysA, ABC-type sulfate/molybdate transport sys 1e-28
TIGR00957 1522 TIGR00957, MRP_assoc_pro, multi drug resistance-associa 1e-28
PLN03130 1622 PLN03130, PLN03130, ABC transporter C family member; Pr 1e-28
cd03226205 cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC 2e-28
cd03230173 cd03230, ABC_DR_subfamily_A, This family of ATP-binding 2e-28
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 2e-28
cd03257228 cd03257, ABC_NikE_OppD_transporters, The ABC transporte 3e-28
COG1129 500 COG1129, MglA, ABC-type sugar transport system, ATPase 3e-28
cd03293220 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are 1e-27
cd03289275 cd03289, ABCC_CFTR2, The CFTR subfamily domain 2 2e-27
TIGR02315243 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-b 2e-27
COG1127263 COG1127, Ttg2A, ABC-type transport system involved in r 3e-27
cd03290218 cd03290, ABCC_SUR1_N, The SUR domain 1 9e-27
COG3638258 COG3638, COG3638, ABC-type phosphate/phosphonate transp 1e-26
cd03296239 cd03296, ABC_CysA_sulfate_importer, Part of the ABC tra 1e-26
COG1117253 COG1117, PstB, ABC-type phosphate transport system, ATP 1e-26
cd03292214 cd03292, ABC_FtsE_transporter, FtsE is a hydrophilic nu 1e-26
PRK13632271 PRK13632, cbiO, cobalt transporter ATP-binding subunit; 1e-26
COG3840231 COG3840, ThiQ, ABC-type thiamine transport system, ATPa 3e-26
COG2884223 COG2884, FtsE, Predicted ATPase involved in cell divisi 3e-26
cd03264211 cd03264, ABC_drug_resistance_like, ABC-type multidrug t 5e-26
COG1123 539 COG1123, COG1123, ATPase components of various ABC-type 7e-26
TIGR02673214 TIGR02673, FtsE, cell division ATP-binding protein FtsE 1e-25
PRK10535 648 PRK10535, PRK10535, macrolide transporter ATP-binding / 1e-25
TIGR01277213 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding 2e-25
cd03294269 cd03294, ABC_Pro_Gly_Bertaine, This family comprises th 8e-25
KOG0061 613 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily 8e-25
TIGR00968237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-bind 8e-25
cd03291282 cd03291, ABCC_CFTR1, The CFTR subfamily domain 1 2e-24
cd03213194 cd03213, ABCG_EPDR, ABCG transporters are involved in e 2e-24
TIGR00972247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP- 2e-24
PRK13640282 PRK13640, cbiO, cobalt transporter ATP-binding subunit; 2e-24
COG1124252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel t 3e-24
COG4148 352 COG4148, ModC, ABC-type molybdate transport system, ATP 6e-24
PRK13647274 PRK13647, cbiO, cobalt transporter ATP-binding subunit; 7e-24
cd03263220 cd03263, ABC_subfamily_A, The ABCA subfamily mediates t 1e-23
TIGR01186 363 TIGR01186, proV, glycine betaine/L-proline transport AT 1e-23
cd03298211 cd03298, ABC_ThiQ_thiamine_transporter, ABC-type thiami 2e-23
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transport sy 2e-23
COG4608268 COG4608, AppF, ABC-type oligopeptide transport system, 3e-23
COG0444316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel t 4e-23
PRK11264250 PRK11264, PRK11264, putative amino-acid ABC transporter 4e-23
cd03224222 cd03224, ABC_TM1139_LivF_branched, LivF (TM1139) is par 5e-23
cd03299235 cd03299, ABC_ModC_like, Archeal protein closely related 5e-23
PRK13648269 PRK13648, cbiO, cobalt transporter ATP-binding subunit; 5e-23
COG4175 386 COG4175, ProV, ABC-type proline/glycine betaine transpo 7e-23
PRK13631320 PRK13631, cbiO, cobalt transporter ATP-binding subunit; 9e-23
cd03219236 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC 2e-22
COG4619223 COG4619, COG4619, ABC-type uncharacterized transport sy 2e-22
cd03234226 cd03234, ABCG_White, The White subfamily represents ABC 2e-22
TIGR01271 1490 TIGR01271, CFTR_protein, cystic fibrosis transmembrane 2e-22
PRK09493240 PRK09493, glnQ, glutamine ABC transporter ATP-binding p 2e-22
cd03297214 cd03297, ABC_ModC_molybdenum_transporter, ModC is an AB 3e-22
cd03301213 cd03301, ABC_MalK_N, The N-terminal ATPase domain of th 3e-22
COG4604252 COG4604, CeuD, ABC-type enterochelin transport system, 3e-22
PRK13646286 PRK13646, cbiO, cobalt transporter ATP-binding subunit; 3e-22
PRK11153343 PRK11153, metN, DL-methionine transporter ATP-binding s 4e-22
PRK13635279 PRK13635, cbiO, cobalt transporter ATP-binding subunit; 4e-22
TIGR02142 354 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-bi 1e-21
PRK15439 510 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-b 1e-21
TIGR03265 353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC 2e-21
PRK13639275 PRK13639, cbiO, cobalt transporter ATP-binding subunit; 4e-21
PRK14244251 PRK14244, PRK14244, phosphate ABC transporter ATP-bindi 4e-21
TIGR02982220 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding su 4e-21
COG4559259 COG4559, COG4559, ABC-type hemin transport system, ATPa 5e-21
COG0410237 COG0410, LivF, ABC-type branched-chain amino acid trans 5e-21
TIGR03873256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transpor 5e-21
COG4172534 COG4172, COG4172, ABC-type uncharacterized transport sy 6e-21
cd03300232 cd03300, ABC_PotA_N, PotA is an ABC-type transporter an 6e-21
PRK13649280 PRK13649, cbiO, cobalt transporter ATP-binding subunit; 8e-21
PRK10619257 PRK10619, PRK10619, histidine/lysine/arginine/ornithine 1e-20
TIGR00955 617 TIGR00955, 3a01204, The Eye Pigment Precursor Transport 1e-20
COG4555245 COG4555, NatA, ABC-type Na+ transport system, ATPase co 2e-20
PRK13637287 PRK13637, cbiO, cobalt transporter ATP-binding subunit; 2e-20
COG4598256 COG4598, HisP, ABC-type histidine transport system, ATP 3e-20
COG0488530 COG0488, Uup, ATPase components of ABC transporters wit 3e-20
PRK14236272 PRK14236, PRK14236, phosphate transporter ATP-binding p 3e-20
cd03266218 cd03266, ABC_NatA_sodium_exporter, NatA is the ATPase c 6e-20
KOG0065 1391 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance 7e-20
COG1119257 COG1119, ModF, ABC-type molybdenum transport system, AT 7e-20
PRK13539207 PRK13539, PRK13539, cytochrome c biogenesis protein Ccm 7e-20
TIGR02314343 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP- 7e-20
cd03268208 cd03268, ABC_BcrA_bacitracin_resist, The BcrA subfamily 1e-19
COG0488 530 COG0488, Uup, ATPase components of ABC transporters wit 2e-19
COG0411250 COG0411, LivG, ABC-type branched-chain amino acid trans 2e-19
PRK13634290 PRK13634, cbiO, cobalt transporter ATP-binding subunit; 2e-19
PRK14237267 PRK14237, PRK14237, phosphate transporter ATP-binding p 2e-19
PRK11231255 PRK11231, fecE, iron-dicitrate transporter ATP-binding 2e-19
PRK14240250 PRK14240, PRK14240, phosphate transporter ATP-binding p 2e-19
PRK14242253 PRK14242, PRK14242, phosphate transporter ATP-binding p 3e-19
PRK14251251 PRK14251, PRK14251, phosphate ABC transporter ATP-bindi 3e-19
PRK14262250 PRK14262, PRK14262, phosphate ABC transporter ATP-bindi 3e-19
PRK11432 351 PRK11432, fbpC, ferric transporter ATP-binding subunit; 4e-19
PRK10771232 PRK10771, thiQ, thiamine transporter ATP-binding subuni 5e-19
PRK11124242 PRK11124, artP, arginine transporter ATP-binding subuni 5e-19
PRK10851 353 PRK10851, PRK10851, sulfate/thiosulfate transporter sub 6e-19
PRK13548258 PRK13548, hmuV, hemin importer ATP-binding subunit; Pro 6e-19
PRK10247225 PRK10247, PRK10247, putative ABC transporter ATP-bindin 7e-19
TIGR02769265 TIGR02769, nickel_nikE, nickel import ATP-binding prote 9e-19
PRK10744260 PRK10744, pstB, phosphate transporter ATP-binding prote 1e-18
COG0396251 COG0396, SufC, ABC-type transport system involved in Fe 2e-18
PRK14269246 PRK14269, PRK14269, phosphate ABC transporter ATP-bindi 2e-18
PRK14264305 PRK14264, PRK14264, phosphate ABC transporter ATP-bindi 2e-18
TIGR03864236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding su 2e-18
PRK13651305 PRK13651, PRK13651, cobalt transporter ATP-binding subu 2e-18
COG4161242 COG4161, ArtP, ABC-type arginine transport system, ATPa 3e-18
PRK13644274 PRK13644, cbiO, cobalt transporter ATP-binding subunit; 3e-18
PRK10070 400 PRK10070, PRK10070, glycine betaine transporter ATP-bin 3e-18
COG4181228 COG4181, COG4181, Predicted ABC-type transport system i 4e-18
PRK09536 402 PRK09536, btuD, corrinoid ABC transporter ATPase; Revie 4e-18
PRK14252265 PRK14252, PRK14252, phosphate ABC transporter ATP-bindi 6e-18
PRK14257329 PRK14257, PRK14257, phosphate ABC transporter ATP-bindi 8e-18
PRK10522547 PRK10522, PRK10522, multidrug transporter membrane comp 8e-18
PRK11247257 PRK11247, ssuB, aliphatic sulfonates transport ATP-bind 9e-18
PRK13645289 PRK13645, cbiO, cobalt transporter ATP-binding subunit; 9e-18
PRK13641287 PRK13641, cbiO, cobalt transporter ATP-binding subunit; 9e-18
cd03218232 cd03218, ABC_YhbG, The ABC transporters belonging to th 1e-17
TIGR03410230 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-b 1e-17
PRK13537306 PRK13537, PRK13537, nodulation ABC transporter NodI; Pr 1e-17
PRK14239252 PRK14239, PRK14239, phosphate transporter ATP-binding p 1e-17
TIGR03005252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC tra 1e-17
TIGR03258 362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport 1e-17
PRK14255252 PRK14255, PRK14255, phosphate ABC transporter ATP-bindi 1e-17
PRK14254285 PRK14254, PRK14254, phosphate ABC transporter ATP-bindi 1e-17
PRK11308327 PRK11308, dppF, dipeptide transporter ATP-binding subun 1e-17
COG4525259 COG4525, TauB, ABC-type taurine transport system, ATPas 2e-17
PRK13652277 PRK13652, cbiO, cobalt transporter ATP-binding subunit; 2e-17
PRK14266250 PRK14266, PRK14266, phosphate ABC transporter ATP-bindi 2e-17
TIGR01187 325 TIGR01187, potA, spermidine/putrescine ABC transporter 2e-17
TIGR02211221 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, 2e-17
PRK11144 352 PRK11144, modC, molybdate transporter ATP-binding prote 2e-17
PRK14245250 PRK14245, PRK14245, phosphate ABC transporter ATP-bindi 2e-17
PRK09452 375 PRK09452, potA, putrescine/spermidine ABC transporter A 3e-17
PRK14249251 PRK14249, PRK14249, phosphate ABC transporter ATP-bindi 3e-17
PRK14247250 PRK14247, PRK14247, phosphate ABC transporter ATP-bindi 5e-17
COG4178604 COG4178, COG4178, ABC-type uncharacterized transport sy 6e-17
PRK13650279 PRK13650, cbiO, cobalt transporter ATP-binding subunit; 6e-17
PRK14270251 PRK14270, PRK14270, phosphate ABC transporter ATP-bindi 7e-17
cd03217200 cd03217, ABC_FeS_Assembly, ABC-type transport system in 1e-16
cd03216163 cd03216, ABC_Carb_Monos_I, This family represents the d 1e-16
COG4167267 COG4167, SapF, ABC-type antimicrobial peptide transport 1e-16
PRK14272252 PRK14272, PRK14272, phosphate ABC transporter ATP-bindi 1e-16
TIGR01288303 TIGR01288, nodI, ATP-binding ABC transporter family nod 2e-16
TIGR01184230 TIGR01184, ntrCD, nitrate transport ATP-binding subunit 2e-16
PRK14253249 PRK14253, PRK14253, phosphate ABC transporter ATP-bindi 2e-16
PRK14235267 PRK14235, PRK14235, phosphate transporter ATP-binding p 3e-16
TIGR01257 2272 TIGR01257, rim_protein, retinal-specific rim ABC transp 3e-16
COG1134249 COG1134, TagH, ABC-type polysaccharide/polyol phosphate 5e-16
cd03265220 cd03265, ABC_DrrA, DrrA is the ATP-binding protein comp 5e-16
PRK10253265 PRK10253, PRK10253, iron-enterobactin transporter ATP-b 6e-16
PRK13636283 PRK13636, cbiO, cobalt transporter ATP-binding subunit; 7e-16
PRK14274259 PRK14274, PRK14274, phosphate ABC transporter ATP-bindi 7e-16
PRK10575265 PRK10575, PRK10575, iron-hydroxamate transporter ATP-bi 8e-16
COG1137243 COG1137, YhbG, ABC-type (unclassified) transport system 9e-16
COG1101263 COG1101, PhnK, ABC-type uncharacterized transport syste 1e-15
PRK14238271 PRK14238, PRK14238, phosphate transporter ATP-binding p 1e-15
PRK09984262 PRK09984, PRK09984, phosphonate/organophosphate ester t 1e-15
PRK14271276 PRK14271, PRK14271, phosphate ABC transporter ATP-bindi 1e-15
cd03220224 cd03220, ABC_KpsT_Wzt, ABC_KpsT_Wzt The KpsT/Wzt ABC tr 2e-15
PRK15056272 PRK15056, PRK15056, manganese/iron transporter ATP-bind 2e-15
PRK14248268 PRK14248, PRK14248, phosphate ABC transporter ATP-bindi 3e-15
TIGR02770230 TIGR02770, nickel_nikD, nickel import ATP-binding prote 4e-15
cd03269210 cd03269, ABC_putative_ATPase, This subfamily is involve 5e-15
PRK11000 369 PRK11000, PRK11000, maltose/maltodextrin transporter AT 6e-15
PRK14256252 PRK14256, PRK14256, phosphate ABC transporter ATP-bindi 6e-15
COG4172 534 COG4172, COG4172, ABC-type uncharacterized transport sy 7e-15
PRK13633280 PRK13633, PRK13633, cobalt transporter ATP-binding subu 7e-15
PRK11288 501 PRK11288, araG, L-arabinose transporter ATP-binding pro 8e-15
PRK14261253 PRK14261, PRK14261, phosphate ABC transporter ATP-bindi 8e-15
COG4586325 COG4586, COG4586, ABC-type uncharacterized transport sy 1e-14
PRK15134529 PRK15134, PRK15134, microcin C ABC transporter ATP-bind 1e-14
PRK13643288 PRK13643, cbiO, cobalt transporter ATP-binding subunit; 1e-14
TIGR01188302 TIGR01188, drrA, daunorubicin resistance ABC transporte 1e-14
PRK10762 501 PRK10762, PRK10762, D-ribose transporter ATP binding pr 1e-14
PRK14246257 PRK14246, PRK14246, phosphate ABC transporter ATP-bindi 1e-14
TIGR03740223 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic 2e-14
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-bindin 2e-14
PRK14273254 PRK14273, PRK14273, phosphate ABC transporter ATP-bindi 2e-14
PRK14267253 PRK14267, PRK14267, phosphate ABC transporter ATP-bindi 4e-14
cd03223166 cd03223, ABCD_peroxisomal_ALDP, Peroxisomal ATP-binding 5e-14
TIGR03269 520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase 5e-14
PRK13638271 PRK13638, cbiO, cobalt transporter ATP-binding subunit; 9e-14
COG4138248 COG4138, BtuD, ABC-type cobalamin transport system, ATP 1e-13
PLN03211 659 PLN03211, PLN03211, ABC transporter G-25; Provisional 1e-13
PRK09700 510 PRK09700, PRK09700, D-allose transporter ATP-binding pr 1e-13
COG4152300 COG4152, COG4152, ABC-type uncharacterized transport sy 3e-13
PRK14275286 PRK14275, PRK14275, phosphate ABC transporter ATP-bindi 3e-13
cd03233202 cd03233, ABC_PDR_domain1, The pleiotropic drug resistan 4e-13
cd03267236 cd03267, ABC_NatA_like, Similar in sequence to NatA, th 4e-13
TIGR03415 382 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP 4e-13
cd03215182 cd03215, ABC_Carb_Monos_II, This family represents doma 6e-13
PRK13549 506 PRK13549, PRK13549, xylose transporter ATP-binding subu 6e-13
KOG0065 1391 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance 8e-13
COG3845501 COG3845, COG3845, ABC-type uncharacterized transport sy 1e-12
cd03232192 cd03232, ABC_PDR_domain2, The pleiotropic drug resistan 1e-12
TIGR03771223 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC trans 1e-12
TIGR01978243 TIGR01978, sufC, FeS assembly ATPase SufC 2e-12
PRK13642277 PRK13642, cbiO, cobalt transporter ATP-binding subunit; 2e-12
PRK14268258 PRK14268, PRK14268, phosphate ABC transporter ATP-bindi 2e-12
cd03237246 cd03237, ABC_RNaseL_inhibitor_domain2, The ATPase domai 4e-12
COG1245591 COG1245, COG1245, Predicted ATPase, RNase L inhibitor ( 4e-12
COG1129500 COG1129, MglA, ABC-type sugar transport system, ATPase 5e-12
KOG0927614 KOG0927, KOG0927, KOG0927, Predicted transporter (ABC s 5e-12
cd03231201 cd03231, ABC_CcmA_heme_exporter, CcmA, the ATP-binding 1e-11
cd03271261 cd03271, ABC_UvrA_II, The excision repair protein UvrA 1e-11
TIGR03269520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase 2e-11
PRK09580248 PRK09580, sufC, cysteine desulfurase ATPase component; 2e-11
PRK03695248 PRK03695, PRK03695, vitamin B12-transporter ATPase; Pro 2e-11
PRK13547272 PRK13547, hmuV, hemin importer ATP-binding subunit; Pro 2e-11
PRK14263261 PRK14263, PRK14263, phosphate ABC transporter ATP-bindi 3e-11
PRK10982 491 PRK10982, PRK10982, galactose/methyl galaxtoside transp 4e-11
KOG0062582 KOG0062, KOG0062, KOG0062, ATPase component of ABC tran 5e-11
COG1245 591 COG1245, COG1245, Predicted ATPase, RNase L inhibitor ( 6e-11
PRK15112267 PRK15112, PRK15112, antimicrobial peptide ABC system AT 1e-10
PRK11300255 PRK11300, livG, leucine/isoleucine/valine transporter A 1e-10
PRK10261 623 PRK10261, PRK10261, glutathione transporter ATP-binding 1e-10
TIGR03522301 TIGR03522, GldA_ABC_ATP, gliding motility-associated AB 1e-10
COG2401593 COG2401, COG2401, ABC-type ATPase fused to a predicted 2e-10
PRK15079331 PRK15079, PRK15079, oligopeptide ABC transporter ATP-bi 2e-10
PRK10584228 PRK10584, PRK10584, putative ABC transporter ATP-bindin 3e-10
CHL00131252 CHL00131, ycf16, sulfate ABC transporter protein; Valid 5e-10
KOG0066807 KOG0066, KOG0066, KOG0066, eIF2-interacting protein ABC 6e-10
COG4674249 COG4674, COG4674, Uncharacterized ABC-type transport sy 6e-10
KOG2355291 KOG2355, KOG2355, KOG2355, Predicted ABC-type transport 7e-10
PLN03073718 PLN03073, PLN03073, ABC transporter F family; Provision 9e-10
smart00382148 smart00382, AAA, ATPases associated with a variety of c 1e-09
PRK13545 549 PRK13545, tagH, teichoic acids export protein ATP-bindi 2e-09
TIGR03719552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, 2e-09
KOG0064728 KOG0064, KOG0064, KOG0064, Peroxisomal long-chain acyl- 4e-09
PLN03140 1470 PLN03140, PLN03140, ABC transporter G family member; Pr 4e-09
PRK11022326 PRK11022, dppD, dipeptide transporter ATP-binding subun 5e-09
COG4170330 COG4170, SapD, ABC-type antimicrobial peptide transport 8e-09
PRK10418254 PRK10418, nikD, nickel transporter ATP-binding protein 8e-09
TIGR02633 500 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding 9e-09
KOG0927 614 KOG0927, KOG0927, KOG0927, Predicted transporter (ABC s 3e-08
TIGR02323253 TIGR02323, CP_lyasePhnK, phosphonate C-P lyase system p 3e-08
PRK15134 529 PRK15134, PRK15134, microcin C ABC transporter ATP-bind 6e-08
COG4107258 COG4107, PhnK, ABC-type phosphonate transport system, A 2e-07
cd03238176 cd03238, ABC_UvrA, The excision repair protein UvrA; Nu 2e-07
cd03278197 cd03278, ABC_SMC_barmotin, Barmotin is a tight junction 5e-07
cd03240204 cd03240, ABC_Rad50, The catalytic domains of Rad50 are 7e-07
TIGR00954659 TIGR00954, 3a01203, Peroxysomal Fatty Acyl CoA Transpor 7e-07
PRK11701258 PRK11701, phnK, phosphonate C-P lyase system protein Ph 1e-06
PRK13546264 PRK13546, PRK13546, teichoic acids export protein ATP-b 2e-06
KOG0066 807 KOG0066, KOG0066, KOG0066, eIF2-interacting protein ABC 1e-05
PLN03140 1470 PLN03140, PLN03140, ABC transporter G family member; Pr 1e-05
KOG0063592 KOG0063, KOG0063, KOG0063, RNAse L inhibitor, ABC super 2e-05
PRK15064530 PRK15064, PRK15064, ABC transporter ATP-binding protein 2e-05
PRK10636638 PRK10636, PRK10636, putative ABC transporter ATP-bindin 2e-05
PRK10938 490 PRK10938, PRK10938, putative molybdenum transport ATP-b 4e-05
cd03227162 cd03227, ABC_Class2, ABC-type Class 2 contains systems 1e-04
PRK09700510 PRK09700, PRK09700, D-allose transporter ATP-binding pr 3e-04
PRK11288501 PRK11288, araG, L-arabinose transporter ATP-binding pro 0.002
PRK15093330 PRK15093, PRK15093, antimicrobial peptide ABC transport 0.003
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transpor 3e-82
TIGR012711490 TIGR01271, CFTR_protein, cystic fibrosis transmembrane 8e-26
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) F 5e-13
TIGR01192585 TIGR01192, chvA, glucan exporter ATP-binding protein 6e-71
PRK10790592 PRK10790, PRK10790, putative multidrug transporter memb 3e-55
PLN03232 1495 PLN03232, PLN03232, ABC transporter C family member; Pr 5e-27
TIGR02857529 TIGR02857, CydD, thiol reductant ABC exporter, CydD sub 2e-68
TIGR02868529 TIGR02868, CydC, thiol reductant ABC exporter, CydC sub 1e-51
pfam00664275 pfam00664, ABC_membrane, ABC transporter transmembrane 3e-26
pfam00005119 pfam00005, ABC_tran, ABC transporter 7e-23
PRK11248255 PRK11248, tauB, taurine transporter ATP-binding subunit 2e-18
PRK14259269 PRK14259, PRK14259, phosphate ABC transporter ATP-bindi 2e-15
PRK10419268 PRK10419, nikE, nickel transporter ATP-binding protein 2e-14
COG4136213 COG4136, COG4136, ABC-type uncharacterized transport sy 1e-13
PRK09544251 PRK09544, znuC, high-affinity zinc transporter ATPase; 1e-13
COG4133209 COG4133, CcmA, ABC-type transport system involved in cy 3e-13
PRK11607 377 PRK11607, potG, putrescine transporter ATP-binding subu 4e-13
COG4778235 COG4778, PhnL, ABC-type phosphonate transport system, A 8e-13
PRK14241258 PRK14241, PRK14241, phosphate transporter ATP-binding p 1e-12
TIGR01189198 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein 1e-10
PRK10261623 PRK10261, PRK10261, glutathione transporter ATP-binding 6e-10
PRK11614237 PRK11614, livF, leucine/isoleucine/valine transporter A 3e-09
PRK13538204 PRK13538, PRK13538, cytochrome c biogenesis protein Ccm 3e-08
PRK13543214 PRK13543, PRK13543, cytochrome c biogenesis protein Ccm 4e-08
PRK15064 530 PRK15064, PRK15064, ABC transporter ATP-binding protein 1e-06
TIGR03411242 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-b 2e-06
PRK13541195 PRK13541, PRK13541, cytochrome c biogenesis protein Ccm 5e-05
PRK09473330 PRK09473, oppD, oligopeptide transporter ATP-binding co 2e-04
TIGR012572272 TIGR01257, rim_protein, retinal-specific rim ABC transp 3e-04
PRK13536340 PRK13536, PRK13536, nodulation factor exporter subunit 3e-21
TIGR00960216 TIGR00960, 3a0501s02, Type II (General) Secretory Pathw 1e-19
TIGR02324224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system p 1e-17
PRK11650 356 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-bi 1e-15
PRK14260259 PRK14260, PRK14260, phosphate ABC transporter ATP-bindi 5e-14
PRK14258261 PRK14258, PRK14258, phosphate ABC transporter ATP-bindi 7e-14
PRK11629233 PRK11629, lolD, lipoprotein transporter ATP-binding sub 2e-13
PRK10908222 PRK10908, PRK10908, cell division protein FtsE; Provisi 3e-12
KOG0062 582 KOG0062, KOG0062, KOG0062, ATPase component of ABC tran 1e-10
PRK10895241 PRK10895, PRK10895, lipopolysaccharide ABC transporter 3e-10
PRK13540200 PRK13540, PRK13540, cytochrome c biogenesis protein Ccm 1e-08
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) F 3e-08
TIGR03719 552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, 7e-08
PRK10938490 PRK10938, PRK10938, putative molybdenum transport ATP-b 5e-06
TIGR01166190 TIGR01166, cbiO, cobalt transport protein ATP-binding s 3e-20
PRK14243264 PRK14243, PRK14243, phosphate transporter ATP-binding p 5e-14
KOG0059885 KOG0059, KOG0059, KOG0059, Lipid exporter ABCA1 and rel 1e-13
PRK14265274 PRK14265, PRK14265, phosphate ABC transporter ATP-bindi 3e-12
PRK13409590 PRK13409, PRK13409, putative ATPase RIL; Provisional 4e-12
KOG0060659 KOG0060, KOG0060, KOG0060, Long-chain acyl-CoA transpor 2e-10
cd03236255 cd03236, ABC_RNaseL_inhibitor_domain1, The ATPase domai 4e-10
PRK11819 556 PRK11819, PRK11819, putative ABC transporter ATP-bindin 8e-06
PRK11819556 PRK11819, PRK11819, putative ABC transporter ATP-bindin 1e-05
KOG0063 592 KOG0063, KOG0063, KOG0063, RNAse L inhibitor, ABC super 0.002
cd03279213 cd03279, ABC_sbcCD, SbcCD and other Mre11/Rad50 (MR) co 0.002
cd03221144 cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3 8e-09
PRK13409 590 PRK13409, PRK13409, putative ATPase RIL; Provisional 1e-08
COG0178935 COG0178, UvrA, Excinuclease ATPase subunit [DNA replica 4e-08
TIGR00630924 TIGR00630, uvra, excinuclease ABC, A subunit 1e-07
PRK00635 1809 PRK00635, PRK00635, excinuclease ABC subunit A; Provisi 7e-06
cd03270226 cd03270, ABC_UvrA_I, The excision repair protein UvrA d 1e-05
cd03222177 cd03222, ABC_RNaseL_inhibitor, The ABC ATPase RNase L i 2e-05
PRK11147 635 PRK11147, PRK11147, ABC transporter ATPase component; R 1e-04
PRK006351809 PRK00635, PRK00635, excinuclease ABC subunit A; Provisi 2e-04
PRK11147635 PRK11147, PRK11147, ABC transporter ATPase component; R 8e-04
PRK00349943 PRK00349, uvrA, excinuclease ABC subunit A; Reviewed 9e-04
PLN03073 718 PLN03073, PLN03073, ABC transporter F family; Provision 0.001
COG0419908 COG0419, SbcC, ATPase involved in DNA repair [DNA repli 0.002
TIGR02633500 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding 0.002
COG0178 935 COG0178, UvrA, Excinuclease ATPase subunit [DNA replica 1e-06
TIGR00630 924 TIGR00630, uvra, excinuclease ABC, A subunit 7e-05
cd03221144 cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3 5e-06
cd00071137 cd00071, GMPK, Guanosine monophosphate kinase (GMPK, EC 0.002
cd03222177 cd03222, ABC_RNaseL_inhibitor, The ABC ATPase RNase L i 0.003
PRK11147635 PRK11147, PRK11147, ABC transporter ATPase component; R 0.004
PRK00300205 PRK00300, gmk, guanylate kinase; Provisional 0.004
pfam03193161 pfam03193, DUF258, Protein of unknown function, DUF258 5e-04
cd01854287 cd01854, YjeQ_engC, YjeQ/EngC 0.002
TIGR00630924 TIGR00630, uvra, excinuclease ABC, A subunit 0.004
PRK00349943 PRK00349, uvrA, excinuclease ABC subunit A; Reviewed 0.004
PRK00098298 PRK00098, PRK00098, GTPase RsgA; Reviewed 0.004
COG11961163 COG1196, Smc, Chromosome segregation ATPases [Cell divi 0.001
PRK01889356 PRK01889, PRK01889, GTPase RsgA; Reviewed 0.003
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|35281 KOG0058, KOG0058, KOG0058, Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|35278 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|32455 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|34593 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|162558 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|35280 KOG0057, KOG0057, KOG0057, Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>gnl|CDD|35277 KOG0054, KOG0054, KOG0054, Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|34592 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|34241 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|130031 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|173501 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|31327 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|35278 KOG0055, KOG0055, KOG0055, Multidrug/pheromone exporter, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|183016 PRK11176, PRK11176, lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>gnl|CDD|35279 KOG0056, KOG0056, KOG0056, Heavy metal exporter HMT1, ABC superfamily [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|162132 TIGR00958, 3a01208, Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>gnl|CDD|34862 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|163239 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|163508 TIGR03796, NHPM_micro_ABC1, NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>gnl|CDD|163509 TIGR03797, NHPM_micro_ABC2, NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|35277 KOG0054, KOG0054, KOG0054, Multidrug resistance-associated protein/mitoxantrone resistance protein, ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|173501 PTZ00265, PTZ00265, multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>gnl|CDD|34240 COG4615, PvdE, ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130262 TIGR01194, cyc_pep_trnsptr, cyclic peptide transporter Back     alignment and domain information
>gnl|CDD|73010 cd03251, ABCC_MsbA, MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>gnl|CDD|73008 cd03249, ABC_MTABC3_MDL1_MDL2, MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>gnl|CDD|73013 cd03254, ABCC_Glucan_exporter_like, Glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|73012 cd03253, ABCC_ATM1_transporter, ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>gnl|CDD|72987 cd03228, ABCC_MRP_Like, The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>gnl|CDD|73007 cd03248, ABCC_TAP, TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>gnl|CDD|73011 cd03252, ABCC_Hemolysin, The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>gnl|CDD|183014 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|73004 cd03245, ABCC_bacteriocin_exporters, ABC-type bacteriocin exporters Back     alignment and domain information
>gnl|CDD|183003 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|73003 cd03244, ABCC_MRP_domain2, Domain 2 of the ABC subfamily C Back     alignment and domain information
>gnl|CDD|162555 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|73009 cd03250, ABCC_MRP_domain1, Domain 1 of the ABC subfamily C Back     alignment and domain information
>gnl|CDD|178676 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|73005 cd03246, ABCC_Protease_Secretion, This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>gnl|CDD|178771 PLN03232, PLN03232, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|73047 cd03288, ABCC_SUR2, The SUR domain 2 Back     alignment and domain information
>gnl|CDD|73061 cd03369, ABCC_NFT1, Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>gnl|CDD|72984 cd03225, ABC_cobalt_CbiO_domain1, Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>gnl|CDD|31319 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31326 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|31331 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|73006 cd03247, ABCC_cytochrome_bd, The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>gnl|CDD|31323 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|73014 cd03255, ABC_MJ0796_Lo1CDE_FtsE, This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>gnl|CDD|31317 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|73054 cd03295, ABC_OpuCA_Osmoprotection, OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>gnl|CDD|72988 cd03229, ABC_Class3, This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>gnl|CDD|73018 cd03259, ABC_Carb_Solutes_like, ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>gnl|CDD|73019 cd03260, ABC_PstB_phosphate_transporter, Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>gnl|CDD|33633 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|73017 cd03258, ABC_MetN_methionine_transporter, MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>gnl|CDD|72971 cd00267, ABC_ATPase, ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>gnl|CDD|73020 cd03261, ABC_Org_Solvent_Resistant, ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>gnl|CDD|31318 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|140270 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|73021 cd03262, ABC_HisP_GlnQ_permeases, HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>gnl|CDD|31322 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|163352 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|72973 cd03214, ABC_Iron-Siderophores_B12_Hemin, ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>gnl|CDD|31313 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184591 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|33631 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|73015 cd03256, ABC_PhnC_transporter, ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>gnl|CDD|31330 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|72994 cd03235, ABC_Metallic_Cations, ABC component of the metal-type transporters Back     alignment and domain information
>gnl|CDD|31320 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|31315 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130031 TIGR00957, MRP_assoc_pro, multi drug resistance-associated protein (MRP) Back     alignment and domain information
>gnl|CDD|178676 PLN03130, PLN03130, ABC transporter C family member; Provisional Back     alignment and domain information
>gnl|CDD|72985 cd03226, ABC_cobalt_CbiO_domain2, Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>gnl|CDD|72989 cd03230, ABC_DR_subfamily_A, This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>gnl|CDD|140270 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|73016 cd03257, ABC_NikE_OppD_transporters, The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>gnl|CDD|31325 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|73052 cd03293, ABC_NrtD_SsuB_transporters, NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>gnl|CDD|73048 cd03289, ABCC_CFTR2, The CFTR subfamily domain 2 Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|31324 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|73049 cd03290, ABCC_SUR1_N, The SUR domain 1 Back     alignment and domain information
>gnl|CDD|33436 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|73055 cd03296, ABC_CysA_sulfate_importer, Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>gnl|CDD|31314 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|73051 cd03292, ABC_FtsE_transporter, FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>gnl|CDD|184192 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|33632 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|32710 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|73023 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|31320 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|73053 cd03294, ABC_Pro_Gly_Bertaine, This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>gnl|CDD|35284 KOG0061, KOG0061, KOG0061, Transporter, ABC superfamily (Breast cancer resistance protein) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|73050 cd03291, ABCC_CFTR1, The CFTR subfamily domain 1 Back     alignment and domain information
>gnl|CDD|72972 cd03213, ABCG_EPDR, ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>gnl|CDD|130045 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184200 PRK13640, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|31321 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|33900 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184206 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|73022 cd03263, ABC_subfamily_A, The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|73057 cd03298, ABC_ThiQ_thiamine_transporter, ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>gnl|CDD|33636 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|73178 COG4608, AppF, ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|30793 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|72983 cd03224, ABC_TM1139_LivF_branched, LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>gnl|CDD|73058 cd03299, ABC_ModC_like, Archeal protein closely related to ModC Back     alignment and domain information
>gnl|CDD|184207 PRK13648, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|33915 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|139715 PRK13631, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|72978 cd03219, ABC_Mj1267_LivG_branched, The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>gnl|CDD|34242 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|72993 cd03234, ABCG_White, The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>gnl|CDD|162277 TIGR01271, CFTR_protein, cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|73056 cd03297, ABC_ModC_molybdenum_transporter, ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>gnl|CDD|73060 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|34235 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183001 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184195 PRK13635, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|163196 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|172732 PRK14244, PRK14244, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|34201 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|30759 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|33913 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|73059 cd03300, ABC_PotA_N, PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>gnl|CDD|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|182592 PRK10619, PRK10619, histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|162130 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|34199 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184197 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|34233 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|30834 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|73025 cd03266, ABC_NatA_sodium_exporter, NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>gnl|CDD|35288 KOG0065, KOG0065, KOG0065, Pleiotropic drug resistance proteins (PDR1-15), ABC superfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|31316 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184126 PRK13539, PRK13539, cytoc