254780919

254780919

dTDP-4-dehydrorhamnose 3,5-epimerase

GeneID in NCBI database:8209939Locus tag:CLIBASIA_04090
Protein GI in NCBI database:254780919Protein Accession:YP_003065332.1
Gene range:+(901563, 902159)Protein Length:198aa
Gene description:dTDP-4-dehydrorhamnose 3,5-epimerase
COG prediction:[M] dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes
KEGG prediction:rfbC; dTDP-4-dehydrorhamnose 3,5-epimerase; K01790 dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
SEED prediction:dTDP-4-dehydrorhamnose 3,5-epimerase (EC 5.1.3.13)
Pathway involved in KEGG:Polyketide sugar unit biosynthesis [PATH:las00523]
Streptomycin biosynthesis [PATH:las00521]
Subsystem involved in SEED:dTDP-rhamnose synthesis;
Rhamnose containing glycans
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDGLPLLSLNMERDLLCV
cccccEEEEcccEEEEcccEEEEEEcHHHHHHccccccEEEEEEEEccccccEEEEEccccccccccEEEEcccEEEEEEEEcccccccccEEEEEEEcccccEEEEEccccEEEEEEccccEEEEEcccccccccccccEEcccHHHcccccccccccEEEcHHHcccccHHHcccccccccEEHHHHccccccccc
cccccEEEEEccccccccccccccHcHHHHHHHcccccHccccccccHcccEEEEEEEEcccccccEEEEEEEcEEEEEEEEccccccccccEEEEEEEcccccEEEEcccEEEEEEEcccEEEEEEEEcccccHHHEEEcccccccccccccHccccccEccHHHHccccHHHHccccEEccccEEEcccHHHcccc
mninpvrilktrkfedsrgwfsqTYSSKLLkelglqdvfvqdnhsfsfdcgtirglhfqrppyaqaKLVRCIAGRIFDIAVdirrnsptygcWVSLEIsannglqiyiptgfahgfMTLEMNTEVIYKVTDFYsvehdsgvawqdksiditwplldtilpsvsekdqnlpflnqidspfeydglpllslnmerdllcv
mninpvrilktrkfedsrgwFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDGLPLLSLNMERDLLCV
MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDGLPLLSLNMERDLLCV
MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDGLPLLSLNMERDLLCV
MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDGLPLLSLNMERDLLCV
MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDGLPLLSLNMERDLLCV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDGLPLLSLNMERDLLCV
MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDGLPLLSLNMERDLLCV
MNINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYDGLPLLSLNMERDLLCV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target198 dTDP-4-dehydrorhamnose 3,5-epimerase [Candidatus Liberi
315122655199 dTDP-4-dehydrorhamnose 3,5-epimerase [Candidatus Liberi 1 7e-85
254500091192 dTDP-4-dehydrorhamnose 3,5-epimerase [Labrenzia alexand 1 4e-57
302382272205 dTDP-4-dehydrorhamnose 3,5-epimerase [Brevundimonas sub 1 1e-56
312115798196 dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodomicrobium va 1 1e-54
148556919185 dTDP-4-dehydrorhamnose 3,5-epimerase [Sphingomonas witt 1 7e-54
90425680184 dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodopseudomonas 1 2e-51
316935627184 dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodopseudomonas 1 4e-51
195953910190 dTDP-4-dehydrorhamnose 3,5-epimerase [Hydrogenobaculum 1 1e-50
83955938198 dTDP-4-dehydrorhamnose 3,5-epimerase [Sulfitobacter sp. 1 2e-50
195953941190 dTDP-4-dehydrorhamnose 3,5-epimerase [Hydrogenobaculum 1 4e-50
>gi|315122655|ref|YP_004063144.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 199 Back     alignment and organism information
 Score =  317 bits (811), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 170/196 (86%)

Query: 3   INPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRPP 62
           INPVRILKT+  ED RGWFS+TY+    K+ G +DVFVQDNHSFS + GTIRGLHFQ+PP
Sbjct: 4   INPVRILKTKILEDDRGWFSETYNDNCFKKNGFKDVFVQDNHSFSLNTGTIRGLHFQKPP 63

Query: 63  YAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMN 122
           +AQAK+VRC++GRIFD+AVD+R++SPTYG W+SLEISA++GLQIYIP GFAHGFMTLE N
Sbjct: 64  HAQAKIVRCVSGRIFDVAVDVRKDSPTYGNWISLEISASSGLQIYIPIGFAHGFMTLEPN 123

Query: 123 TEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDSPFEYD 182
           TEVIYKVTDFYS  HDSGV WQDKSI I WPLL+ + PS+S+KD NLPFLNQ+DSPF YD
Sbjct: 124 TEVIYKVTDFYSSSHDSGVLWQDKSIGIRWPLLEKVSPSLSDKDMNLPFLNQLDSPFTYD 183

Query: 183 GLPLLSLNMERDLLCV 198
           G PLL L+M+RD+ CV
Sbjct: 184 GFPLLPLDMDRDMSCV 199


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|254500091|ref|ZP_05112243.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Labrenzia alexandrii DFL-11] Length = 192 Back     alignment and organism information
>gi|302382272|ref|YP_003818095.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Brevundimonas subvibrioides ATCC 15264] Length = 205 Back     alignment and organism information
>gi|312115798|ref|YP_004013394.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodomicrobium vannielii ATCC 17100] Length = 196 Back     alignment and organism information
>gi|148556919|ref|YP_001264501.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sphingomonas wittichii RW1] Length = 185 Back     alignment and organism information
>gi|90425680|ref|YP_534050.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodopseudomonas palustris BisB18] Length = 184 Back     alignment and organism information
>gi|316935627|ref|YP_004110609.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Rhodopseudomonas palustris DX-1] Length = 184 Back     alignment and organism information
>gi|195953910|ref|YP_002122200.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Hydrogenobaculum sp. Y04AAS1] Length = 190 Back     alignment and organism information
>gi|83955938|ref|ZP_00964449.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Sulfitobacter sp. NAS-14.1] Length = 198 Back     alignment and organism information
>gi|195953941|ref|YP_002122231.1| dTDP-4-dehydrorhamnose 3,5-epimerase [Hydrogenobaculum sp. Y04AAS1] Length = 190 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target198 dTDP-4-dehydrorhamnose 3,5-epimerase [Candidatus Liberi
TIGR01221176 TIGR01221, rmlC, dTDP-4-dehydrorhamnose 3,5-epimerase 8e-56
COG1898173 COG1898, RfbC, dTDP-4-dehydrorhamnose 3,5-epimerase and 2e-49
pfam00908177 pfam00908, dTDP_sugar_isom, dTDP-4-dehydrorhamnose 3,5- 3e-67
>gnl|CDD|162258 TIGR01221, rmlC, dTDP-4-dehydrorhamnose 3,5-epimerase Back     alignment and domain information
>gnl|CDD|32082 COG1898, RfbC, dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|144487 pfam00908, dTDP_sugar_isom, dTDP-4-dehydrorhamnose 3,5-epimerase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 198 dTDP-4-dehydrorhamnose 3,5-epimerase [Candidatus Liberi
TIGR01221181 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase; InterPro: IP 100.0
pfam00908177 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase. T 100.0
COG1898173 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and related e 100.0
pfam05523131 FdtA WxcM-like, C-terminal. This family includes FdtA f 99.52
TIGR03404 367 bicupin_oxalic bicupin, oxalate decarboxylase family. M 96.36
smart00835146 Cupin_1 Cupin. This family represents the conserved bar 95.11
pfam00190139 Cupin_1 Cupin. This family represents the conserved bar 94.46
COG2140209 Thermophilic glucose-6-phosphate isomerase and related 94.26
LOAD_DSBH66 consensus 93.9
PRK04190191 glucose-6-phosphate isomerase; Provisional 90.32
>TIGR01221 rmlC dTDP-4-dehydrorhamnose 3,5-epimerase; InterPro: IPR000888 Deoxythymidine diphosphate (dTDP)-4-keto-6-deoxy-d-hexulose 3, 5-epimerase (RmlC, 5 Back     alignment and domain information
>pfam00908 dTDP_sugar_isom dTDP-4-dehydrorhamnose 3,5-epimerase Back     alignment and domain information
>COG1898 RfbC dTDP-4-dehydrorhamnose 3,5-epimerase and related enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam05523 FdtA WxcM-like, C-terminal Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>smart00835 Cupin_1 Cupin Back     alignment and domain information
>pfam00190 Cupin_1 Cupin Back     alignment and domain information
>COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>LOAD_DSBH consensus Back     alignment and domain information
>PRK04190 glucose-6-phosphate isomerase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target198 dTDP-4-dehydrorhamnose 3,5-epimerase [Candidatus Liberi
1rtv_A184 Rmlc (Dtdp-6-Deoxy-D-Xylo-4-Hexulose 3,5-Epimerase) 3e-38
2ixi_A184 Rmlc P Aeruginosa With Dtdp-Xylose Length = 184 4e-38
1dzr_A183 Rmlc From Salmonella Typhimurium Length = 183 4e-38
1ep0_A185 High Resolution Crystal Structure Of Dtdp-6-Deoxy-D 2e-35
1pm7_A202 Rmlc (Dtdp-6-Deoxy-D-Xylo-4-Hexulose 3,5-Epimerase) 1e-30
1upi_A225 Mycobacterium Tuberculosis Rmlc Epimerase (Rv3465) 1e-29
2c0z_A216 The 1.6 A Resolution Crystal Structure Of Novw: A 4 5e-28
1wlt_A196 Crystal Structure Of Dtdp-4-Dehydrorhamnose 3,5-Epi 3e-24
2b9u_A176 Crystal Structure Of Dtdp-4-Dehydrorhamnose 3,5-Epi 1e-23
1ofn_A205 Purification, Crystallisation And Preliminary Struc 5e-22
1wa4_A205 Crystal Structure Of The M131f L135a Evad Double Mu 8e-22
1nxm_A197 The High Resolution Structures Of Rmlc From Strepto 1e-16
>gi|46015557|pdb|1RTV|A Chain A, Rmlc (Dtdp-6-Deoxy-D-Xylo-4-Hexulose 3,5-Epimerase) Crystal Structure From Pseudomonas Aeruginosa, Apo Structure Length = 184 Back     alignment and structure
 Score =  162 bits (409), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 79/178 (44%), Positives = 106/178 (59%), Gaps = 5/178 (2%)

Query: 1   MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQ 59
           + I  V + + R F D RG+F ++Y+ +  +E  G    FVQDNHS S   G +RGLH+Q
Sbjct: 9   LAIPDVILFEPRVFGDDRGFFFESYNQRAFEEACGHPVSFVQDNHSRSAR-GVLRGLHYQ 67

Query: 60  RPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTL 119
               AQ KLVR   G +FD+AVD+RR SPT+G WV   +SA N  Q++IP GFAHGF+ L
Sbjct: 68  IRQ-AQGKLVRATLGEVFDVAVDLRRGSPTFGQWVGERLSAENKRQMWIPAGFAHGFVVL 126

Query: 120 EMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQIDS 177
               E +YK TDF++ EH+  + W D  + I WPL D   P +SEKD+        D 
Sbjct: 127 SEYAEFLYKTTDFWAPEHERCIVWNDPELKIDWPLQD--APLLSEKDRQGKAFADADC 182


>gi|112491444|pdb|2IXI|A Chain A, Rmlc P Aeruginosa With Dtdp-Xylose Length = 184 Back     alignment and structure
gi|7767043|pdb|1DZR|A Chain A, Rmlc From Salmonella Typhimurium Length = 183 Back     alignment and structure
gi|12084451|pdb|1EP0|A Chain A, High Resolution Crystal Structure Of Dtdp-6-Deoxy-D-Xylo-4- Hexulose 3,5-Epimerase From Methanobacterium Thermoautotrophicum Length = 185 Back     alignment and structure
gi|40889319|pdb|1PM7|A Chain A, Rmlc (Dtdp-6-Deoxy-D-Xylo-4-Hexulose 3,5-Epimerase) Structure From Mycobacterium Tuberculosis And Inhibitor Design. The Apo Structure. Length = 202 Back     alignment and structure
>gi|38493079|pdb|1UPI|A Chain A, Mycobacterium Tuberculosis Rmlc Epimerase (Rv3465) Length = 225 Back     alignment and structure
>gi|88192518|pdb|2C0Z|A Chain A, The 1.6 A Resolution Crystal Structure Of Novw: A 4-Keto-6- Deoxy Sugar Epimerase From The Novobiocin Biosynthetic Gene Cluster Of Streptomyces Spheroides Length = 216 Back     alignment and structure
>gi|73535427|pdb|1WLT|A Chain A, Crystal Structure Of Dtdp-4-Dehydrorhamnose 3,5-Epimerase Homologue From Sulfolobus Tokodaii Length = 196 Back     alignment and structure
gi|118137319|pdb|2B9U|A Chain A, Crystal Structure Of Dtdp-4-Dehydrorhamnose 3,5-Epimerase From Sulfolobus Tokodaii Length = 176 Back     alignment and structure
>gi|48425092|pdb|1OFN|A Chain A, Purification, Crystallisation And Preliminary Structural Studies Of Dtdp-4-Keto-6-Deoxy-Glucose-5-Epimerase (Evad) From Amycolatopsis Orientalis; The Fourth Enzyme In The Dtdp-L-Epivancosamine Biosynthetic Pathway. Length = 205 Back     alignment and structure
>gi|126030141|pdb|1WA4|A Chain A, Crystal Structure Of The M131f L135a Evad Double Mutant Length = 205 Back     alignment and structure
gi|33357526|pdb|1NXM|A Chain A, The High Resolution Structures Of Rmlc From Streptococcus Suis Length = 197 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target198 dTDP-4-dehydrorhamnose 3,5-epimerase [Candidatus Liberi
1ep0_A185 DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, 2e-58
1dzr_A183 DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, 3, 5-h 1e-57
1oi6_A205 PCZA361.16; epimerase, vancomycin group antibiotic, EVA 3e-45
1nxm_A197 DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly rol 6e-33
1upi_A225 DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, 3e-32
2ixk_A184 DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopo 2e-29
1wlt_A196 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epi 2e-29
2c0z_A216 NOVW; isomerase, epimerase, antibiotic biosynthesis, RM 4e-28
3ejk_A174 DTDP sugar isomerase; YP_390184.1, structural genomics, 5e-21
2pa7_A141 DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar bi 1e-10
2zkl_A369 Capsular polysaccharide synthesis enzyme CAP5F; rossman 3e-07
>1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A* Length = 185 Back     alignment and structure
 Score =  220 bits (561), Expect = 2e-58
 Identities = 76/181 (41%), Positives = 101/181 (55%), Gaps = 7/181 (3%)

Query: 1   MNINP-----VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRG 55
                       I++   + D RG+F +T++  + +E GL+  FVQDN S S     +RG
Sbjct: 4   FRFIKTSLDGAIIIEPEVYTDERGYFMETFNEAIFQENGLEVRFVQDNESMSVRG-VLRG 62

Query: 56  LHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHG 115
           LHFQR    Q KLVR I G IFD+AVD+R+NS TYG W  + +S  N  + +IP GFAHG
Sbjct: 63  LHFQREK-PQGKLVRVIRGEIFDVAVDLRKNSDTYGEWTGVRLSDENRREFFIPEGFAHG 121

Query: 116 FMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
           F+ L     V YK T+ Y  E+DSG+ W D  I I WPL       +SEKD+N   L + 
Sbjct: 122 FLALSDECIVNYKCTELYHPEYDSGIPWDDPDIGIDWPLEMVDDLIISEKDRNWKPLREN 181

Query: 176 D 176
            
Sbjct: 182 P 182


>1dzr_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, 3, 5-hexulose epimerase; 2.17A {Salmonella typhimurium} SCOP: b.82.1.1 PDB: 1dzt_A* Length = 183 Back     alignment and structure
>1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A Length = 205 Back     alignment and structure
>1nxm_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} SCOP: b.82.1.1 PDB: 1nyw_A* 1nzc_A* 2ixl_A* Length = 197 Back     alignment and structure
>1upi_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} SCOP: b.82.1.1 PDB: 2ixc_A* 1pm7_A* Length = 225 Back     alignment and structure
>2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A* Length = 184 Back     alignment and structure
>1wlt_A 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} SCOP: b.82.1.1 PDB: 2b9u_A Length = 196 Back     alignment and structure
>2c0z_A NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} SCOP: b.82.1.1 Length = 216 Back     alignment and structure
>3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, joint center for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp} Length = 174 Back     alignment and structure
>2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* Length = 141 Back     alignment and structure
>2zkl_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, isomerase; 2.61A {Staphylococcus aureus} Length = 369 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target198 dTDP-4-dehydrorhamnose 3,5-epimerase [Candidatus Liberi
1upi_A225 DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, 100.0
2c0z_A216 NOVW; isomerase, epimerase, antibiotic biosynthesis, RM 100.0
1ep0_A185 DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, 100.0
2ixk_A184 DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopo 100.0
1dzr_A183 DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, 3, 5-h 100.0
1oi6_A205 PCZA361.16; epimerase, vancomycin group antibiotic, EVA 100.0
1wlt_A196 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epi 100.0
1nxm_A197 DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly rol 100.0
3ejk_A174 DTDP sugar isomerase; YP_390184.1, structural genomics, 100.0
2pa7_A141 DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar bi 99.9
2zkl_A369 Capsular polysaccharide synthesis enzyme CAP5F; rossman 99.79
1j58_A 385 YVRK protein; cupin, decarboxyklase, oxalate, manganese 97.32
2vqa_A 361 SLL1358 protein, MNCA; periplasmic binding protein, met 96.66
1fxz_A476 Glycinin G1; proglycinin, legumin, SEED storage protein 96.32
3d0j_A140 Uncharacterized protein CA_C3497; beta-barrel, structur 95.25
1fi2_A201 Oxalate oxidase, germin; beta-jellyroll, oxidoreductase 93.5
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loops wi 91.19
2xlg_A239 SLL1785 protein, CUCA; metal binding protein, cupin; 1. 95.71
3kgl_A466 Cruciferin; 11S SEED globulin, rapeseed, SEED storage p 95.6
2d5f_A493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED stor 95.54
3c3v_A510 Arachin ARAH3 isoform; peanut allergen, allergy, glycin 95.4
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, manganese 95.38
3ksc_A496 LEGA class, prolegumin; PEA prolegumin, 11S SEED storag 95.28
3fz3_A531 Prunin; TREE NUT allergen, allergy, amandin, almond, 11 95.04
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein, met 94.99
2e9q_A459 11S globulin subunit beta; cucubitin, pumpkin SEED stor 94.96
2ea7_A434 7S globulin-1; beta barrel, cupin superfamily, plant pr 94.94
2phl_A397 Phaseolin; plant SEED storage protein(vicilin); HET: NA 94.62
2o8q_A134 Hypothetical protein; cpuin-like fold, structural genom 94.52
2cav_A445 Protein (canavalin); vicilin, 7S SEED protein, domain d 94.49
1x82_A190 Glucose-6-phosphate isomerase; cupin superfamily, hyper 94.41
2oa2_A148 BH2720 protein; 10175341, structural genomics, joint ce 93.87
1juh_A 350 Quercetin 2,3-dioxygenase; copper, cupin, glycoprotein, 93.42
2q30_A110 Uncharacterized protein; YP_388795.1, structural genomi 93.35
1uij_A 416 Beta subunit of beta conglycinin; double-stranded beta 93.33
1lr5_A163 Auxin binding protein 1; beta jellyroll, double strande 92.76
3ht1_A145 REMF protein; cupin fold, Zn-binding, antibiotic biosyn 92.45
2i45_A107 Hypothetical protein; neisseria meningitidis cupin doma 92.15
1y3t_A 337 Hypothetical protein YXAG; BI cupin, dioxygenase, oxido 91.9
2qnk_A 286 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cu 91.82
1o4t_A133 Putative oxalate decarboxylase; TM1287, structural geno 91.44
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 famil 90.97
1y3t_A337 Hypothetical protein YXAG; BI cupin, dioxygenase, oxido 90.48
3k2o_A336 Bifunctional arginine demethylase and lysyl-hydro JMJD6 90.15
1juh_A350 Quercetin 2,3-dioxygenase; copper, cupin, glycoprotein, 92.9
>1upi_A DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} SCOP: b.82.1.1 PDB: 2ixc_A* 1pm7_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=418.37  Aligned_cols=178  Identities=32%  Similarity=0.608  Sum_probs=170.6

Q ss_pred             CCCCCEEEEECCEEEECCCEEEEEECHHHHHHC-CCCCCEEEEEEEECCCCCEEEECCCCCCCCCHHHHEEECHHHHHHH
Q ss_conf             965753997076220379504211088989867-9987413442331252000000015555544012100002222234
Q gi|254780919|r    1 MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDI   79 (198)
Q Consensus         1 L~I~gv~ii~~~~f~D~RG~f~e~f~~~~~~~~-~~~~~~~Q~n~S~s~~kgvlRGlH~Q~~p~~Q~Klv~ci~G~I~dv   79 (198)
                      |+|+||+++++++|.|+||+|.|+|+.+.++++ +.++.|+|+|+|+| +||||||||||.+|++|+|||+|++|+|+||
T Consensus        26 ~~I~Gv~li~~~~f~D~RG~F~e~f~~~~~~~~~~~~~~~~Q~n~S~S-~kgvlRGlH~Q~~p~~q~Klv~ci~G~I~dv  104 (225)
T 1upi_A           26 LDVPGAWEITPTIHVDSRGLFFEWLTDHGFRAFAGHSLDVRQVNCSVS-SAGVLRGLHFAQLPPSQAKYVTCVSGSVFDV  104 (225)
T ss_dssp             CSSTTEEEEECCEEEETTEEEECSCCHHHHHHHHSSCCCCCEEEEEEE-CTTBEEEEEEECTTTCCCEEEEEEESEEEEE
T ss_pred             CCCCCEEEEECCCEECCCCCEEEEECHHHHHHHHCCCCCCCEEEEEEC-CCCEEEEEEEECCCCCEEEEEEEECCEEEEE
T ss_conf             638976999796267899387785126799986299988762798886-6994999974158887657878540689999


Q ss_pred             HHHCCCCHHHHHHEEEEEEECCCCCEEEECCCCCEEEEEECCCCEEEEEECCCCCCHHCEECCCCCCCCCCCCCCCCCCC
Q ss_conf             33406421333100113662365302333023220345307453389721787671017021688801177478887676
Q gi|254780919|r   80 AVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTIL  159 (198)
Q Consensus        80 vvDlR~~SpTfgk~~~~~Ls~~~~~~l~IP~G~aHGf~~L~d~~~i~Y~~~~~y~p~~e~~i~~~Dp~l~i~Wp~~~~~~  159 (198)
                      +||+|++|||||+|.+++|+++++.+||||+||||||+||+|+|+++|+|+++|+|+.|.+|+|+||.|+|+||+.+...
T Consensus       105 vvDlRk~S~Tfgk~~~~~Ls~~~~~~l~IP~G~aHGf~tL~d~t~v~Y~~s~~y~p~~e~~i~~~Dp~l~I~Wp~~~~~~  184 (225)
T 1upi_A          105 VVDIREGSPTFGRWDSVLLDDQDRRTIYVSEGLAHGFLALQDNSTVMYLCSAEYNPQREHTICATDPTLAVDWPLVDGAA  184 (225)
T ss_dssp             EECCCBTCTTTTCEEEEEEETTTCCEEEECTTCEEEEEECSSSEEEEEEESSCCCTTTEEECCTTCTTTCCCCCCSTTCC
T ss_pred             EEEECCCCCCCCEEEEEEEECCCCCEEECCCCCEEEEEECCCCCEEEEECCCCCCCCCCEEECCCCCCCCCCCCCCCCCC
T ss_conf             97300377648849999955177526984899648999727886899966885083576446489801197899989878


Q ss_pred             CEECHHHHCCCCHHHCCCCC
Q ss_conf             30167884599877818551
Q gi|254780919|r  160 PSVSEKDQNLPFLNQIDSPF  179 (198)
Q Consensus       160 piiS~kD~~~p~l~d~~~~f  179 (198)
                      ||||+||+++|+|+|+.+.+
T Consensus       185 ~IiS~kD~~~p~l~d~~~~~  204 (225)
T 1upi_A          185 PSLSDRDAAAPSFEDVRASG  204 (225)
T ss_dssp             CBCCHHHHTCCCHHHHHHTT
T ss_pred             CEECHHHCCCCCHHHHHHCC
T ss_conf             68798993998989997679



>2c0z_A NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} SCOP: b.82.1.1 Back     alignment and structure
>1ep0_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} SCOP: b.82.1.1 PDB: 1epz_A* Back     alignment and structure
>2ixk_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A* Back     alignment and structure
>1dzr_A DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, 3, 5-hexulose epimerase; 2.17A {Salmonella typhimurium} SCOP: b.82.1.1 PDB: 1dzt_A* Back     alignment and structure
>1oi6_A PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} SCOP: b.82.1.1 PDB: 1ofn_A* 1wa4_A Back     alignment and structure
>1wlt_A 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} SCOP: b.82.1.1 PDB: 2b9u_A Back     alignment and structure
>1nxm_A DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} SCOP: b.82.1.1 PDB: 1nyw_A* 1nzc_A* 2ixl_A* Back     alignment and structure
>3ejk_A DTDP sugar isomerase; YP_390184.1, structural genomics, joint center for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>2pa7_A DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} SCOP: b.82.1.1 PDB: 2pae_A* 2pak_A* 2pam_A* Back     alignment and structure
>2zkl_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, isomerase; 2.61A {Staphylococcus aureus} Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal binding protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices, merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Back     alignment and structure
>2xlg_A SLL1785 protein, CUCA; metal binding protein, cupin; 1.80A {Synechocystis SP} PDB: 2xl7_A 2xl9_A 2xlf_A* 2xla_A Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal binding protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.55A {Burkholderia xenovorans LB400} Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, plant protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle, 5-phospho-D- arabinonate; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 1j3q_A 1j3p_A 1j3r_A* Back     alignment and structure
>2oa2_A BH2720 protein; 10175341, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.41A {Bacillus halodurans} Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; copper, cupin, glycoprotein, beta sandwich, oxidoreductase; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>2q30_A Uncharacterized protein; YP_388795.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.94A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like protein, protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Back     alignment and structure
>3ht1_A REMF protein; cupin fold, Zn-binding, antibiotic biosynthesis, resistomycin, metalloprotein, cyclase, lyase; 1.20A {Streptomyces resistomycificus} PDB: 3ht2_A Back     alignment and structure
>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PSI-2, protein structure initiative; 2.50A {Neisseria meningitidis} Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloenzyme, trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure
>1o4t_A Putative oxalate decarboxylase; TM1287, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSGXRC, structural genomics; 2.00A {Halorhodospira halophila SL1} Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>3k2o_A Bifunctional arginine demethylase and lysyl-hydro JMJD6; structural genomics consortium, SGC, chromatin regulator, developmental protein; 1.75A {Homo sapiens} PDB: 3ld8_A 3ldb_A* Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; copper, cupin, glycoprotein, beta sandwich, oxidoreductase; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 198 dTDP-4-dehydrorhamnose 3,5-epimerase [Candidatus Liberi
d1ep0a_183 b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC 5e-35
d1dzra_183 b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC 4e-34
d2ixha1184 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase 3e-31
d2ixca1198 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase 5e-30
d2c0za1190 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW 4e-28
d1wlta1176 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase 1e-27
d1oi6a_202 b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase E 2e-26
d1nxma_194 b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC 4e-22
d2pa7a1135 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isome 9e-11
>d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 183 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: dTDP-sugar isomerase
domain: dTDP-4-dehydrorhamnose 3,5-epimerase RmlC
species: Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]
 Score =  141 bits (355), Expect = 5e-35
 Identities = 77/175 (44%), Positives = 105/175 (60%), Gaps = 2/175 (1%)

Query: 2   NINPVRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRGLHFQRP 61
           +++   I++   + D RG+F +T++  + +E GL+  FVQDN S S   G +RGLHFQR 
Sbjct: 8   SLDGAIIIEPEVYTDERGYFMETFNEAIFQENGLEVRFVQDNESMSV-RGVLRGLHFQRE 66

Query: 62  PYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEM 121
              Q KLVR I G IFD+AVD+R+NS TYG W  + +S  N  + +IP GFAHGF+ L  
Sbjct: 67  K-PQGKLVRVIRGEIFDVAVDLRKNSDTYGEWTGVRLSDENRREFFIPEGFAHGFLALSD 125

Query: 122 NTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQID 176
              V YK T+ Y  E+DSG+ W D  I I WPL       +SEKD+N   L +  
Sbjct: 126 ECIVNYKCTELYHPEYDSGIPWDDPDIGIDWPLEMVDDLIISEKDRNWKPLRENP 180


>d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]} Length = 183 Back     information, alignment and structure
>d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]} Length = 184 Back     information, alignment and structure
>d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} Length = 198 Back     information, alignment and structure
>d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]} Length = 190 Back     information, alignment and structure
>d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 176 Back     information, alignment and structure
>d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]} Length = 202 Back     information, alignment and structure
>d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]} Length = 194 Back     information, alignment and structure
>d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} Length = 135 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target198 dTDP-4-dehydrorhamnose 3,5-epimerase [Candidatus Liberi
d2ixca1198 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacteriu 100.0
d2c0za1190 Novobiocin biosynthesis protein NovW {Streptomyces caer 100.0
d2ixha1184 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas 100.0
d1ep0a_183 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Met 100.0
d1oi6a_202 dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolato 100.0
d1dzra_183 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella t 100.0
d1wlta1176 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sul 100.0
d1nxma_194 dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcu 100.0
d2pa7a1135 dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurini 99.91
d1fxza2174 Seed storage 7S protein {Soybean (Glycine max), proglyc 96.81
d1j58a_ 372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [T 96.65
g1dgw.1168 Seed storage 7S protein {Jack bean (Canavalia ensiformi 96.51
d2phla2162 Seed storage 7S protein {French bean (Phaseolus vulgari 95.99
d1uika2185 Seed storage 7S protein {Soybean (Glycine max), beta-co 94.99
d1dgwa_178 Seed storage 7S protein {Jack bean (Canavalia ensiformi 94.03
d1uika1203 Seed storage 7S protein {Soybean (Glycine max), beta-co 92.66
d1uija1170 Seed storage 7S protein {Soybean (Glycine max), beta-co 92.56
d2phla1200 Seed storage 7S protein {French bean (Phaseolus vulgari 90.51
d1x82a_190 Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus 95.69
d1j58a_372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [T 95.38
d1juha_ 348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId 94.74
d1od5a2173 Seed storage 7S protein {Soybean (Glycine max), glycini 94.41
d1juha_348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId 93.85
d2et1a1201 Germin {Barley (Hordeum vulgare) [TaxId: 4513]} 93.61
d1y3ta1 330 Hypothetical protein YxaG {Bacillus subtilis [TaxId: 14 93.31
d1o4ta_115 Hypothetical protein TM1287 {Thermotoga maritima [TaxId 92.51
d1y3ta1330 Hypothetical protein YxaG {Bacillus subtilis [TaxId: 14 92.27
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcus jan 90.57
>d2ixca1 b.82.1.1 (A:1-198) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: RmlC-like cupins
family: dTDP-sugar isomerase
domain: dTDP-4-dehydrorhamnose 3,5-epimerase RmlC
species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=100.00  E-value=0  Score=410.56  Aligned_cols=178  Identities=32%  Similarity=0.608  Sum_probs=170.4

Q ss_pred             CCCCCEEEEECCEEEECCCEEEEEECHHHHHHC-CCCCCEEEEEEEECCCCCEEEECCCCCCCCCHHHHEEECHHHHHHH
Q ss_conf             965753997076220379504211088989867-9987413442331252000000015555544012100002222234
Q gi|254780919|r    1 MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDI   79 (198)
Q Consensus         1 L~I~gv~ii~~~~f~D~RG~f~e~f~~~~~~~~-~~~~~~~Q~n~S~s~~kgvlRGlH~Q~~p~~Q~Klv~ci~G~I~dv   79 (198)
                      ++|+||+++++++|.|+||+|.|+|+.++++++ +.++.|+|+|+|.| +||||||||||.+|++|+|||+|++|+|+||
T Consensus         6 ~~I~Gv~~i~~~~f~D~RG~f~e~f~~~~~~~~~~~~~~~~Q~n~S~S-~kgvlRGlH~q~~~~~q~Klv~~i~G~I~dv   84 (198)
T d2ixca1           6 LDVPGAWEITPTIHVDSRGLFFEWLTDHGFRAFAGHSLDVRQVNCSVS-SAGVLRGLHFAQLPPSQAKYVTCVSGSVFDV   84 (198)
T ss_dssp             CSSTTEEEEECCCEEETTEEEEEEEEHHHHHHHHSSCCCCCEEEEEEE-CTTBEEEEEEECTTTCCCEEEEEEESEEEEE
T ss_pred             CCCCCEEEEECCEEECCCCCEEEEECHHHHHHHHCCCCCCEEEEEEEE-EHHHHEEEEEECCCCHHHHHHHHHHCEEEEE
T ss_conf             448966999797067689686780007888874255865301134420-0433133355126512454543210217999


Q ss_pred             HHHCCCCHHHHHHEEEEEEECCCCCEEEECCCCCEEEEEECCCCEEEEEECCCCCCHHCEECCCCCCCCCCCCCCCCCCC
Q ss_conf             33406421333100113662365302333023220345307453389721787671017021688801177478887676
Q gi|254780919|r   80 AVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTIL  159 (198)
Q Consensus        80 vvDlR~~SpTfgk~~~~~Ls~~~~~~l~IP~G~aHGf~~L~d~~~i~Y~~~~~y~p~~e~~i~~~Dp~l~i~Wp~~~~~~  159 (198)
                      +||+|++|||||++..++|+++++++|+||+||||||+||+++|+++|+||++|+|++|.||+|+||.|+|+||+.+...
T Consensus        85 vvDlR~~S~Tfgk~~~~~L~~~~~~~i~IP~G~aHGf~~L~~~~~i~Y~~s~~y~p~~e~~i~~~Dp~l~i~Wp~~~~~~  164 (198)
T d2ixca1          85 VVDIREGSPTFGRWDSVLLDDQDRRTIYVSEGLAHGFLALQDNSTVMYLCSAEYNPQREHTICATDPTLAVDWPLVDGAA  164 (198)
T ss_dssp             EECCCBTCTTTTCEEEEEEETTTCCEEEECTTCEEEEEECSSSEEEEEEESSCCCTTTEEECCTTCTTTCCCCCCSSSSC
T ss_pred             EEECCCCCCCCCCEEEEEEECCCCCEEEECCCCEEEEEEECCCCEEECCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             98324665648817999811477534897499679998606854430136776298888122578821285798988878


Q ss_pred             CEECHHHHCCCCHHHCCCCC
Q ss_conf             30167884599877818551
Q gi|254780919|r  160 PSVSEKDQNLPFLNQIDSPF  179 (198)
Q Consensus       160 piiS~kD~~~p~l~d~~~~f  179 (198)
                      ||||+||+++|+|+|+++..
T Consensus       165 ~ilS~kD~~~~~l~~~~~~~  184 (198)
T d2ixca1         165 PSLSDRDAAAPSFEDVRASG  184 (198)
T ss_dssp             CBCCHHHHTCCCHHHHHHHT
T ss_pred             CEECHHHCCCCCHHHHHHCC
T ss_conf             78898992999989998669



>d2c0za1 b.82.1.1 (A:1-190) Novobiocin biosynthesis protein NovW {Streptomyces caeruleus [TaxId: 195949]} Back     information, alignment and structure
>d2ixha1 b.82.1.1 (A:1-184) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ep0a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1oi6a_ b.82.1.1 (A:) dTDP-4-keto-6-deoxy-glucose-5-epimerase EvaD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1dzra_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wlta1 b.82.1.1 (A:1-176) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1nxma_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Streptococcus suis [TaxId: 1307]} Back     information, alignment and structure
>d2pa7a1 b.82.1.1 (A:2-136) dTDP-6-deoxy-3,4-keto-hexulose isomerase FdtA {Aneurinibacillus thermoaerophilus [TaxId: 143495]} Back     information, alignment and structure
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Back     information, alignment and structure
>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y3ta1 b.82.1.5 (A:5-334) Hypothetical protein YxaG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 198 dTDP-4-dehydrorhamnose 3,5-epimerase [Candidatus L
1upi_A_225 (A:) DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnos 1e-52
2c0z_A_216 (A:) NOVW; isomerase, epimerase, antibiotic biosyn 4e-50
1ep0_A_185 (A:) DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; 2e-49
1oi6_A_205 (A:) PCZA361.16; epimerase, vancomycin group antib 4e-49
1wlt_A_196 (A:) 176AA long hypothetical DTDP-4-dehydrorhamnos 2e-48
2ixk_A_184 (A:) DTDP-4-dehydrorhamnose 3,5-epimerase; isomera 5e-48
1dzr_A_183 (A:) DTDP-4-dehydrorhamnose 3,5-epimerase; isomera 2e-47
1nxm_A_197 (A:) DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; 6e-40
3ejk_A_174 (A:) DTDP sugar isomerase; YP_390184.1, structural 8e-33
2pa7_A_141 (A:) DTDP-6-deoxy-3,4-keto-hexulose isomerase; deo 2e-21
2zkl_A_249-369121 (A:249-369) Capsular polysaccharide synthesis enzy 1e-19
>1upi_A (A:) DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis}Length = 225 Back     alignment and structure
 Score =  200 bits (510), Expect = 1e-52
 Identities = 54/186 (29%), Positives = 91/186 (48%), Gaps = 5/186 (2%)

Query: 1   MNINP-----VRILKTRKFEDSRGWFSQTYSSKLLKELGLQDVFVQDNHSFSFDCGTIRG 55
           M            +      DSRG F +  +    +      + V+  +      G +RG
Sbjct: 21  MKARELDVPGAWEITPTIHVDSRGLFFEWLTDHGFRAFAGHSLDVRQVNCSVSSAGVLRG 80

Query: 56  LHFQRPPYAQAKLVRCIAGRIFDIAVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHG 115
           LHF + P +QAK V C++G +FD+ VDIR  SPT+G W S+ +   +   IY+  G AHG
Sbjct: 81  LHFAQLPPSQAKYVTCVSGSVFDVVVDIREGSPTFGRWDSVLLDDQDRRTIYVSEGLAHG 140

Query: 116 FMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTILPSVSEKDQNLPFLNQI 175
           F+ L+ N+ V+Y  +  Y+ + +  +   D ++ + WPL+D   PS+S++D   P    +
Sbjct: 141 FLALQDNSTVMYLXSAEYNPQREHTIXATDPTLAVDWPLVDGAAPSLSDRDAAAPSFEDV 200

Query: 176 DSPFEY 181
            +    
Sbjct: 201 RASGLL 206


>2c0z_A (A:) NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides}Length = 216 Back     alignment and structure
>1ep0_A (A:) DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus}Length = 185 Back     alignment and structure
>1oi6_A (A:) PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis}Length = 205 Back     alignment and structure
>1wlt_A (A:) 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii}Length = 196 Back     alignment and structure
>2ixk_A (A:) DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A*Length = 184 Back     alignment and structure
>1dzr_A (A:) DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, 3, 5-hexulose epimerase; 2.17A {Salmonella typhimurium}Length = 183 Back     alignment and structure
>1nxm_A (A:) DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis}Length = 197 Back     alignment and structure
>3ejk_A (A:) DTDP sugar isomerase; YP_390184.1, structural genomics, joint center for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp}Length = 174 Back     alignment and structure
>2pa7_A (A:) DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus}Length = 141 Back     alignment and structure
>2zkl_A (A:249-369) Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, isomerase; 2.61A {Staphylococcus aureus}Length = 121 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target198 dTDP-4-dehydrorhamnose 3,5-epimerase [Candidatus Liberi
1upi_A_225 DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pat 100.0
1oi6_A_205 PCZA361.16; epimerase, vancomycin group antibiotic 100.0
2c0z_A_216 NOVW; isomerase, epimerase, antibiotic biosynthesi 100.0
1ep0_A_185 DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; race 100.0
1dzr_A_183 DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, 3 100.0
2ixk_A_184 DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, l 100.0
1wlt_A_196 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 100.0
1nxm_A_197 DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jell 100.0
3ejk_A_174 DTDP sugar isomerase; YP_390184.1, structural geno 100.0
2pa7_A_141 DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysug 99.95
2zkl_A_249-369121 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.88
1juh_A_24-221198 Quercetin 2,3-dioxygenase; copper, cupin, glycopro 97.22
3c3v_A_344-510167 Arachin ARAH3 isoform; peanut allergen, allergy, g 96.68
1fxz_A_310-476167 Glycinin G1; proglycinin, legumin, SEED storage pr 96.68
2d5f_A_339-493155 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 96.51
1fi2_A_201 Oxalate oxidase, germin; beta-jellyroll, oxidoredu 96.42
2o8q_A_134 Hypothetical protein; structural genomics, joint c 95.86
2e9q_A_294-459166 11S globulin subunit beta; cucubitin, pumpkin SEED 95.85
1j58_A_55-232178 YVRK protein; cupin, decarboxyklase, oxalate, mang 95.29
2vqa_A_28-209182 SLL1358 protein, MNCA; periplasmic binding protein 96.61
2qnk_A_19-191173 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol 96.54
1zvf_A_22-176155 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b 96.43
1yfu_A_174 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid 96.34
1uij_A_17-222206 Beta subunit of beta conglycinin; double-stranded 95.81
2oa2_A_148 BH2720 protein; 10175341, structural genomics, joi 95.5
1vj2_A_126 Novel manganese-containing cupin TM1459; structura 95.43
2cav_A_55-254200 Protein (canavalin); vicilin, 7S SEED protein, dom 95.18
1dgw_A_178 Canavalin; duplicated swiss-roll beta barrels, loo 94.95
3bu7_A_83-255173 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 94.41
2pyt_A_133 Ethanolamine utilization protein EUTQ; 16421009, s 94.25
1j58_A_22-54_233-349150 YVRK protein; cupin, decarboxyklase, oxalate, mang 93.98
1x82_A_190 Glucose-6-phosphate isomerase; cupin superfamily, 93.89
1yhf_A_115 Hypothetical protein SPY1581; structural genomics, 93.8
3bal_A_153 Acetylacetone-cleaving enzyme; jelly roll, tetrame 93.8
3h8u_A_125 Uncharacterized conserved protein with double- str 93.62
3d8c_A_33-306274 Hypoxia-inducible factor 1 alpha inhibitor; FIH, H 93.4
2ozi_A_98 Hypothetical protein RPA4178; APC6210, putative pr 93.37
3ht1_A_145 REMF protein; cupin fold, Zn-binding, antibiotic b 93.2
1vrb_A_1-254254 Putative asparaginyl hydroxylase; 2636534, structu 93.13
1zrr_A_179 E-2/E-2' protein; nickel, cupin, beta helix, methi 92.96
2phd_A_62-235174 Gentisate 1,2-dioxygenase; beta-sandwich, oxidored 92.92
3eqe_A_171 Putative cystein deoxygenase; YUBC, SR112, NESG, s 92.85
1y3t_A_22-193172 Hypothetical protein YXAG; BI cupin, dioxygenase, 92.5
2yu1_A_51-323273 JMJC domain-containing histone demethylation prote 92.41
1o4t_A_133 Putative oxalate decarboxylase; TM1287, structural 92.33
2opk_A_112 Hypothetical protein; structural genomics, joint c 92.2
3es1_A_41-172132 Cupin 2, conserved barrel domain protein; YP_00116 92.16
3cjx_A_165 Protein of unknown function with A cupin-like fold 91.98
2ozj_A_114 Cupin 2, conserved barrel; EAT53321.1, structural 91.96
3kv9_A_43-302260 JMJC domain-containing histone demethylation prote 91.86
3kv5_D_134-393260 JMJC domain-containing histone demethylation prote 91.86
3ibm_A_167 Cupin 2, conserved barrel domain protein; cupin 2 91.61
2fqp_A_97 Hypothetical protein BP2299; NP_880937.1, structur 91.28
2i45_A_107 Hypothetical protein; neisseria meningitidis cupin 91.22
2q30_A_110 Uncharacterized protein; YP_388795.1, structural g 91.15
1y9q_A_77-192116 Transcriptional regulator, HTH_3 family; transcrip 91.1
3fjs_A_114 Uncharacterized protein with RMLC-like cupin fold; 91.1
2pfw_A_116 Cupin 2, conserved barrel domain protein; YP_75178 90.99
3kgz_A_156 Cupin 2 conserved barrel domain protein; metallopr 90.91
1sef_A_40-160121 Conserved hypothetical protein; structural genomic 90.8
3jzv_A_166 Uncharacterized protein RRU_A2000; structural geno 90.72
2o1q_A_145 Putative acetyl/propionyl-COA carboxylase, alpha s 90.47
2gu9_A_113 Tetracenomycin polyketide synthesis protein; X-RAY 90.16
2bnm_A_77-198122 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 90.1
3k3o_A_1-274274 PHF8, PHD finger protein 8; histone demethylase, c 90.05
3fz3_A_366-531166 Prunin; TREE NUT allergen, allergy, amandin, almon 95.62
1fxz_A_1-309309 Glycinin G1; proglycinin, legumin, SEED storage pr 95.58
1lr5_A_1-149149 Auxin binding protein 1; beta jellyroll, double st 95.45
2ea7_A_29-224196 7S globulin-1; beta barrel, cupin superfamily, pla 95.33
2d5f_A_1-338 338 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 93.8
2phl_A_20-214195 Phaseolin; plant SEED storage protein(vicilin); HE 93.52
2e9q_A_1-293293 11S globulin subunit beta; cucubitin, pumpkin SEED 92.31
3c3v_A_1-343 343 Arachin ARAH3 isoform; peanut allergen, allergy, g 92.15
>1upi_A (A:) DTDP-4-dehydrorhamnose 3,5-epimerase; rhamnose pathway, PSI, protein structure initiative, TB structural genomics consortium, TB; HET: CME; 1.7A {Mycobacterium tuberculosis} Back     alignment and structure
Probab=100.00  E-value=0  Score=394.84  Aligned_cols=182  Identities=31%  Similarity=0.585  Sum_probs=175.1

Q ss_pred             CCCCCEEEEECCEEEECCCEEEEEECHHHHHHC-CCCCCEEEEEEEECCCCCEEEECCCCCCCCCHHHHEEECHHHHHHH
Q ss_conf             965753997076220379504211088989867-9987413442331252000000015555544012100002222234
Q gi|254780919|r    1 MNINPVRILKTRKFEDSRGWFSQTYSSKLLKEL-GLQDVFVQDNHSFSFDCGTIRGLHFQRPPYAQAKLVRCIAGRIFDI   79 (198)
Q Consensus         1 L~I~gv~ii~~~~f~D~RG~f~e~f~~~~~~~~-~~~~~~~Q~n~S~s~~kgvlRGlH~Q~~p~~Q~Klv~ci~G~I~dv   79 (198)
                      ++|+||++++++.|.|+||+|.|+|+.+++.++ +.++.++|+|+|+| ++||+||||+|.+|++|+|+++|++|+|++|
T Consensus        26 ~~I~Gv~ii~~~~~~D~RG~f~e~f~~~~~~~~~~~~~~~~q~~~s~s-~~G~iRGlH~h~~p~~q~klv~ci~G~i~~v  104 (225)
T 1upi_A           26 LDVPGAWEITPTIHVDSRGLFFEWLTDHGFRAFAGHSLDVRQVNCSVS-SAGVLRGLHFAQLPPSQAKYVTCVSGSVFDV  104 (225)
T ss_dssp             CSSTTEEEEECCEEEETTEEEECSCCHHHHHHHHSSCCCCCEEEEEEE-CTTBEEEEEEECTTTCCCEEEEEEESEEEEE
T ss_pred             CCCCCEEEEECCCEECCCCCEEEECCHHHHHHHHCCCCCCHHHHHHHH-HHHHEEEEEEECCCCHHHHHEEEEEEEEEEE
T ss_conf             648966999793167889485685147899986199864023333222-2333054577316511343100100048999


Q ss_pred             HHHCCCCHHHHHHEEEEEEECCCCCEEEECCCCCEEEEEECCCCEEEEEECCCCCCHHCEECCCCCCCCCCCCCCCCCCC
Q ss_conf             33406421333100113662365302333023220345307453389721787671017021688801177478887676
Q gi|254780919|r   80 AVDIRRNSPTYGCWVSLEISANNGLQIYIPTGFAHGFMTLEMNTEVIYKVTDFYSVEHDSGVAWQDKSIDITWPLLDTIL  159 (198)
Q Consensus        80 vvDlR~~SpTfgk~~~~~Ls~~~~~~l~IP~G~aHGf~~L~d~~~i~Y~~~~~y~p~~e~~i~~~Dp~l~i~Wp~~~~~~  159 (198)
                      +||+|++|||||+|..++|+++++++||||+||||||++|+|+++++|++|.+|+|++|.+|+|+||+|+|+||++....
T Consensus       105 ~vD~R~~SpTfG~~~~~~l~~~~~~~l~IP~G~aHgf~~lsd~a~lly~~s~~ydp~~e~~i~~~Dp~l~i~Wp~~~~~~  184 (225)
T 1upi_A          105 VVDIREGSPTFGRWDSVLLDDQDRRTIYVSEGLAHGFLALQDNSTVMYLXSAEYNPQREHTIXATDPTLAVDWPLVDGAA  184 (225)
T ss_dssp             EECCCBTCTTTTCEEEEEEETTTCCEEEECTTCEEEEEECSSSEEEEEEESSCCCTTTEEECCTTCTTTCCCCCCSTTCC
T ss_pred             EEECCCCCCCCCCEEEEEEECCCCCEEEECCCCEEEEEEECCCCEEEEECCCCCCCCCCEEECCCCHHCCCCCCCCCCCC
T ss_conf             98403575538807899830366414896389679998606865678856875181347234489800097899989878


Q ss_pred             CEECHHHHCCCCHHHCCCCCEECC
Q ss_conf             301678845998778185512356
Q gi|254780919|r  160 PSVSEKDQNLPFLNQIDSPFEYDG  183 (198)
Q Consensus       160 piiS~kD~~~p~l~d~~~~f~~~~  183 (198)
                      |||||||+++|.|+|+.++|.+..
T Consensus       185 ~iiS~kD~~~p~l~~~~~~~~~p~  208 (225)
T 1upi_A          185 PSLSDRDAAAPSFEDVRASGLLPR  208 (225)
T ss_dssp             CBCCHHHHTCCCHHHHHHTTCSCB
T ss_pred             CEECHHHCCCCCHHHHHHCCCCCC
T ss_conf             687889929999899976699998



>1oi6_A (A:) PCZA361.16; epimerase, vancomycin group antibiotic, EVAD, isomerase; HET: TMP; 1.4A {Amycolatopsis orientalis} Back     alignment and structure
>2c0z_A (A:) NOVW; isomerase, epimerase, antibiotic biosynthesis, RMLC-like cupin; 1.60A {Streptomyces sphaeroides} Back     alignment and structure
>1ep0_A (A:) DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; racemase, DTDP-4-dehydrorhamnose epimerase, structural genomics, PSI; 1.50A {Methanothermobacterthermautotrophicus} Back     alignment and structure
>1dzr_A (A:) DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, 3, 5-hexulose epimerase; 2.17A {Salmonella typhimurium} Back     alignment and structure
>2ixk_A (A:) DTDP-4-dehydrorhamnose 3,5-epimerase; isomerase, lipopolysaccharide biosynthesis, epimerise, epimerize; HET: TDO; 1.7A {Pseudomonas aeruginosa} PDB: 2ixi_A* 2ixh_A* 1rtv_A* 2ixj_A* Back     alignment and structure
>1wlt_A (A:) 176AA long hypothetical DTDP-4-dehydrorhamnose 3, 5-epimerase; jelly roll-like topology, flattened barrel, isomerase; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1nxm_A (A:) DTDP-6-deoxy-D-XYLO-4-hexulose 3,5-epimerase; jelly roll-like structure, beta sheet, isomerase; 1.30A {Streptococcus suis} Back     alignment and structure
>3ejk_A (A:) DTDP sugar isomerase; YP_390184.1, structural genomics, joint center for structural genomics, JCSG; HET: CIT; 1.95A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>2pa7_A (A:) DTDP-6-deoxy-3,4-keto-hexulose isomerase; deoxysugar biosynthesis, S-layer biosynthesis, ketoisomerase; HET: TYD; 1.50A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>2zkl_A (A:249-369) Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, isomerase; 2.61A {Staphylococcus aureus} Back     alignment and structure
>1juh_A (A:24-221) Quercetin 2,3-dioxygenase; copper, cupin, glycoprotein, beta sandwich, oxidoreductase; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} Back     alignment and structure
>3c3v_A (A:344-510) Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>1fxz_A (A:310-476) Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} Back     alignment and structure
>2d5f_A (A:339-493) Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant protein; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Back     alignment and structure
>1fi2_A (A:) Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} Back     alignment and structure
>2o8q_A (A:) Hypothetical protein; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans LB400} Back     alignment and structure
>2e9q_A (A:294-459) 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>1j58_A (A:55-232) YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal binding protein; 1.75A {Bacillus subtilis} Back     alignment and structure
>2vqa_A (A:28-209) SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>2qnk_A (A:19-191) 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloenzyme, trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure
>1zvf_A (A:22-176) 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} Back     alignment and structure
>1yfu_A (A:) 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} Back     alignment and structure
>1uij_A (A:17-222) Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} Back     alignment and structure
>2oa2_A (A:) BH2720 protein; 10175341, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.41A {Bacillus halodurans} Back     alignment and structure
>1vj2_A (A:) Novel manganese-containing cupin TM1459; structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.65A {Thermotoga maritima} Back     alignment and structure
>2cav_A (A:55-254) Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, plant protein; 2.00A {Canavalia ensiformis} Back     alignment and structure
>1dgw_A (A:) Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices, merohedral/ hemihedral twinning; 1.70A {Canavalia ensiformis} Back     alignment and structure
>3bu7_A (A:83-255) Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} Back     alignment and structure
>2pyt_A (A:) Ethanolamine utilization protein EUTQ; 16421009, structural genomics, joint center for structural genomics, JCSG; 1.90A {Salmonella typhimurium LT2} Back     alignment and structure
>1j58_A (A:22-54,A:233-349) YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal binding protein; 1.75A {Bacillus subtilis} Back     alignment and structure
>1x82_A (A:) Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle, 5-phospho-D- arabinonate; HET: PA5; 1.50A {Pyrococcus furiosus} Back     alignment and structure
>1yhf_A (A:) Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 2.00A {Streptococcus pyogenes m1 gas} Back     alignment and structure
>3bal_A (A:) Acetylacetone-cleaving enzyme; jelly roll, tetramer, dioxygenase, iron, metal-binding, oxidoreductase; 1.95A {Acinetobacter johnsonii} Back     alignment and structure
>3h8u_A (A:) Uncharacterized conserved protein with double- stranded beta-helix domain; YP_001338853.1, structural genomics; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure