254780918

254780918

glycosyl transferase family protein

GeneID in NCBI database:8209938Locus tag:CLIBASIA_04085
Protein GI in NCBI database:254780918Protein Accession:YP_003065331.1
Gene range:-(899321, 901192)Protein Length:623aa
Gene description:glycosyl transferase family protein
COG prediction:[M] Glycosyltransferases involved in cell wall biogenesis
KEGG prediction:glycosyl transferase family protein
SEED prediction:Glycosyl transferase, group 2 family protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620---
MIQSCKCVVKSLLRKIKLKFPSRHKRRIIKFENFEKEYREWSSLFHDTSPQFTKKILQNISQWQNKPLISVIMPVYKIKKEWLEMAIESVRSQIYSHWELCIAEDCSGDIETVSLLKKYANMDSRIKVVFRAKNGHISAASNSAAQLATSEWLALLDHDDLLHPTALYYVADAINNNPNAEIIYSDEDKINENQIRSGPYFKYDFNPELFHVHNMITHLGVYRTETFKKIGGFREKFEGAQDYDLVLRFLENIDLSQIIHIPRVLYHWRMHDNSTAQKIGNKNYAGKAGERALNEHFQRTGIAAKAVFDGAQYRTHYMIPNPPPLVSIIIPTYNHHHLLKICLESIYHKTTYSSFEVIIIDNLSDDSKTFLYLQKIQKKYPNLRVITDNTHPFNYSRINNNATLHAKGQYFCFLNNDTEVINGQWLSEMMGIASQPQVGAVGARLWYRRKKLWKRSKRLQHGGVIMGINNIAGHKNKHHKARCSVPNYQAFAMHFTHSISAVTGACMVMSKKCFMHVGGFDEKNTPVVFSDIDLCLRILEAGYRNVWTPHADLYHDESRTRKYDHEDPAKMIVFQEACQYLQKRWKKIIEKDPCYNPNLSLLHEGGHTLAYPPRLDCLSSPTK
ccccHHHHHHHHHHHcccccccccHHHHHccccHHHHHHHHHHHccccccHHccccHHHHccccccccEEEEEcccccHHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHccccEEEEccEEEEcccccccccEEcccccHHHHccccccccccEEEHHHHHHcccccccccHHHHHHHHHHHHHccccEEEEEccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHcccEEEEEEEEEcccccccccccEEEcccccccccccccccccccHHHcccccccHHHHcccccccEEEccccHHHHHHHHHHccccHHHcccEEcHHHHHHHHHHcccEEEEEccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHcccccc
ccccccEEEccHHHHHHccccHHHHHcccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHccccEEEEEccEEEccccccccccccccccHHHHHHcccccHHEEEcHHHHHHHcccccccccHHHHHHHHHHHHHcccccEEEEccEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHccccccEcccccccEEEEcccccccEEEEEEEccccHHHHHHHHHHHHHccccccEEEEEEEcccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHcccccEEEEcEEEcccccEEcccHHHHHccEEEEccccccccccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccEEEcccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccc
MIQSCKCVVKSLLRKIKlkfpsrhkrriIKFENFEKEYREWsslfhdtspqFTKKILQNISQwqnkplisvimPVYKIKKEWLEMAIESVRSQIYSHWELCIAEDCSGDIETVSLLKKYANMDSRIKVVFRAKNGHISAASNSAAQLATSEWLALLdhddllhpTALYYVADainnnpnaeiiysdedkinenqirsgpyfkydfnpelfhVHNMITHLGVYRTETFKKIggfrekfegaqdYDLVLRFLENidlsqiihiprvlyhwrmhdnstaqkignknyagkagERALNEHFQRTGIAAKAvfdgaqyrthymipnppplvsiiiptynhhHLLKICLESiyhkttysSFEVIIIDNLSDDSKTFLYLQKIQkkypnlrvitdnthpfnysrinnnatlhakgQYFCFLNNDTEVINGQWLsemmgiasqpqvgaVGARLWYRRKKLWKRSkrlqhggvimginniaghknkhhkarcsvpnyQAFAMHFTHSISAVTGACMVMSkkcfmhvggfdekntpvvfsDIDLCLRILEAgyrnvwtphadlyhdesrtrkydhedpakMIVFQEACQYLQKRWKKIiekdpcynpnlsllhegghtlaypprldclssptk
MIQSCKCVVKSLlrkiklkfpsrhkrriikfenfeKEYREWSSLFHDTSPQFTKKILQNIsqwqnkplisVIMPVYKIKKEWLEMAIESVRSQIYSHWELCIAEDCSGDIETVSLLKKYANMDSRIKVVFRAKNGHISAASNSAAQLATSEWLALLDHDDLLHPTALYYVADAINNNPNAEIIYSDEDKINENQIRSGPYFKYDFNPELFHVHNMITHLGVYRTETFKKIGGFREKFEGAQDYDLVLRFLENIDLSQIIHIPRVLYHWRMHDNSTAQKIGNKNYAGKAGERALNEHFQRTGIAAKAVFDGAQYRTHYMIPNPPPLVSIIIPTYNHHHLLKICLESIYHKTTYSSFEVIIIDNLSDDSKTFLYLQKIqkkypnlrvITDNTHPFNYSRINNNATLHAKGQYFCFLNNDTEVINGQWLSEMMGIASQPQVGAVGARLWYRRKKLWkrskrlqhggVIMGINNIAGHKNKHHKARCSVPNYQAFAMHFTHSISAVTGACMVMSKKCFMHVGGFDEKNTPVVFSDIDLCLRILEAGyrnvwtphadlyhdesrTRKYDHEDPAKMIVFQEACQYLQKRWKKIIEKDPCYNPNLSLLHEgghtlaypprldclssptk
MIQSCKCVVKSLLRKIKLKFPSRHKRRIIKFENFEKEYREWSSLFHDTSPQFTKKILQNISQWQNKPLISVIMPVYKIKKEWLEMAIESVRSQIYSHWELCIAEDCSGDIETVSLLKKYANMDSRIKVVFRAKNGHISAASNSAAQLATSEWlalldhddllhPTALYYVADAINNNPNAEIIYSDEDKINENQIRSGPYFKYDFNPELFHVHNMITHLGVYRTETFKKIGGFREKFEGAQDYDLVLRFLENIDLSQIIHIPRVLYHWRMHDNSTAQKIGNKNYAGKAGERALNEHFQRTGIAAKAVFDGAQYRTHYMIPNPPPLVSIIIPTYNHHHLLKICLESIYHKTTYSSFEVIIIDNLSDDSKTFLYLQKIQKKYPNLRVITDNTHPFNYSRINNNATLHAKGQYFCFLNNDTEVINGQWLSEMMGIASQPQVGAVGArlwyrrkklwkrskrlQHGGVIMGINNIAGHKNKHHKARCSVPNYQAFAMHFTHSISAVTGACMVMSKKCFMHVGGFDEKNTPVVFSDIDLCLRILEAGYRNVWTPHADLYHDESRTRKYDHEDPAKMIVFQEACQYLQKRWKKIIEKDPCYNPNLSLLHEGGHTLAYPPRLDCLSSPTK
***S***VVKSLLRKIKLKFPSRHKRRIIKFENFEKEYREWSSLFHDTSPQFTKKILQ**S*WQNKPLISVIMPVYKIKKEWLEMAIESVRSQIYSHWELCIAEDCSGDIETVSLLKKYANMDSRIKVVFRAKNGHISAASNSAAQLATSEWLALLDHDDLLHPTALYYVADAINNNPNAEIIYSDEDKINENQIRSGPYFKYDFNPELFHVHNMITHLGVYRTETFKKIGGFREKFEGAQDYDLVLRFLENIDLSQIIHIPRVLYHWRMHDNSTAQKIGNKNYAGKAGERALNEHFQRTGIAAKAVFDGAQYRTHYMIPNPPPLVSIIIPTYNHHHLLKICLESIYHKTTYSSFEVIIIDNLSDDSKTFLYLQKIQKKYPNLRVITDNTHPFNYSRINNNATLHAKGQYFCFLNNDTEVINGQWLSEMMGIASQPQVGAVGARLWYRRKKLWKRSKRLQHGGVIMGINNIAGHKNKHHKARCSVPNYQAFAMHFTHSISAVTGACMVMSKKCFMHVGGFDEKNTPVVFSDIDLCLRILEAGYRNVWTPHADLYHD****************VFQEACQYLQKRWKKIIEKDPCYNPNLSLLHEGGHTLAYPPRLDCLSSP**
MIQSCKCVVKSLLRKIKLKFPSRHKRRIIKFENFEKEYREWSSLFHDTSPQFTKKILQNISQWQNKPLISVIMPVYKIKKEWLEMAIESVRSQIYSHWELCIAEDCSGDIETVSLLKKYANMDSRIKVVFRAKNGHISAASNSAAQLATSEWLALLDHDDLLHPTALYYVADAINNNPNAEIIYSDEDKINENQIRSGPYFKYDFNPELFHVHNMITHLGVYRTETFKKIGGFREKFEGAQDYDLVLRFLENIDLSQIIHIPRVLYHWRMHDNSTAQKIGNKNYAGKAGERALNEHFQRTGIAAKAVFDGAQYRTHYMIPNPPPLVSIIIPTYNHHHLLKICLESIYHKTTYSSFEVIIIDNLSDDSKTFLYLQKIQKKYPNLRVITDNTHPFNYSRINNNATLHAKGQYFCFLNNDTEVINGQWLSEMMGIASQPQVGAVGARLWYRRKKLWKRSKRLQHGGVIMGINNIAGHKNKHHKARCSVPNYQAFAMHFTHSISAVTGACMVMSKKCFMHVGGFDEKNTPVVFSDIDLCLRILEAGYRNVWTPHADLYHDESRTRKYDHEDPAKMIVFQEACQYLQKRWKKIIEKDPCYNPNLSLLHEGGHTLAYPPRLDCLSSPTK
*I*SCKCVVKSLLRKIKLKFPSRHKRRIIKFENFEKEYREWSSLFHDTSPQFTKKILQNISQWQNKPLISVIMPVYKIKKEWLEMAIESVRSQIYSHWELCIAEDCSGDIETVSLLKKYANMDSRIKVVFRAKNGHISAASNSAAQLATSEWLALLDHDDLLHPTALYYVADAINNNPNAEIIYSDEDKINENQIRSGPYFKYDFNPELFHVHNMITHLGVYRTETFKKIGGFREKFEGAQDYDLVLRFLENIDLSQIIHIPRVLYHWRMHDNSTAQKIGNKNYAGKAGERALNEHFQRTGIAAKAVFDGAQYRTHYMIPNPPPLVSIIIPTYNHHHLLKICLESIYHKTTYSSFEVIIIDNLSDDSKTFLYLQKIQKKYPNLRVITDNTHPFNYSRINNNATLHAKGQYFCFLNNDTEVINGQWLSEMMGIASQPQVGAVGARLWYRRKKLWKRSKRLQHGGVIMGINNIAGHKNKHHKARCSVPNYQAFAMHFTHSISAVTGACMVMSKKCFMHVGGFDEKNTPVVFSDIDLCLRILEAGYRNVWTPHADLYHDESRTRKYDHEDPAKMIVFQEACQYLQKRWKKIIEKDPCYNPNLSLLHEGGHTLAYPPRLDC******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIQSCKCVVKSLLRKIKLKFPSRHKRRIIKFENFEKEYREWSSLFHDTSPQFTKKILQNISQWQNKPLISVIMPVYKIKKEWLEMAIESVRSQIYSHWELCIAEDCSGDIETVSLLKKYANMDSRIKVVFRAKNGHISAASNSAAQLATSEWLALLDHDDLLHPTALYYVADAINNNPNAEIIYSDEDKINENQIRSGPYFKYDFNPELFHVHNMITHLGVYRTETFKKIGGFREKFEGAQDYDLVLRFLENIDLSQIIHIPRVLYHWRMHDNSTAQKIGNKNYAGKAGERALNEHFQRTGIAAKAVFDGAQYRTHYMIPNPPPLVSIIIPTYNHHHLLKICLESIYHKTTYSSFEVIIIDNLSDDSKTFLYLQKIQKKYPNLRVITDNTHPFNYSRINNNATLHAKGQYFCFLNNDTEVINGQWLSEMMGIASQPQVGAVGARLWYRRKKLWKRSKRLQHGGVIMGINNIAGHKNKHHKARCSVPNYQAFAMHFTHSISAVTGACMVMSKKCFMHVGGFDEKNTPVVFSDIDLCLRILEAGYRNVWTPHADLYHDESRTRKYDHEDPAKMIVFQEACQYLQKRWKKIIEKDPCYNPNLSLLHEGGHTLAYPPRLDCLSSPTK
MIQSCKCVVKSLLRKIKLKFPSRHKRRIIKFENFEKEYREWSSLFHDTSPQFTKKILQNISQWQNKPLISVIMPVYKIKKEWLEMAIESVRSQIYSHWELCIAEDCSGDIETVSLLKKYANMDSRIKVVFRAKNGHISAASNSAAQLATSEWLALLDHDDLLHPTALYYVADAINNNPNAEIIYSDEDKINENQIRSGPYFKYDFNPELFHVHNMITHLGVYRTETFKKIGGFREKFEGAQDYDLVLRFLENIDLSQIIHIPRVLYHWRMHDNSTAQKIGNKNYAGKAGERALNEHFQRTGIAAKAVFDGAQYRTHYMIPNPPPLVSIIIPTYNHHHLLKICLESIYHKTTYSSFEVIIIDNLSDDSKTFLYLQKIQKKYPNLRVITDNTHPFNYSRINNNATLHAKGQYFCFLNNDTEVINGQWLSEMMGIASQPQVGAVGARLWYRRKKLWKRSKRLQHGGVIMGINNIAGHKNKHHKARCSVPNYQAFAMHFTHSISAVTGACMVMSKKCFMHVGGFDEKNTPVVFSDIDLCLRILEAGYRNVWTPHADLYHDESRTRKYDHEDPAKMIVFQEACQYLQKRWKKIIEKDPCYNPNLSLLHEGGHTLAYPPRLDCLSSPTK
MIQSCKCVVKSLLRKIKLKFPSRHKRRIIKFENFEKEYREWSSLFHDTSPQFTKKILQNISQWQNKPLISVIMPVYKIKKEWLEMAIESVRSQIYSHWELCIAEDCSGDIETVSLLKKYANMDSRIKVVFRAKNGHISAASNSAAQLATSEWLALLDHDDLLHPTALYYVADAINNNPNAEIIYSDEDKINENQIRSGPYFKYDFNPELFHVHNMITHLGVYRTETFKKIGGFREKFEGAQDYDLVLRFLENIDLSQIIHIPRVLYHWRMHDNSTAQKIGNKNYAGKAGERALNEHFQRTGIAAKAVFDGAQYRTHYMIPNPPPLVSIIIPTYNHHHLLKICLESIYHKTTYSSFEVIIIDNLSDDSKTFLYLQKIQKKYPNLRVITDNTHPFNYSRINNNATLHAKGQYFCFLNNDTEVINGQWLSEMMGIASQPQVGAVGARLWYRRKKLWKRSKRLQHGGVIMGINNIAGHKNKHHKARCSVPNYQAFAMHFTHSISAVTGACMVMSKKCFMHVGGFDEKNTPVVFSDIDLCLRILEAGYRNVWTPHADLYHDESRTRKYDHEDPAKMIVFQEACQYLQKRWKKIIEKDPCYNPNLSLLHEGGHTLAYPPRLDCLSSPTK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target623 glycosyl transferase family protein [Candidatus Liberib
315122656565 glycosyl transferase family protein [Candidatus Liberib 1 0.0
3078250241032 glycosyl transferase family 2 [Methylobacter tundripalu 1 1e-168
330972789696 glycosyl transferase family protein [Pseudomonas syring 1 1e-160
213967247684 glycosyl transferase, group 2 family protein [Pseudomon 1 1e-160
1485491321509 glycosyl transferase family protein [Pseudomonas putida 1 1e-159
170732202625 glycosyl transferase family protein [Burkholderia cenoc 1 1e-159
330961704686 glycosyl transferase family protein [Pseudomonas syring 1 1e-158
237799702603 glycosyl transferase family protein [Pseudomonas syring 1 1e-158
107021954625 glycosyl transferase family protein [Burkholderia cenoc 1 1e-155
307728826632 glycosyl transferase family 2 [Burkholderia sp. CCGE100 1 1e-154
>gi|315122656|ref|YP_004063145.1| glycosyl transferase family protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 565 Back     alignment and organism information
 Score =  773 bits (1996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/554 (65%), Positives = 447/554 (80%), Gaps = 7/554 (1%)

Query: 73  MPVYKIKKEWLEMAIESVRSQIYSHWELCIAEDCSGDIETVSLLKKYANMDSRIKVVFRA 132
           MPVYK+K+EWL+ AIESVR+QIY HWELCIAEDC+G+++ V LLKKYANMD RIKVVFR 
Sbjct: 1   MPVYKVKQEWLKTAIESVRNQIYPHWELCIAEDCAGNVDNVLLLKKYANMDPRIKVVFRT 60

Query: 133 KNGHISAASNSAAQLATSEWLALLDHDDLLHPTALYYVADAINNNPNAEIIYSDEDKINE 192
             GHI+A+SNSA+QL TS+W+ALLDHDD+LHPTALYYVA++IN NPNAE++YSDEDKINE
Sbjct: 61  TTGHITASSNSASQLVTSDWIALLDHDDILHPTALYYVAESINANPNAELLYSDEDKINE 120

Query: 193 NQ-IRSGPYFKYDFNPELFHVHNMITHLGVYRTETFKKIGGFREKFEGAQDYDLVLRFLE 251
           N  IRS PYFKYDFN +LF+ HNMI+HLGVY+T TF+KIGGFR+ FEG+QDYDLVLRFL+
Sbjct: 121 NNTIRSDPYFKYDFNIDLFYAHNMISHLGVYKTTTFRKIGGFRKGFEGSQDYDLVLRFLQ 180

Query: 252 NIDLSQIIHIPRVLYHWRMHDNSTAQKIGNKNYAGKAGERALNEHFQRTGIAAKAVFDGA 311
           +IDLSQIIHIPRVLYHWR+HD+STA+ I NK+YA +  +RALN++F+R GI AKA     
Sbjct: 181 HIDLSQIIHIPRVLYHWRIHDSSTAKTINNKSYATETSKRALNDYFKRHGIKAKAKSTIY 240

Query: 312 QYRTHYMIPNPPPLVSIIIPTYNHHHLLKICLESIYHKTTYSSFEVIIIDNLSDDSKTFL 371
            + T+Y +PNP PL+SIIIP +N +  LK CLE++Y KT+Y +FEVI++DN S DS T  
Sbjct: 241 GFYTNYQLPNPKPLISIIIPVHNQYAPLKKCLENLYQKTSYRNFEVIVVDNNSTDSHTLS 300

Query: 372 YLQKIQKKYPNLRVITDNTHPFNYSRINNNATLHAKGQYFCFLNNDTEVINGQWLSEMMG 431
           +LQKIQK Y  L VI D T PFN+S+I NNA  HAKGQY CFLN+ T+VIN  WL EM+ 
Sbjct: 301 FLQKIQKDYQRLSVIVDKTQPFNFSQIMNNAVPHAKGQYLCFLNDSTQVINDHWLLEMLK 360

Query: 432 IASQPQVGAVGARLWYRRKKLW--KRSKRLQHGGVIMGINNIAGHKNKHHKARCSVPNYQ 489
           IA+QP+VGAVGARLWY   +++  K  KRLQHGG+IMG++ IA +KNK+H    ++PN Q
Sbjct: 361 IAAQPKVGAVGARLWYLTPRIFFKKPKKRLQHGGIIMGVDGIASNKNKNHTGCHTIPNCQ 420

Query: 490 AFAMHFTHSISAVTGACMVMSKKCFMHVGGFDEKNTPVVFSDIDLCLRILEAGYRNVWTP 549
            FAMH  HS+SAVT ACM++SKKCF+ + GFD+KNTPV FSD+D CLR +EAGYRN++TP
Sbjct: 421 FFAMHLIHSVSAVTSACMLVSKKCFVEINGFDDKNTPVAFSDVDFCLRAIEAGYRNIFTP 480

Query: 550 HADLYHDESRTRKYDHEDPAKMIVFQEACQYLQKRWKKIIEKDPCYNPNLSLLHEGGHTL 609
            ADLY  +S TRKY     A  I F++ CQY+ KRW+KII+ DPCYNPNL++L EG H L
Sbjct: 481 FADLYQYKSATRKYG----ALNIEFKQVCQYMTKRWEKIIKNDPCYNPNLNILSEGNHNL 536

Query: 610 AYPPRLDCLSSPTK 623
           AYPPRL    +P K
Sbjct: 537 AYPPRLKHFYNPQK 550


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|307825024|ref|ZP_07655246.1| glycosyl transferase family 2 [Methylobacter tundripaludum SV96] Length = 1032 Back     alignment and organism information
>gi|330972789|gb|EGH72855.1| glycosyl transferase family protein [Pseudomonas syringae pv. aceris str. M302273PT] Length = 696 Back     alignment and organism information
>gi|213967247|ref|ZP_03395396.1| glycosyl transferase, group 2 family protein [Pseudomonas syringae pv. tomato T1] Length = 684 Back     alignment and organism information
>gi|148549132|ref|YP_001269234.1| glycosyl transferase family protein [Pseudomonas putida F1] Length = 1509 Back     alignment and organism information
>gi|170732202|ref|YP_001764149.1| glycosyl transferase family protein [Burkholderia cenocepacia MC0-3] Length = 625 Back     alignment and organism information
>gi|330961704|gb|EGH61964.1| glycosyl transferase family protein [Pseudomonas syringae pv. maculicola str. ES4326] Length = 686 Back     alignment and organism information
>gi|237799702|ref|ZP_04588163.1| glycosyl transferase family protein [Pseudomonas syringae pv. oryzae str. 1_6] Length = 603 Back     alignment and organism information
>gi|107021954|ref|YP_620281.1| glycosyl transferase family protein [Burkholderia cenocepacia AU 1054] Length = 625 Back     alignment and organism information
>gi|307728826|ref|YP_003906050.1| glycosyl transferase family 2 [Burkholderia sp. CCGE1003] Length = 632 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target623 glycosyl transferase family protein [Candidatus Liberib
cd06433202 cd06433, GT_2_WfgS_like, WfgS and WfeV are involved in 9e-30
cd00761156 cd00761, Glyco_tranf_GTA_type, Glycosyltransferase fami 1e-19
PRK10018279 PRK10018, PRK10018, putative glycosyl transferase; Prov 5e-13
cd04196214 cd04196, GT_2_like_d, Subfamily of Glycosyltransferase 3e-12
cd02525249 cd02525, Succinoglycan_BP_ExoA, ExoA is involved in the 2e-11
PRK10073328 PRK10073, PRK10073, putative glycosyl transferase; Prov 9e-11
COG1215439 COG1215, COG1215, Glycosyltransferases, probably involv 2e-10
cd04186166 cd04186, GT_2_like_c, Subfamily of Glycosyltransferase 5e-10
cd06420182 cd06420, GT2_Chondriotin_Pol_N, N-terminal domain of Ch 6e-09
COG1216305 COG1216, COG1216, Predicted glycosyltransferases [Gener 5e-08
cd04195201 cd04195, GT2_AmsE_like, GT2_AmsE_like is involved in ex 8e-06
cd06913219 cd06913, beta3GnTL1_like, Beta 1, 3-N-acetylglucosaminy 8e-05
cd04184202 cd04184, GT2_RfbC_Mx_like, Myxococcus xanthus RfbC like 1e-92
cd04186166 cd04186, GT_2_like_c, Subfamily of Glycosyltransferase 3e-26
cd00761156 cd00761, Glyco_tranf_GTA_type, Glycosyltransferase fami 8e-15
COG0463291 COG0463, WcaA, Glycosyltransferases involved in cell wa 9e-09
PRK10073328 PRK10073, PRK10073, putative glycosyl transferase; Prov 1e-07
PRK11204420 PRK11204, PRK11204, N-glycosyltransferase; Provisional 1e-05
cd06434235 cd06434, GT2_HAS, Hyaluronan synthases catalyze polymer 7e-04
cd02520196 cd02520, Glucosylceramide_synthase, Glucosylceramide sy 0.002
pfam00535168 pfam00535, Glycos_transf_2, Glycosyl transferase family 5e-23
cd06423180 cd06423, CESA_like, CESA_like is the cellulose synthase 5e-10
pfam00535168 pfam00535, Glycos_transf_2, Glycosyl transferase family 8e-19
cd06423180 cd06423, CESA_like, CESA_like is the cellulose synthase 6e-12
cd04192229 cd04192, GT_2_like_e, Subfamily of Glycosyltransferase 4e-08
cd06913219 cd06913, beta3GnTL1_like, Beta 1, 3-N-acetylglucosaminy 2e-06
cd02522221 cd02522, GT_2_like_a, GT_2_like_a represents a glycosyl 2e-04
COG1216305 COG1216, COG1216, Predicted glycosyltransferases [Gener 1e-18
COG1215 439 COG1215, COG1215, Glycosyltransferases, probably involv 4e-14
cd02525249 cd02525, Succinoglycan_BP_ExoA, ExoA is involved in the 1e-13
cd06433202 cd06433, GT_2_WfgS_like, WfgS and WfeV are involved in 5e-10
COG0463291 COG0463, WcaA, Glycosyltransferases involved in cell wa 1e-15
cd04186166 cd04186, GT_2_like_c, Subfamily of Glycosyltransferase 6e-12
PRK11204420 PRK11204, PRK11204, N-glycosyltransferase; Provisional 5e-11
PRK14583444 PRK14583, hmsR, N-glycosyltransferase; Provisional 6e-06
cd04187181 cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are 6e-05
cd06439251 cd06439, CESA_like_1, CESA_like_1 is a member of the ce 2e-04
cd04179185 cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_like i 0.002
cd04184202 cd04184, GT2_RfbC_Mx_like, Myxococcus xanthus RfbC like 2e-07
TIGR03111439 TIGR03111, glyc2_xrt_Gpos1, putative glycosyltransferas 6e-07
cd06420182 cd06420, GT2_Chondriotin_Pol_N, N-terminal domain of Ch 2e-05
cd04179185 cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_like i 1e-04
PRK10018279 PRK10018, PRK10018, putative glycosyl transferase; Prov 1e-04
cd04188211 cd04188, DPG_synthase, DPG_synthase is involved in prot 0.001
cd04185202 cd04185, GT_2_like_b, Subfamily of Glycosyltransferase 6e-04
PLN02726243 PLN02726, PLN02726, dolichyl-phosphate beta-D-mannosylt 0.001
cd04187181 cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are 0.002
cd06442224 cd06442, DPM1_like, DPM1_like represents putative enzym 0.002
PRK14583444 PRK14583, hmsR, N-glycosyltransferase; Provisional 0.004
>gnl|CDD|133055 cd06433, GT_2_WfgS_like, WfgS and WfeV are involved in O-antigen biosynthesis Back     alignment and domain information
>gnl|CDD|132997 cd00761, Glyco_tranf_GTA_type, Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>gnl|CDD|182197 PRK10018, PRK10018, putative glycosyl transferase; Provisional Back     alignment and domain information
>gnl|CDD|133039 cd04196, GT_2_like_d, Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>gnl|CDD|133016 cd02525, Succinoglycan_BP_ExoA, ExoA is involved in the biosynthesis of succinoglycan Back     alignment and domain information
>gnl|CDD|182223 PRK10073, PRK10073, putative glycosyl transferase; Provisional Back     alignment and domain information
>gnl|CDD|31408 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|133029 cd04186, GT_2_like_c, Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>gnl|CDD|133042 cd06420, GT2_Chondriotin_Pol_N, N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase Back     alignment and domain information
>gnl|CDD|31409 COG1216, COG1216, Predicted glycosyltransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|133038 cd04195, GT2_AmsE_like, GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis Back     alignment and domain information
>gnl|CDD|133063 cd06913, beta3GnTL1_like, Beta 1, 3-N-acetylglucosaminyltransferase is essential for the formation of poly-N-acetyllactosamine Back     alignment and domain information
>gnl|CDD|133027 cd04184, GT2_RfbC_Mx_like, Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis Back     alignment and domain information
>gnl|CDD|133029 cd04186, GT_2_like_c, Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>gnl|CDD|132997 cd00761, Glyco_tranf_GTA_type, Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>gnl|CDD|30811 COG0463, WcaA, Glycosyltransferases involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|182223 PRK10073, PRK10073, putative glycosyl transferase; Provisional Back     alignment and domain information
>gnl|CDD|183038 PRK11204, PRK11204, N-glycosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133056 cd06434, GT2_HAS, Hyaluronan synthases catalyze polymerization of hyaluronan Back     alignment and domain information
>gnl|CDD|133012 cd02520, Glucosylceramide_synthase, Glucosylceramide synthase catalyzes the first glycosylation step of glycosphingolipid synthesis Back     alignment and domain information
>gnl|CDD|144210 pfam00535, Glycos_transf_2, Glycosyl transferase family 2 Back     alignment and domain information
>gnl|CDD|133045 cd06423, CESA_like, CESA_like is the cellulose synthase superfamily Back     alignment and domain information
>gnl|CDD|144210 pfam00535, Glycos_transf_2, Glycosyl transferase family 2 Back     alignment and domain information
>gnl|CDD|133045 cd06423, CESA_like, CESA_like is the cellulose synthase superfamily Back     alignment and domain information
>gnl|CDD|133035 cd04192, GT_2_like_e, Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>gnl|CDD|133063 cd06913, beta3GnTL1_like, Beta 1, 3-N-acetylglucosaminyltransferase is essential for the formation of poly-N-acetyllactosamine Back     alignment and domain information
>gnl|CDD|133013 cd02522, GT_2_like_a, GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function Back     alignment and domain information
>gnl|CDD|31409 COG1216, COG1216, Predicted glycosyltransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|31408 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|133016 cd02525, Succinoglycan_BP_ExoA, ExoA is involved in the biosynthesis of succinoglycan Back     alignment and domain information
>gnl|CDD|133055 cd06433, GT_2_WfgS_like, WfgS and WfeV are involved in O-antigen biosynthesis Back     alignment and domain information
>gnl|CDD|30811 COG0463, WcaA, Glycosyltransferases involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|133029 cd04186, GT_2_like_c, Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>gnl|CDD|183038 PRK11204, PRK11204, N-glycosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184755 PRK14583, hmsR, N-glycosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133030 cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1 Back     alignment and domain information
>gnl|CDD|133061 cd06439, CESA_like_1, CESA_like_1 is a member of the cellulose synthase (CESA) superfamily Back     alignment and domain information
>gnl|CDD|133022 cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily Back     alignment and domain information
>gnl|CDD|133027 cd04184, GT2_RfbC_Mx_like, Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis Back     alignment and domain information
>gnl|CDD|132155 TIGR03111, glyc2_xrt_Gpos1, putative glycosyltransferase TIGR03111 Back     alignment and domain information
>gnl|CDD|133042 cd06420, GT2_Chondriotin_Pol_N, N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase Back     alignment and domain information
>gnl|CDD|133022 cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily Back     alignment and domain information
>gnl|CDD|182197 PRK10018, PRK10018, putative glycosyl transferase; Provisional Back     alignment and domain information
>gnl|CDD|133031 cd04188, DPG_synthase, DPG_synthase is involved in protein N-linked glycosylation Back     alignment and domain information
>gnl|CDD|133028 cd04185, GT_2_like_b, Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>gnl|CDD|178327 PLN02726, PLN02726, dolichyl-phosphate beta-D-mannosyltransferase Back     alignment and domain information
>gnl|CDD|133030 cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1 Back     alignment and domain information
>gnl|CDD|133062 cd06442, DPM1_like, DPM1_like represents putative enzymes similar to eukaryotic DPM1 Back     alignment and domain information
>gnl|CDD|184755 PRK14583, hmsR, N-glycosyltransferase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 623 glycosyl transferase family protein [Candidatus Liberib
cd04184202 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like proteins 100.0
cd04195201 GT2_AmsE_like GT2_AmsE_like is involved in exopolysacch 100.0
cd06913219 beta3GnTL1_like Beta 1, 3-N-acetylglucosaminyltransfera 100.0
cd04196214 GT_2_like_d Subfamily of Glycosyltransferase Family GT2 100.0
PRK10018279 predicted glycosyl transferase; Provisional 100.0
cd06433202 GT_2_WfgS_like WfgS and WfeV are involved in O-antigen 100.0
PRK10073329 predicted glycosyl transferase; Provisional 100.0
PRK10063248 predicted glycosyl transferase; Provisional 100.0
cd02525249 Succinoglycan_BP_ExoA ExoA is involved in the biosynthe 100.0
cd02522221 GT_2_like_a GT_2_like_a represents a glycosyltransferas 100.0
PRK11204421 N-glycosyltransferase PgaC; Provisional 100.0
cd06421234 CESA_CelA_like CESA_CelA_like are involved in the elong 100.0
TIGR03111439 glyc2_xrt_Gpos1 putative glycosyltransferase TIGR03111. 100.0
cd04186166 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 100.0
cd06420182 GT2_Chondriotin_Pol_N N-terminal domain of Chondroitin 100.0
cd06439251 CESA_like_1 CESA_like_1 is a member of the cellulose sy 99.97
cd02520196 Glucosylceramide_synthase Glucosylceramide synthase cat 99.97
cd06435236 CESA_NdvC_like NdvC_like proteins in this family are pu 99.97
cd06437232 CESA_CaSu_A2 Cellulose synthase catalytic subunit A2 (C 99.97
cd06427241 CESA_like_2 CESA_like_2 is a member of the cellulose sy 99.96
cd04185202 GT_2_like_b Subfamily of Glycosyltransferase Family GT2 99.96
cd04192229 GT_2_like_e Subfamily of Glycosyltransferase Family GT2 99.96
cd02510299 pp-GalNAc-T pp-GalNAc-T initiates the formation of muci 99.95
TIGR03469384 HonB hopene-associated glycosyltransferase HpnB. This f 99.94
cd02526237 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl transfe 99.94
TIGR03030713 CelA cellulose synthase catalytic subunit (UDP-forming) 99.93
COG1215439 Glycosyltransferases, probably involved in cell wall bi 99.93
COG1216305 Predicted glycosyltransferases [General function predic 99.92
cd06434235 GT2_HAS Hyaluronan synthases catalyze polymerization of 99.91
TIGR03472373 HpnI hopanoid biosynthesis associated glycosyl transfer 99.91
cd04179185 DPM_DPG-synthase_like DPM_DPG-synthase_like is a member 99.84
PRK11498858 bcsA cellulose synthase catalytic subunit; Provisional 99.81
cd00761156 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A 99.81
cd04190244 Chitin_synth_C C-terminal domain of Chitin Synthase cat 99.81
KOG3738559 consensus 99.8
KOG3736578 consensus 99.78
cd04191254 Glucan_BSP_ModH Glucan_BSP_ModH catalyzes the elongatio 99.72
KOG3737603 consensus 99.68
KOG2978238 consensus 99.56
TIGR01556291 rhamnosyltran rhamnosyltransferase; InterPro: IPR006446 99.51
cd02514334 GT13_GLCNAC-TI GT13_GLCNAC-TI is involved in an essenti 98.97
KOG2547431 consensus 98.94
pfam03071434 GNT-I GNT-I family. Alpha-1,3-mannosyl-glycoprotein bet 98.81
PRK11234646 nfrB bacteriophage N4 adsorption protein B; Provisional 98.76
COG4092346 Predicted glycosyltransferase involved in capsule biosy 98.65
KOG3588494 consensus 98.19
cd00899219 b4GalT Beta-4-Galactosyltransferase is involved in the 97.33
pfam02709271 Galactosyl_T_2 Galactosyltransferase. This is a family 97.27
KOG2571862 consensus 95.62
KOG1413411 consensus 95.21
COG1209286 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biog 94.63
cd02525249 Succinoglycan_BP_ExoA ExoA is involved in the biosynthe 100.0
cd02526237 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl transfe 100.0
COG1216305 Predicted glycosyltransferases [General function predic 100.0
cd04185202 GT_2_like_b Subfamily of Glycosyltransferase Family GT2 100.0
cd02522221 GT_2_like_a GT_2_like_a represents a glycosyltransferas 100.0
cd02510299 pp-GalNAc-T pp-GalNAc-T initiates the formation of muci 100.0
PRK10073329 predicted glycosyl transferase; Provisional 99.96
PRK10018279 predicted glycosyl transferase; Provisional 99.96
TIGR03030 713 CelA cellulose synthase catalytic subunit (UDP-forming) 99.91
KOG3736 578 consensus 99.89
cd04190244 Chitin_synth_C C-terminal domain of Chitin Synthase cat 99.86
TIGR01556291 rhamnosyltran rhamnosyltransferase; InterPro: IPR006446 99.84
KOG3737 603 consensus 99.8
KOG3738 559 consensus 99.74
PRK10714324 undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose 99.63
KOG3588494 consensus 99.21
KOG3916372 consensus 98.87
cd02538240 G1P_TT_short G1P_TT_short is the short form of glucose- 96.33
cd04189236 G1P_TT_long G1P_TT_long represents the long form of glu 93.52
PRK13368238 3-deoxy-manno-octulosonate cytidylyltransferase; Provis 93.36
COG1213239 Predicted sugar nucleotidyltransferases [Cell envelope 92.85
cd04186166 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 100.0
cd06421234 CESA_CelA_like CESA_CelA_like are involved in the elong 100.0
cd04184202 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like proteins 100.0
cd06435236 CESA_NdvC_like NdvC_like proteins in this family are pu 100.0
cd06439251 CESA_like_1 CESA_like_1 is a member of the cellulose sy 100.0
PRK11204421 N-glycosyltransferase PgaC; Provisional 100.0
cd06420182 GT2_Chondriotin_Pol_N N-terminal domain of Chondroitin 100.0
cd02520196 Glucosylceramide_synthase Glucosylceramide synthase cat 100.0
TIGR03111 439 glyc2_xrt_Gpos1 putative glycosyltransferase TIGR03111. 100.0
cd06437232 CESA_CaSu_A2 Cellulose synthase catalytic subunit A2 (C 100.0
cd04192229 GT_2_like_e Subfamily of Glycosyltransferase Family GT2 100.0
cd04195201 GT2_AmsE_like GT2_AmsE_like is involved in exopolysacch 100.0
cd06433202 GT_2_WfgS_like WfgS and WfeV are involved in O-antigen 100.0
cd04196214 GT_2_like_d Subfamily of Glycosyltransferase Family GT2 100.0
cd06913219 beta3GnTL1_like Beta 1, 3-N-acetylglucosaminyltransfera 100.0
cd06427241 CESA_like_2 CESA_like_2 is a member of the cellulose sy 99.98
cd06434235 GT2_HAS Hyaluronan synthases catalyze polymerization of 99.97
TIGR03469384 HonB hopene-associated glycosyltransferase HpnB. This f 99.97
TIGR03472373 HpnI hopanoid biosynthesis associated glycosyl transfer 99.97
PRK10063248 predicted glycosyl transferase; Provisional 99.93
PRK11498 858 bcsA cellulose synthase catalytic subunit; Provisional 99.82
cd06438183 EpsO_like EpsO protein participates in the methanolan s 99.81
cd04188211 DPG_synthase DPG_synthase is involved in protein N-link 99.8
cd06442224 DPM1_like DPM1_like represents putative enzymes similar 99.78
cd00761156 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A 99.76
cd04191254 Glucan_BSP_ModH Glucan_BSP_ModH catalyzes the elongatio 99.72
PTZ00260336 glycosyl transferase group 2; Provisional 99.63
KOG2978238 consensus 99.57
KOG2547431 consensus 99.33
pfam02709271 Galactosyl_T_2 Galactosyltransferase. This is a family 99.05
cd00899219 b4GalT Beta-4-Galactosyltransferase is involved in the 98.91
PRK11234 646 nfrB bacteriophage N4 adsorption protein B; Provisional 98.66
cd02514334 GT13_GLCNAC-TI GT13_GLCNAC-TI is involved in an essenti 98.4
COG4092346 Predicted glycosyltransferase involved in capsule biosy 98.39
pfam03071434 GNT-I GNT-I family. Alpha-1,3-mannosyl-glycoprotein bet 98.27
pfam11397324 GlcNAc Glycosyltransferase (GlcNAc). GlcNAc is an enzym 97.91
pfam05679498 CHGN Chondroitin N-acetylgalactosaminyltransferase. 97.75
PRK05454 663 glucosyltransferase MdoH; Provisional 97.62
KOG3917310 consensus 97.19
COG2943 736 MdoH Membrane glycosyltransferase [Cell envelope biogen 96.5
PRK09451 456 glmU bifunctional N-acetylglucosamine-1-phosphate uridy 95.88
cd04181217 NTP_transferase NTP_transferases catalyze the transfer 95.18
cd06915223 NTP_transferase_WcbM_like WcbM_like is a subfamily of n 94.91
pfam00483247 NTP_transferase Nucleotidyl transferase. This family in 94.7
PRK05450248 3-deoxy-manno-octulosonate cytidylyltransferase; Provis 92.64
PRK13389302 UTP--glucose-1-phosphate uridylyltransferase subunit Ga 91.37
cd02517239 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the act 90.58
cd06423180 CESA_like CESA_like is the cellulose synthase superfami 100.0
pfam00535168 Glycos_transf_2 Glycosyl transferase family 2. Diverse 99.89
cd06436191 GlcNAc-1-P_transferase N-acetyl-glucosamine transferase 99.87
cd04187181 DPM1_like_bac Bacterial DPM1_like enzymes are related t 99.51
cd06423180 CESA_like CESA_like is the cellulose synthase superfami 99.96
cd06436191 GlcNAc-1-P_transferase N-acetyl-glucosamine transferase 99.87
PRK10714324 undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose 99.78
cd04187181 DPM1_like_bac Bacterial DPM1_like enzymes are related t 99.74
PRK05454663 glucosyltransferase MdoH; Provisional 98.98
COG2943736 MdoH Membrane glycosyltransferase [Cell envelope biogen 98.62
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate uridy 95.92
COG1215439 Glycosyltransferases, probably involved in cell wall bi 99.95
cd02511229 Beta4Glucosyltransferase UDP-glucose LOS-beta-1,4 gluco 99.7
COG0463291 WcaA Glycosyltransferases involved in cell wall biogene 99.62
cd04179185 DPM_DPG-synthase_like DPM_DPG-synthase_like is a member 99.59
PRK13915307 putative glucosyl-3-phosphoglycerate synthase; Provisio 99.18
KOG2977323 consensus 98.81
cd00218223 GlcAT-I Beta1,3-glucuronyltransferase I (GlcAT-I) is in 96.45
pfam11316235 DUF3118 Protein of unknown function (DUF3118). This bac 96.42
pfam09258244 Glyco_transf_64 Glycosyl transferase family 64 domain. 95.07
KOG1476330 consensus 94.74
pfam07507310 WavE WavE lipopolysaccharide synthesis. These proteins 94.39
pfam11735244 CAP59_mtransfer Cryptococcal mannosyltransferase 1. The 94.21
PRK00317193 mobA molybdopterin-guanine dinucleotide biosynthesis pr 93.71
pfam01983217 CofC Guanylyl transferase CofC like. Coenzyme F420 is a 92.6
cd02503181 MobA MobA catalyzes the formation of molybdopterin guan 91.06
pfam00535168 Glycos_transf_2 Glycosyl transferase family 2. Diverse 99.92
cd04188211 DPG_synthase DPG_synthase is involved in protein N-link 99.87
cd06438183 EpsO_like EpsO protein participates in the methanolan s 99.85
COG0463291 WcaA Glycosyltransferases involved in cell wall biogene 99.84
cd06442224 DPM1_like DPM1_like represents putative enzymes similar 99.83
cd02511229 Beta4Glucosyltransferase UDP-glucose LOS-beta-1,4 gluco 99.74
KOG2977323 consensus 99.34
pfam11316235 DUF3118 Protein of unknown function (DUF3118). This bac 97.91
TIGR02460394 osmo_MPGsynth mannosyl-3-phosphoglycerate synthase; Int 96.55
pfam09488381 Osmo_MPGsynth Mannosyl-3-phosphoglycerate synthase (osm 95.96
pfam03452270 Anp1 Anp1. The members of this family (Anp1, Van1 and M 95.44
pfam07507310 WavE WavE lipopolysaccharide synthesis. These proteins 94.85
pfam01697262 DUF23 Domain of unknown function. This family consists 94.36
PTZ00260336 glycosyl transferase group 2; Provisional 99.8
PRK13915307 putative glucosyl-3-phosphoglycerate synthase; Provisio 99.57
pfam03142536 Chitin_synth_2 Chitin synthase. Members of this family 98.33
pfam03142 536 Chitin_synth_2 Chitin synthase. Members of this family 98.15
KOG2571 862 consensus 97.65
pfam03452270 Anp1 Anp1. The members of this family (Anp1, Van1 and M 96.25
pfam05679498 CHGN Chondroitin N-acetylgalactosaminyltransferase. 95.64
TIGR01208361 rmlA_long glucose-1-phosphate thymidylyltransferase; In 95.26
KOG3916372 consensus 93.95
pfam03552716 Cellulose_synt Cellulose synthase. Cellulose, an aggreg 91.37
pfam05045498 RgpF Rhamnan synthesis protein F. This family consists 90.42
>cd04184 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis Back     alignment and domain information
>cd04195 GT2_AmsE_like GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis Back     alignment and domain information
>cd06913 beta3GnTL1_like Beta 1, 3-N-acetylglucosaminyltransferase is essential for the formation of poly-N-acetyllactosamine Back     alignment and domain information
>cd04196 GT_2_like_d Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>PRK10018 predicted glycosyl transferase; Provisional Back     alignment and domain information
>cd06433 GT_2_WfgS_like WfgS and WfeV are involved in O-antigen biosynthesis Back     alignment and domain information
>PRK10073 predicted glycosyl transferase; Provisional Back     alignment and domain information
>PRK10063 predicted glycosyl transferase; Provisional Back     alignment and domain information
>cd02525 Succinoglycan_BP_ExoA ExoA is involved in the biosynthesis of succinoglycan Back     alignment and domain information
>cd02522 GT_2_like_a GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function Back     alignment and domain information
>PRK11204 N-glycosyltransferase PgaC; Provisional Back     alignment and domain information
>cd06421 CESA_CelA_like CESA_CelA_like are involved in the elongation of the glucan chain of cellulose Back     alignment and domain information
>TIGR03111 glyc2_xrt_Gpos1 putative glycosyltransferase TIGR03111 Back     alignment and domain information
>cd04186 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd06420 GT2_Chondriotin_Pol_N N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase Back     alignment and domain information
>cd06439 CESA_like_1 CESA_like_1 is a member of the cellulose synthase (CESA) superfamily Back     alignment and domain information
>cd02520 Glucosylceramide_synthase Glucosylceramide synthase catalyzes the first glycosylation step of glycosphingolipid synthesis Back     alignment and domain information
>cd06435 CESA_NdvC_like NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase Back     alignment and domain information
>cd06437 CESA_CaSu_A2 Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex Back     alignment and domain information
>cd06427 CESA_like_2 CESA_like_2 is a member of the cellulose synthase superfamily Back     alignment and domain information
>cd04185 GT_2_like_b Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd04192 GT_2_like_e Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd02510 pp-GalNAc-T pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information
>TIGR03469 HonB hopene-associated glycosyltransferase HpnB Back     alignment and domain information
>cd02526 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl transferase Back     alignment and domain information
>TIGR03030 CelA cellulose synthase catalytic subunit (UDP-forming) Back     alignment and domain information
>COG1215 Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1216 Predicted glycosyltransferases [General function prediction only] Back     alignment and domain information
>cd06434 GT2_HAS Hyaluronan synthases catalyze polymerization of hyaluronan Back     alignment and domain information
>TIGR03472 HpnI hopanoid biosynthesis associated glycosyl transferase protein HpnI Back     alignment and domain information
>cd04179 DPM_DPG-synthase_like DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily Back     alignment and domain information
>PRK11498 bcsA cellulose synthase catalytic subunit; Provisional Back     alignment and domain information
>cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>cd04190 Chitin_synth_C C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin Back     alignment and domain information
>KOG3738 consensus Back     alignment and domain information
>KOG3736 consensus Back     alignment and domain information
>cd04191 Glucan_BSP_ModH Glucan_BSP_ModH catalyzes the elongation of beta-1,2 polyglucose chains of glucan Back     alignment and domain information
>KOG3737 consensus Back     alignment and domain information
>KOG2978 consensus Back     alignment and domain information
>TIGR01556 rhamnosyltran rhamnosyltransferase; InterPro: IPR006446 This subfamily is composed of sequences from the gamma proteobacteria that function as L-rhamnosyltransferases in the synthesis of their respective surface polysaccharides Back     alignment and domain information
>cd02514 GT13_GLCNAC-TI GT13_GLCNAC-TI is involved in an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides Back     alignment and domain information
>KOG2547 consensus Back     alignment and domain information
>pfam03071 GNT-I GNT-I family Back     alignment and domain information
>PRK11234 nfrB bacteriophage N4 adsorption protein B; Provisional Back     alignment and domain information
>COG4092 Predicted glycosyltransferase involved in capsule biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG3588 consensus Back     alignment and domain information
>cd00899 b4GalT Beta-4-Galactosyltransferase is involved in the formation of the poly-N-acetyllactosamine core structures present in glycoproteins and glycosphingolipids Back     alignment and domain information
>pfam02709 Galactosyl_T_2 Galactosyltransferase Back     alignment and domain information
>KOG2571 consensus Back     alignment and domain information
>KOG1413 consensus Back     alignment and domain information
>COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd02525 Succinoglycan_BP_ExoA ExoA is involved in the biosynthesis of succinoglycan Back     alignment and domain information
>cd02526 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl transferase Back     alignment and domain information
>COG1216 Predicted glycosyltransferases [General function prediction only] Back     alignment and domain information
>cd04185 GT_2_like_b Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd02522 GT_2_like_a GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function Back     alignment and domain information
>cd02510 pp-GalNAc-T pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information
>PRK10073 predicted glycosyl transferase; Provisional Back     alignment and domain information
>PRK10018 predicted glycosyl transferase; Provisional Back     alignment and domain information
>TIGR03030 CelA cellulose synthase catalytic subunit (UDP-forming) Back     alignment and domain information
>KOG3736 consensus Back     alignment and domain information
>cd04190 Chitin_synth_C C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin Back     alignment and domain information
>TIGR01556 rhamnosyltran rhamnosyltransferase; InterPro: IPR006446 This subfamily is composed of sequences from the gamma proteobacteria that function as L-rhamnosyltransferases in the synthesis of their respective surface polysaccharides Back     alignment and domain information
>KOG3737 consensus Back     alignment and domain information
>KOG3738 consensus Back     alignment and domain information
>PRK10714 undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase; Provisional Back     alignment and domain information
>KOG3588 consensus Back     alignment and domain information
>KOG3916 consensus Back     alignment and domain information
>cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04186 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd06421 CESA_CelA_like CESA_CelA_like are involved in the elongation of the glucan chain of cellulose Back     alignment and domain information
>cd04184 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis Back     alignment and domain information
>cd06435 CESA_NdvC_like NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase Back     alignment and domain information
>cd06439 CESA_like_1 CESA_like_1 is a member of the cellulose synthase (CESA) superfamily Back     alignment and domain information
>PRK11204 N-glycosyltransferase PgaC; Provisional Back     alignment and domain information
>cd06420 GT2_Chondriotin_Pol_N N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase Back     alignment and domain information
>cd02520 Glucosylceramide_synthase Glucosylceramide synthase catalyzes the first glycosylation step of glycosphingolipid synthesis Back     alignment and domain information
>TIGR03111 glyc2_xrt_Gpos1 putative glycosyltransferase TIGR03111 Back     alignment and domain information
>cd06437 CESA_CaSu_A2 Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex Back     alignment and domain information
>cd04192 GT_2_like_e Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd04195 GT2_AmsE_like GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis Back     alignment and domain information
>cd06433 GT_2_WfgS_like WfgS and WfeV are involved in O-antigen biosynthesis Back     alignment and domain information
>cd04196 GT_2_like_d Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd06913 beta3GnTL1_like Beta 1, 3-N-acetylglucosaminyltransferase is essential for the formation of poly-N-acetyllactosamine Back     alignment and domain information
>cd06427 CESA_like_2 CESA_like_2 is a member of the cellulose synthase superfamily Back     alignment and domain information
>cd06434 GT2_HAS Hyaluronan synthases catalyze polymerization of hyaluronan Back     alignment and domain information
>TIGR03469 HonB hopene-associated glycosyltransferase HpnB Back     alignment and domain information
>TIGR03472 HpnI hopanoid biosynthesis associated glycosyl transferase protein HpnI Back     alignment and domain information
>PRK10063 predicted glycosyl transferase; Provisional Back     alignment and domain information
>PRK11498 bcsA cellulose synthase catalytic subunit; Provisional Back     alignment and domain information
>cd06438 EpsO_like EpsO protein participates in the methanolan synthesis Back     alignment and domain information
>cd04188 DPG_synthase DPG_synthase is involved in protein N-linked glycosylation Back     alignment and domain information
>cd06442 DPM1_like DPM1_like represents putative enzymes similar to eukaryotic DPM1 Back     alignment and domain information
>cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>cd04191 Glucan_BSP_ModH Glucan_BSP_ModH catalyzes the elongation of beta-1,2 polyglucose chains of glucan Back     alignment and domain information
>PTZ00260 glycosyl transferase group 2; Provisional Back     alignment and domain information
>KOG2978 consensus Back     alignment and domain information
>KOG2547 consensus Back     alignment and domain information
>pfam02709 Galactosyl_T_2 Galactosyltransferase Back     alignment and domain information
>cd00899 b4GalT Beta-4-Galactosyltransferase is involved in the formation of the poly-N-acetyllactosamine core structures present in glycoproteins and glycosphingolipids Back     alignment and domain information
>PRK11234 nfrB bacteriophage N4 adsorption protein B; Provisional Back     alignment and domain information
>cd02514 GT13_GLCNAC-TI GT13_GLCNAC-TI is involved in an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides Back     alignment and domain information
>COG4092 Predicted glycosyltransferase involved in capsule biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam03071 GNT-I GNT-I family Back     alignment and domain information
>pfam11397 GlcNAc Glycosyltransferase (GlcNAc) Back     alignment and domain information
>pfam05679 CHGN Chondroitin N-acetylgalactosaminyltransferase Back     alignment and domain information
>PRK05454 glucosyltransferase MdoH; Provisional Back     alignment and domain information
>KOG3917 consensus Back     alignment and domain information
>COG2943 MdoH Membrane glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information