254780920

254780920

dTDP-glucose 4,6-dehydratase

GeneID in NCBI database:8209940Locus tag:CLIBASIA_04095
Protein GI in NCBI database:254780920Protein Accession:YP_003065333.1
Gene range:+(902150, 903226)Protein Length:358aa
Gene description:dTDP-glucose 4,6-dehydratase
COG prediction:[M] dTDP-D-glucose 4,6-dehydratase
KEGG prediction:rfbB; dTDP-glucose 4,6-dehydratase; K01710 dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
SEED prediction:dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)
Pathway involved in KEGG:Polyketide sugar unit biosynthesis [PATH:las00523]
Biosynthesis of vancomycin group antibiotics
Streptomycin biosynthesis [PATH:las00521]
Subsystem involved in SEED:dTDP-rhamnose synthesis;
Rhamnose containing glycans
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKWKNLNEMSCNRK
cEEEEEccccHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHHccccccEEEEcccccccHHHHHHHHHHHHccccccccccccccEEccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccc
cEEEEEccccHHHHHHHHHHHHHcccEEEEEEcccccccHHHHccccccccEEEEEcccccHHHHHHHHHHHcccEEEEccccccHHHHHHccHHHHHHHcHHHHHHHHHHHHHHHcccHHHHHHcEEEEEEEHHcccccccccEccccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEcEEEccccccccHHHHHHHHHHccccEEEEcccccEEEEEEHHHHHHHHHHHHHHcccccEEEEccccEEEHHHHHHHHHHHHHHHccccccHHHHEEEEccccccccEccEccHHHHHHHcccccccHHHHHHHHHHHHHHcHHHHHHHHcHcccccHHHHHHHHHccccccc
mrlivtggagFIGSALCRYLVNDLKIQVLVIDKLTyagnlnslkeisqsnlfsflqvdicDRECIRSALKEFQPDAIVNFAaeshvdrsilgadefitTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVygsldkglfsedmpynpsspysatkassDYLVLAWGhtygipvllsncsnnygpyhfpeklIPLAITRMIEGSHvflygdgqnvrdwLYVEDHVRALYLVLKKgrigeryniggnnerknIDIVFEIGFLLDalipksyshtELIRFiedrpghdrryaidsskikseigwfpqenmesglnKTVCWYLdnnwwwrplykelkpdndyskwknlnemscnrk
mrlivtggagfiGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVlkkgrigeryniggnnerknIDIVFEIGFLLDALIPKSYSHTELIrfiedrpghdrRYAIDsskikseigwfpqENMESGLNKTVCWYLDNNWWWRPLYkelkpdndyskwknlnemscnrk
MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKWKNLNEMSCNRK
MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKWKN**E******
MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKWKNLNEMSCNRK
MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKWKNLNEMSC***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
hhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKWKNLNEMSCNRK
MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKWKNLNEMSCNRK
MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDICDRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLLSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDNDYSKWKNLNEMSCNRK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target358 dTDP-glucose 4,6-dehydratase [Candidatus Liberibacter a
254780328333 UDP-glucose 4-epimerase [Candidatus Liberibacter a 3e-18
254780921290 dTDP-4-dehydrorhamnose reductase [Candidatus Liber 0.017
>gi|254780328|ref|YP_003064741.1| UDP-glucose 4-epimerase [Candidatus Liberibacter asiaticus str. psy62] Length = 333 Back     alignment
 Score = 84.0 bits (206), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 87/344 (25%), Positives = 155/344 (45%), Gaps = 48/344 (13%)

Query: 3   LIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFL-QVDICD 61
           ++V GGAG+IG+  CR L  +     +V+D L+ +G+       ++  L+  L QVDICD
Sbjct: 6   VLVVGGAGYIGAHTCRVLY-ERGFLPIVLDNLS-SGH-------AEFVLWGPLEQVDICD 56

Query: 62  RECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQD 121
              +R+   ++QP ++++FA  +++  S+     F   NI G+F L+          +  
Sbjct: 57  YTNLRAVFAKYQPASVMHFAGLTNISESVKNPSLFYEINIKGSFNLIA---------TAI 107

Query: 122 KKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVLL 181
           + +  RF+  ST   YG     + +E+ P    +PY  TK   +  +L      G+  ++
Sbjct: 108 ESNVRRFIFSSTCATYGIPHNTIITENDPQESITPYGYTKYVVERELLQHNKVNGLRSVV 167

Query: 182 --------SNCSNNYGPYHFPEK-LIPLAITRMIEGSHVF-LYG------DGQNVRDWLY 225
                   +   +  G +H PE  +IPLAI   +   + F ++G      DG  +RD+++
Sbjct: 168 LRYFNAAGATLDSIIGEWHNPETHVIPLAIKTAMGYQNSFKVFGQDYATRDGTCLRDYIH 227

Query: 226 VED----HVRALYLVLKKGRIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELI 281
           V D    H+ AL  ++ +G      N+G        +I+  I  + +   P +Y      
Sbjct: 228 VLDLANAHIMALEYLINQGD-SIAINLGTGTGITVKEIISTIQSMYECAFPITYES---- 282

Query: 282 RFIEDRPGHDRRYAIDSSKIKSEIGWFPQENMESGLNKTVCWYL 325
           R I D P        D+ K K  +GW P+  +   +     W+L
Sbjct: 283 RRIGDPPS----LVADNKKAKKILGWNPKYKLRDIIESAWNWHL 322

>gi|254780921|ref|YP_003065334.1| dTDP-4-dehydrorhamnose reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 290 Back     alignment
 Score = 32.0 bits (71), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 51/122 (41%), Gaps = 12/122 (9%)

Query: 57  VDICDRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEET-RLWW 115
           +D+   +   S    F PD I+N AA + VD++    +   + N  G   + +    +  
Sbjct: 34  IDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGI 93

Query: 116 SCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTY 175
            C+            ISTD V+  L +    E  P NP + Y  +K + +  V ++ + Y
Sbjct: 94  PCI-----------YISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNY 142

Query: 176 GI 177
            I
Sbjct: 143 VI 144

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target358 dTDP-glucose 4,6-dehydratase [Candidatus Liberibacter a
315122654348 dTDP-glucose 4,6-dehydratase [Candidatus Liberibacter s 1 1e-166
315499262352 dtdp-glucose 4,6-dehydratase [Asticcacaulis excentricus 1 1e-125
154247481355 dTDP-glucose 4,6-dehydratase [Xanthobacter autotrophicu 1 1e-124
159186243351 dTDP-D-glucose-4,6-dehydratase [Agrobacterium tumefacie 1 1e-122
332715609352 dTDP-D-glucose-4,6-dehydratase [Agrobacterium sp. H13-3 1 1e-121
11385992351 dTDP-glucose-4,6-dehydratase [Agrobacterium tumefaciens 1 1e-121
254500114350 dTDP-glucose 4,6-dehydratase [Labrenzia alexandrii DFL- 1 1e-121
222148115352 dTDP-D-glucose-46-dehydratase [Agrobacterium vitis S4] 1 1e-121
116251391351 dTDP-glucose 4,6-dehydratase [Rhizobium leguminosarum b 1 1e-120
222148465352 dTDP-glucose 4,6-dehydratase [Agrobacterium vitis S4] L 1 1e-120
>gi|315122654|ref|YP_004063143.1| dTDP-glucose 4,6-dehydratase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 348 Back     alignment and organism information
 Score =  590 bits (1520), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 283/342 (82%), Positives = 309/342 (90%)

Query: 1   MRLIVTGGAGFIGSALCRYLVNDLKIQVLVIDKLTYAGNLNSLKEISQSNLFSFLQVDIC 60
           MR+IVTGGAGFIGSALCRYL+NDLKIQVLVIDKLTYAGNL+SLK+ISQS+LFSFLQ DIC
Sbjct: 1   MRIIVTGGAGFIGSALCRYLINDLKIQVLVIDKLTYAGNLDSLKQISQSDLFSFLQADIC 60

Query: 61  DRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEETRLWWSCLSQ 120
           DRE IR ALKEFQPDAI+N AAESHVDRSI+G+DEFI TNI+GTF+LLEETRLWWSCL  
Sbjct: 61  DRESIRLALKEFQPDAIMNLAAESHVDRSIMGSDEFIATNIMGTFVLLEETRLWWSCLPG 120

Query: 121 DKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTYGIPVL 180
            KKD FRFLQ+STDEVYGSLD+GLFSED PY PSSPYSATKASSDYL LAW  TYGIP+L
Sbjct: 121 YKKDHFRFLQVSTDEVYGSLDEGLFSEDNPYCPSSPYSATKASSDYLALAWQCTYGIPIL 180

Query: 181 LSNCSNNYGPYHFPEKLIPLAITRMIEGSHVFLYGDGQNVRDWLYVEDHVRALYLVLKKG 240
           LSNCSNNYGPY FPEKLIPLAITRMI+GSHVFLYGDG+NVRDWLYVEDHVRALYLVL KG
Sbjct: 181 LSNCSNNYGPYQFPEKLIPLAITRMIKGSHVFLYGDGKNVRDWLYVEDHVRALYLVLTKG 240

Query: 241 RIGERYNIGGNNERKNIDIVFEIGFLLDALIPKSYSHTELIRFIEDRPGHDRRYAIDSSK 300
           RIGERYNIGGNNER+NIDIVF+I  LLD L PK Y H++L+ F +DR GHDRRYAID SK
Sbjct: 241 RIGERYNIGGNNERENIDIVFQICHLLDVLHPKPYPHSDLVLFTKDRLGHDRRYAIDFSK 300

Query: 301 IKSEIGWFPQENMESGLNKTVCWYLDNNWWWRPLYKELKPDN 342
           IK E+GW+PQEN +SGL+KTV WYLDN+WWW PLYKEL   N
Sbjct: 301 IKKELGWYPQENKDSGLDKTVHWYLDNSWWWHPLYKELNLSN 342


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315499262|ref|YP_004088066.1| dtdp-glucose 4,6-dehydratase [Asticcacaulis excentricus CB 48] Length = 352 Back     alignment and organism information
>gi|154247481|ref|YP_001418439.1| dTDP-glucose 4,6-dehydratase [Xanthobacter autotrophicus Py2] Length = 355 Back     alignment and organism information
>gi|159186243|ref|NP_356045.2| dTDP-D-glucose-4,6-dehydratase [Agrobacterium tumefaciens str. C58] Length = 351 Back     alignment and organism information
>gi|332715609|ref|YP_004443075.1| dTDP-D-glucose-4,6-dehydratase [Agrobacterium sp. H13-3] Length = 352 Back     alignment and organism information
>gi|11385992|gb|AAG35060.1|AF314183_2 dTDP-glucose-4,6-dehydratase [Agrobacterium tumefaciens] Length = 351 Back     alignment and organism information
>gi|254500114|ref|ZP_05112266.1| dTDP-glucose 4,6-dehydratase [Labrenzia alexandrii DFL-11] Length = 350 Back     alignment and organism information
>gi|222148115|ref|YP_002549072.1| dTDP-D-glucose-46-dehydratase [Agrobacterium vitis S4] Length = 352 Back     alignment and organism information
>gi|116251391|ref|YP_767229.1| dTDP-glucose 4,6-dehydratase [Rhizobium leguminosarum bv. viciae 3841] Length = 351 Back     alignment and organism information
>gi|222148465|ref|YP_002549422.1| dTDP-glucose 4,6-dehydratase [Agrobacterium vitis S4] Length = 352 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target358 dTDP-glucose 4,6-dehydratase [Candidatus Liberibacter a
TIGR01181317 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehydratas 1e-135
PRK10084352 PRK10084, PRK10084, dTDP-glucose 4,6 dehydratase; Provi 1e-134
PRK10217355 PRK10217, PRK10217, dTDP-glucose 4,6-dehydratase; Provi 1e-127
KOG0747331 KOG0747, KOG0747, KOG0747, Putative NAD+-dependent epim 1e-69
PLN02260 668 PLN02260, PLN02260, probable rhamnose biosynthetic enzy 2e-68
COG0451314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases 5e-39
COG1087329 COG1087, GalE, UDP-glucose 4-epimerase [Cell envelope b 3e-35
TIGR01179328 TIGR01179, galE, UDP-glucose-4-epimerase 2e-29
KOG1371343 KOG1371, KOG1371, KOG1371, UDP-glucose 4-epimerase/UDP- 7e-29
COG1089345 COG1089, Gmd, GDP-D-mannose dehydratase [Cell envelope 3e-25
KOG1429350 KOG1429, KOG1429, KOG1429, dTDP-glucose 4-6-dehydratase 2e-21
PLN02240352 PLN02240, PLN02240, UDP-glucose 4-epimerase 6e-16
KOG1430361 KOG1430, KOG1430, KOG1430, C-3 sterol dehydrogenase/3-b 8e-16
COG1091281 COG1091, RfbD, dTDP-4-dehydrorhamnose reductase [Cell e 4e-15
PLN02166436 PLN02166, PLN02166, dTDP-glucose 4,6-dehydratase 6e-14
TIGR02197314 TIGR02197, heptose_epim, ADP-L-glycero-D-manno-heptose- 1e-13
PLN02206442 PLN02206, PLN02206, UDP-glucuronate decarboxylase 7e-12
PRK15181348 PRK15181, PRK15181, Vi polysaccharide biosynthesis prot 8e-12
PRK10675338 PRK10675, PRK10675, UDP-galactose-4-epimerase; Provisio 4e-11
TIGR02622349 TIGR02622, CDP_4_6_dhtase, CDP-glucose 4,6-dehydratase 1e-09
KOG1431315 KOG1431, KOG1431, KOG1431, GDP-L-fucose synthetase [Car 3e-08
PLN02695370 PLN02695, PLN02695, GDP-D-mannose-3',5'-epimerase 6e-07
KOG1502327 KOG1502, KOG1502, KOG1502, Flavonol reductase/cinnamoyl 5e-05
COG1088340 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell env 1e-140
pfam01370235 pfam01370, Epimerase, NAD dependent epimerase/dehydrata 7e-63
pfam01073280 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid dehydrogena 9e-15
COG1086588 COG1086, COG1086, Predicted nucleoside-diphosphate suga 4e-13
TIGR03466328 TIGR03466, HpnA, hopanoid-associated sugar epimerase 7e-10
PLN02427386 PLN02427, PLN02427, UDP-apiose/xylose synthase 2e-04
COG1090297 COG1090, COG1090, Predicted nucleoside-diphosphate suga 0.003
TIGR01472343 TIGR01472, gmd, GDP-mannose 4,6-dehydratase 4e-18
KOG1372376 KOG1372, KOG1372, KOG1372, GDP-mannose 4,6 dehydratase 4e-16
PLN02653340 PLN02653, PLN02653, GDP-mannose 4,6-dehydratase 7e-17
pfam02719280 pfam02719, Polysacc_synt_2, Polysaccharide biosynthesis 3e-12
pfam04321284 pfam04321, RmlD_sub_bind, RmlD substrate binding domain 9e-10
TIGR01214287 TIGR01214, rmlD, dTDP-4-dehydrorhamnose reductase 4e-09
pfam07993245 pfam07993, NAD_binding_4, Male sterility protein 1e-05
TIGR03589324 TIGR03589, PseB, UDP-N-acetylglucosamine 4,6-dehydratas 2e-05
COG1028251 COG1028, FabG, Dehydrogenases with different specificit 3e-05
PLN02572442 PLN02572, PLN02572, UDP-sulfoquinovose synthase 3e-06
COG1748389 COG1748, LYS9, Saccharopine dehydrogenase and related p 9e-06
PRK09186256 PRK09186, PRK09186, flagellin modification protein A; P 4e-05
PRK07074257 PRK07074, PRK07074, short chain dehydrogenase; Provisio 0.001
PRK12827249 PRK12827, PRK12827, short chain dehydrogenase; Provisio 0.001
pfam00106167 pfam00106, adh_short, short chain dehydrogenase 0.004
TIGR02415254 TIGR02415, 23BDH, acetoin reductases 0.004
PLN02725306 PLN02725, PLN02725, GDP-4-keto-6-deoxymannose-3,5-epime 3e-05
PRK11908347 PRK11908, PRK11908, NAD-dependent epimerase/dehydratase 4e-04
COG0702275 COG0702, COG0702, Predicted nucleoside-diphosphate-suga 0.004
>gnl|CDD|130249 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|182230 PRK10084, PRK10084, dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|182313 PRK10217, PRK10217, dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|35966 KOG0747, KOG0747, KOG0747, Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|177902 PLN02260, PLN02260, probable rhamnose biosynthetic enzyme Back     alignment and domain information
>gnl|CDD|30800 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|31284 COG1087, GalE, UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|130247 TIGR01179, galE, UDP-glucose-4-epimerase Back     alignment and domain information
>gnl|CDD|36585 KOG1371, KOG1371, KOG1371, UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>gnl|CDD|31286 COG1089, Gmd, GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|36642 KOG1429, KOG1429, KOG1429, dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>gnl|CDD|177883 PLN02240, PLN02240, UDP-glucose 4-epimerase Back     alignment and domain information
>gnl|CDD|36643 KOG1430, KOG1430, KOG1430, C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism, Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|31288 COG1091, RfbD, dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|165812 PLN02166, PLN02166, dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|162758 TIGR02197, heptose_epim, ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>gnl|CDD|177856 PLN02206, PLN02206, UDP-glucuronate decarboxylase Back     alignment and domain information
>gnl|CDD|185103 PRK15181, PRK15181, Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>gnl|CDD|182639 PRK10675, PRK10675, UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>gnl|CDD|162953 TIGR02622, CDP_4_6_dhtase, CDP-glucose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|36644 KOG1431, KOG1431, KOG1431, GDP-L-fucose synthetase [Carbohydrate transport and metabolism, Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|178298 PLN02695, PLN02695, GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>gnl|CDD|36715 KOG1502, KOG1502, KOG1502, Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|31285 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|144821 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information
>gnl|CDD|144605 pfam01073, 3Beta_HSD, 3-beta hydroxysteroid dehydrogenase/isomerase family Back     alignment and domain information
>gnl|CDD|31283 COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|163279 TIGR03466, HpnA, hopanoid-associated sugar epimerase Back     alignment and domain information
>gnl|CDD|178047 PLN02427, PLN02427, UDP-apiose/xylose synthase Back     alignment and domain information
>gnl|CDD|31287 COG1090, COG1090, Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>gnl|CDD|162378 TIGR01472, gmd, GDP-mannose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|36586 KOG1372, KOG1372, KOG1372, GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|178259 PLN02653, PLN02653, GDP-mannose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|145720 pfam02719, Polysacc_synt_2, Polysaccharide biosynthesis protein Back     alignment and domain information
>gnl|CDD|113104 pfam04321, RmlD_sub_bind, RmlD substrate binding domain Back     alignment and domain information
>gnl|CDD|162255 TIGR01214, rmlD, dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>gnl|CDD|149205 pfam07993, NAD_binding_4, Male sterility protein Back     alignment and domain information
>gnl|CDD|132628 TIGR03589, PseB, UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|31231 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|178184 PLN02572, PLN02572, UDP-sulfoquinovose synthase Back     alignment and domain information
>gnl|CDD|31934 COG1748, LYS9, Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|169699 PRK09186, PRK09186, flagellin modification protein A; Provisional Back     alignment and domain information
>gnl|CDD|180823 PRK07074, PRK07074, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183776 PRK12827, PRK12827, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143883 pfam00106, adh_short, short chain dehydrogenase Back     alignment and domain information
>gnl|CDD|131468 TIGR02415, 23BDH, acetoin reductases Back     alignment and domain information
>gnl|CDD|178326 PLN02725, PLN02725, GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>gnl|CDD|183375 PRK11908, PRK11908, NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>gnl|CDD|31046 COG0702, COG0702, Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 358 dTDP-glucose 4,6-dehydratase [Candidatus Liberibacter a
TIGR01181340 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase; InterPro: 100.0
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 100.0
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biog 100.0
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 100.0
TIGR01179341 galE UDP-glucose 4-epimerase; InterPro: IPR005886 Synon 100.0
PRK11908347 NAD-dependent epimerase/dehydratase family protein; Pro 100.0
PRK10675338 UDP-galactose-4-epimerase; Provisional 100.0
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, 100.0
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisio 100.0
KOG0747331 consensus 100.0
TIGR02622361 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase; InterPro: I 100.0
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequences 100.0
KOG1429350 consensus 100.0
KOG1371343 consensus 100.0
pfam04321284 RmlD_sub_bind RmlD substrate binding domain. L-rhamnose 100.0
TIGR01472365 gmd GDP-mannose 4,6-dehydratase; InterPro: IPR006368 Th 100.0
TIGR02197353 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase; 100.0
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-am 100.0
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis 100.0
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell enve 100.0
KOG1431315 consensus 100.0
KOG1372376 consensus 100.0
TIGR01214317 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005 100.0
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 100.0
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope bi 100.0
KOG1430361 consensus 100.0
KOG1502327 consensus 100.0
TIGR01777307 yfcH conserved hypothetical protein TIGR01777; InterPro 100.0
CHL00194319 ycf39 Ycf39; Provisional 99.97
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [Gener 99.95
KOG2774366 consensus 99.93
PRK05865 854 hypothetical protein; Provisional 99.78
PRK12320 699 hypothetical protein; Provisional 99.73
KOG2865391 consensus 99.7
KOG3019315 consensus 99.19
pfam02719280 Polysacc_synt_2 Polysaccharide biosynthesis protein. Th 100.0
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This enzy 100.0
pfam01073280 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase 100.0
COG1086588 Predicted nucleoside-diphosphate sugar epimerases [Cell 100.0
PRK07201 663 short chain dehydrogenase; Provisional 99.96
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase 99.94
TIGR01746405 Thioester-redct thioester reductase domain; InterPro: I 99.93
pfam05368232 NmrA NmrA-like family. NmrA is a negative transcription 99.93
KOG1221467 consensus 99.82
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G 99.67
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases [Cell 99.61
TIGR01850361 argC N-acetyl-gamma-glutamyl-phosphate reductase; Inter 97.01
pfam01370235 Epimerase NAD dependent epimerase/dehydratase family. T 100.0
pfam07993245 NAD_binding_4 Male sterility protein. This family repre 99.97
COG3320382 Putative dehydrogenase domain of multifunctional non-ri 99.92
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 99.68
PRK12825250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.67
PRK12826253 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed 99.61
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 99.61
PRK10538248 3-hydroxy acid dehydrogenase; Provisional 99.61
PRK07578199 short chain dehydrogenase; Provisional 99.6
PRK08267258 short chain dehydrogenase; Provisional 99.6
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.6
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.59
PRK08220253 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.58
PRK07479252 consensus 99.58
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.58
PRK07856254 short chain dehydrogenase; Provisional 99.57
PRK07231250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.57
PRK07454241 short chain dehydrogenase; Provisional 99.57
PRK07774250 short chain dehydrogenase; Provisional 99.55
PRK09730247 hypothetical protein; Provisional 99.55
PRK09009235 C factor cell-cell signaling protein; Provisional 99.55
PRK05875277 short chain dehydrogenase; Provisional 99.54
PRK08340259 glucose-1-dehydrogenase; Provisional 99.54
PRK09135249 pteridine reductase; Provisional 99.54
PRK08339263 short chain dehydrogenase; Provisional 99.54
PRK12939250 short chain dehydrogenase; Provisional 99.54
PRK09242258 tropinone reductase; Provisional 99.53
PRK08219226 short chain dehydrogenase; Provisional 99.53
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.53
PRK07024256 short chain dehydrogenase; Provisional 99.53
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisional 99.53
PRK07102243 short chain dehydrogenase; Provisional 99.53
PRK06181263 short chain dehydrogenase; Provisional 99.53
PRK07035252 short chain dehydrogenase; Provisional 99.52
PRK07060245 short chain dehydrogenase; Provisional 99.52
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.52
PRK07677254 short chain dehydrogenase; Provisional 99.52
PRK08277278 D-mannonate oxidoreductase; Provisional 99.52
PRK07890258 short chain dehydrogenase; Provisional 99.51
PRK07831261 short chain dehydrogenase; Provisional 99.51
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.51
PRK12827251 short chain dehydrogenase; Provisional 99.51
PRK06101241 short chain dehydrogenase; Provisional 99.51
PRK07707239 consensus 99.51
PRK06124259 gluconate 5-dehydrogenase; Provisional 99.51
PRK07326235 short chain dehydrogenase; Provisional 99.51
PRK05872296 short chain dehydrogenase; Provisional 99.51
PRK06483236 short chain dehydrogenase; Provisional 99.5
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogena 99.5
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.5
PRK05650270 short chain dehydrogenase; Provisional 99.5
PRK08017256 short chain dehydrogenase; Provisional 99.5
PRK07069251 short chain dehydrogenase; Validated 99.5
PRK07985294 oxidoreductase; Provisional 99.49
PRK09186255 flagellin modification protein A; Provisional 99.49
PRK07577234 short chain dehydrogenase; Provisional 99.49
PRK06550237 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.49
PRK07067256 sorbitol dehydrogenase; Provisional 99.49
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.49
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.49
PRK06841255 short chain dehydrogenase; Provisional 99.48
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate deh 99.48
PRK06947252 glucose-1-dehydrogenase; Provisional 99.48
PRK08251248 short chain dehydrogenase; Provisional 99.48
PRK07041240 short chain dehydrogenase; Provisional 99.48
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Revie 99.47
PRK06172253 short chain dehydrogenase; Provisional 99.47
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.47
PRK08324676 short chain dehydrogenase; Validated 99.46
PRK12828239 short chain dehydrogenase; Provisional 99.46
PRK06227256 consensus 99.46
PRK07478254 short chain dehydrogenase; Provisional 99.46
PRK12937245 short chain dehydrogenase; Provisional 99.46
PRK06398256 aldose dehydrogenase; Validated 99.46
PRK09134256 short chain dehydrogenase; Provisional 99.46
PRK07576260 short chain dehydrogenase; Provisional 99.46
PRK07775275 short chain dehydrogenase; Provisional 99.46
PRK12745259 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 99.45
PRK06138252 short chain dehydrogenase; Provisional 99.45
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.45
PRK06924251 short chain dehydrogenase; Provisional 99.45
PRK07814263 short chain dehydrogenase; Provisional 99.45
PRK07776252 consensus 99.45
PRK07074256 short chain dehydrogenase; Provisional 99.45
PRK06123249 short chain dehydrogenase; Provisional 99.45
PRK07523251 gluconate 5-dehydrogenase; Provisional 99.45
PRK05717255 oxidoreductase; Validated 99.44
PRK08642254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.44
PRK07666238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.44
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.44
PRK06057255 short chain dehydrogenase; Provisional 99.44
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.44
PRK12743253 acetoin dehydrogenase; Provisional 99.43
PRK09072262 short chain dehydrogenase; Provisional 99.43
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase 99.43
PRK08265261 short chain dehydrogenase; Provisional 99.43
PRK06114262 short chain dehydrogenase; Provisional 99.43
PRK06701289 short chain dehydrogenase; Provisional 99.43
PRK08936261 glucose-1-dehydrogenase; Provisional 99.42
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.42
PRK06346251 consensus 99.42
PRK12829264 short chain dehydrogenase; Provisional 99.42
PRK07201663 short chain dehydrogenase; Provisional 99.41
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.41
PRK06949258 short chain dehydrogenase; Provisional 99.41
PRK07062265 short chain dehydrogenase; Provisional 99.41
PRK06125259 short chain dehydrogenase; Provisional 99.41
PRK06198268 short chain dehydrogenase; Provisional 99.41
PRK06463254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.4
PRK06128300 oxidoreductase; Provisional 99.4
PRK05866290 short chain dehydrogenase; Provisional 99.4
TIGR01830238 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reducta 99.4
PRK08643256 acetoin reductase; Validated 99.4
PRK06500249 short chain dehydrogenase; Provisional 99.4
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenas 99.39
PRK07832272 short chain dehydrogenase; Provisional 99.39
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.38
PRK08226263 short chain dehydrogenase; Provisional 99.38
PRK05867253 short chain dehydrogenase; Provisional 99.38
PRK12744257 short chain dehydrogenase; Provisional 99.37
PRK08628258 short chain dehydrogenase; Provisional 99.37
PRK05599246 hypothetical protein; Provisional 99.37
PRK12748257 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 99.36
PRK07063259 short chain dehydrogenase; Provisional 99.36
PRK12746254 short chain dehydrogenase; Provisional 99.36
PRK07806248 short chain dehydrogenase; Provisional 99.36
PRK06523260 short chain dehydrogenase; Provisional 99.36
PRK07825273 short chain dehydrogenase; Provisional 99.35
PRK06139324 short chain dehydrogenase; Provisional 99.35
PRK08945245 short chain dehydrogenase; Provisional 99.35
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.34
PRK12747252 short chain dehydrogenase; Provisional 99.34
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.34
PRK06484 530 short chain dehydrogenase; Validated 99.33
PRK07370259 enoyl-(acyl carrier protein) reductase; Validated 99.33
PRK06077249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.33
PRK12859257 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 99.32
PRK08594256 enoyl-(acyl carrier protein) reductase; Provisional 99.32
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisional 99.32
PRK08589272 short chain dehydrogenase; Validated 99.31
PRK12742237 oxidoreductase; Provisional 99.31
PRK06484530 short chain dehydrogenase; Validated 99.3
PRK07109338 short chain dehydrogenase; Provisional 99.29
PRK07904253 short chain dehydrogenase; Provisional 99.29
PRK07792303 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.26
PRK08278273 short chain dehydrogenase; Provisional 99.26
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisional 99.24
PRK08703239 short chain dehydrogenase; Provisional 99.23
COG0300265 DltE Short-chain dehydrogenases of various substrate sp 99.21
PRK07791285 short chain dehydrogenase; Provisional 99.21
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisional 99.2
PRK07533254 enoyl-(acyl carrier protein) reductase; Provisional 99.2
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisional 99.18
PRK05884223 short chain dehydrogenase; Provisional 99.17
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisional 99.16
TIGR01829244 AcAcCoA_reduct acetoacetyl-CoA reductase; InterPro: IPR 99.16
PRK05855582 short chain dehydrogenase; Validated 99.16
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisional 99.16
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisional 99.14
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisional 99.13
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisional 99.12
COG2910211 Putative NADH-flavin reductase [General function predic 99.12
COG4221246 Short-chain alcohol dehydrogenase of unknown specificit 99.11
PRK12428261 3-alpha-hydroxysteroid dehydrogenase; Provisional 99.08
PRK08261447 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.08
PRK06940277 short chain dehydrogenase; Provisional 99.05
KOG1210331 consensus 98.95
KOG4169261 consensus 98.91
KOG4288283 consensus 98.84
TIGR01963258 PHB_DH 3-hydroxybutyrate dehydrogenase; InterPro: IPR01 98.8
KOG1201300 consensus 98.79
TIGR02632709 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol 98.78
KOG1200256 consensus 98.45
PRK06300298 enoyl-(acyl carrier protein) reductase; Provisional 98.29
KOG1207245 consensus 98.17
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 92.22
PRK06482276 short chain dehydrogenase; Provisional 99.55
PRK06182273 short chain dehydrogenase; Validated 99.54
PRK06180277 short chain dehydrogenase; Provisional 99.52
PRK05693274 short chain dehydrogenase; Provisional 99.52
PRK08263275 short chain dehydrogenase; Provisional 99.51
PRK06179270 short chain dehydrogenase; Provisional 99.51
pfam08659181 KR KR domain. This enzymatic domain is part of bacteria 99.49
PRK05993277 short chain dehydrogenase; Provisional 99.49
smart00822180 PKS_KR This enzymatic domain is part of bacterial polyk 99.46
PRK06953222 short chain dehydrogenase; Provisional 99.45
PRK09291257 short chain dehydrogenase; Provisional 99.44
PRK08264235 short chain dehydrogenase; Validated 99.43
PRK07023243 short chain dehydrogenase; Provisional 99.43
pfam00106167 adh_short short chain dehydrogenase. This family contai 99.38
PRK08177225 short chain dehydrogenase; Provisional 99.37
PRK06914280 short chain dehydrogenase; Provisional 99.37
PRK06194301 hypothetical protein; Provisional 99.33
PRK06196316 oxidoreductase; Provisional 99.32
PRK05876275 short chain dehydrogenase; Provisional 99.29
PRK05854314 short chain dehydrogenase; Provisional 99.27
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.21
KOG1205282 consensus 99.16
PRK06197306 short chain dehydrogenase; Provisional 99.16
COG1028251 FabG Dehydrogenases with different specificities (relat 99.14
KOG1203411 consensus 99.07
KOG1208314 consensus 99.02
PRK08303305 short chain dehydrogenase; Provisional 98.94
PRK08862227 short chain dehydrogenase; Provisional 98.94
KOG0725270 consensus 98.93
KOG1209289 consensus 98.85
KOG1611249 consensus 98.8
COG3967245 DltE Short-chain dehydrogenase involved in D-alanine es 98.69
TIGR02415258 23BDH acetoin reductases; InterPro: IPR014007 One membe 98.55
PRK12367250 short chain dehydrogenase; Provisional 98.55
KOG1610322 consensus 98.54
PRK07424410 bifunctional sterol desaturase/short chain dehydrogenas 98.4
KOG4039238 consensus 98.26
KOG1014312 consensus 98.18
KOG1478341 consensus 98.17
pfam08643296 DUF1776 Fungal family of unknown function (DUF1776). Th 98.16
KOG1199260 consensus 98.12
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochond 97.87
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehydroge 97.77
PRK05442325 malate dehydrogenase; Provisional 97.51
PRK05086312 malate dehydrogenase; Provisional 97.45
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like structu 97.36
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Mal 97.3
KOG1204253 consensus 97.2
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate 97.17
COG4982866 3-oxoacyl-[acyl-carrier protein] 96.94
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, pu 96.94
COG0039313 Mdh Malate/lactate dehydrogenases [Energy production an 96.84
TIGR01832249 kduD 2-deoxy-D-gluconate 3-dehydrogenase; InterPro: IPR 96.72
PTZ00325313 malate dehydrogenase; Provisional 96.65
PRK06223312 malate dehydrogenase; Reviewed 96.57
TIGR01289321 LPOR light-dependent protochlorophyllide reductase; Int 96.56
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 96.26
KOG1202 2376 consensus 96.19
PTZ00117313 malate dehydrogenase; Provisional 95.92
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases and s 95.83
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-lactate 95.75
cd00300300 LDH_like L-lactate dehydrogenase-like enzymes. Members 95.26
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-li 95.04
TIGR02813 2773 omega_3_PfaA polyketide-type polyunsaturated fatty acid 95.01
PTZ00082322 L-lactate dehydrogenase; Provisional 94.78
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 94.78
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate dehydr 93.85
TIGR01500267 sepiapter_red sepiapterin reductase; InterPro: IPR00639 92.5
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 91.68
KOG1494345 consensus 90.84
PRK06720169 hypothetical protein; Provisional 98.69
TIGR01759329 MalateDH-SF1 malate dehydrogenase; InterPro: IPR010945 96.44
pfam02571246 CbiJ Precorrin-6x reductase CbiJ/CobK. This family cons 96.35
PRK08057241 cobalt-precorrin-6x reductase; Reviewed 94.09
pfam03668284 ATP_bind_2 P-loop ATPase protein family. This family co 92.18
PRK05416292 hypothetical protein; Provisional 91.77
TIGR00715260 precor6x_red precorrin-6x reductase; InterPro: IPR00372 90.29
COG1748389 LYS9 Saccharopine dehydrogenase and related proteins [A 98.56
pfam03435384 Saccharop_dh Saccharopine dehydrogenase. This family co 98.28
PRK09496 455 trkA potassium transporter peripheral membrane componen 98.25
PRK08309182 short chain dehydrogenase; Provisional 97.43
PRK12767325 carbamoyl phosphate synthase-like protein; Provisional 97.21
PRK06732228 phosphopantothenate--cysteine ligase; Validated 97.2
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2; Val 97.07
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 97.06
PRK00048265 dihydrodipicolinate reductase; Provisional 96.74
COG0027394 PurT Formate-dependent phosphoribosylglycinamide formyl 96.66
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene tetr 96.46
TIGR02114253 coaB_strep phosphopantothenate--cysteine ligase; InterP 96.35
PRK12446352 N-acetylglucosaminyl transferase; Reviewed 96.3
KOG2733423 consensus 96.16
KOG4022236 consensus 96.15
PRK05447379 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provis 96.04
TIGR00036281 dapB dihydrodipicolinate reductase; InterPro: IPR011770 96.04
PRK09620229 hypothetical protein; Provisional 95.89
TIGR02356210 adenyl_thiF thiazole biosynthesis adenylyltransferase T 95.88
PRK00726359 murG N-acetylglucosaminyl transferase; Provisional 95.86
pfam02254115 TrkA_N TrkA-N domain. This domain is found in a wide va 95.86
KOG2013 603 consensus 95.74
pfam04127197 DFP DNA / pantothenate metabolism flavoprotein. The DNA 95.65
PRK05784 485 phosphoribosylamine--glycine ligase; Provisional 95.55
PRK06019377 phosphoribosylaminoimidazole carboxylase ATPase subunit 95.43
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketide syn 95.35
PRK06849387 hypothetical protein; Provisional 95.27
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-am 95.15
COG0604326 Qor NADPH:quinone reductase and related Zn-dependent ox 95.08
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid transpor 94.98
KOG0172445 consensus 94.74
PRK09496455 trkA potassium transporter peripheral membrane componen 94.72
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 94.56
pfam01488134 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This 94.44
PRK06988313 putative formyltransferase; Provisional 94.44
PRK00885424 phosphoribosylamine--glycine ligase; Provisional 94.37
TIGR02817338 adh_fam_1 zinc-binding alcohol dehydrogenase family pro 94.3
COG1660286 Predicted P-loop-containing kinase [General function pr 94.09
cd04962371 GT1_like_5 This family is most closely related to the G 93.9
PRK06395435 phosphoribosylamine--glycine ligase; Provisional 93.41
PRK13304265 L-aspartate dehydrogenase; Reviewed 93.4
PRK13303265 L-aspartate dehydrogenase; Provisional 93.31
pfam01408120 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossman 93.29
PRK13789426 phosphoribosylamine--glycine ligase; Provisional 93.18
pfam01470203 Peptidase_C15 Pyroglutamyl peptidase. 93.02
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 92.54
PRK13194204 pyrrolidone-carboxylate peptidase; Provisional 92.52
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-li 92.23
PRK13886241 conjugal transfer protein TraL; Provisional 92.21
PRK13302271 putative L-aspartate dehydrogenase; Provisional 91.69
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal structu 91.56
PRK13193201 pyrrolidone-carboxylate peptidase; Provisional 91.53
pfam03054354 tRNA_Me_trans tRNA methyl transferase. This family repr 91.02
PRK13301267 putative L-aspartate dehydrogenase; Provisional 90.37
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MDH) is 97.79
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-lactate 97.12
cd04510334 consensus 95.3
cd05295452 MDH_like Malate dehydrogenase-like. These MDH-like prot 94.26
PRK00436345 argC N-acetyl-gamma-glutamyl-phosphate reductase; Valid 97.01
PRK08655441 prephenate dehydrogenase; Provisional 96.96
pfam01113122 DapB_N Dihydrodipicolinate reductase, N-terminus. Dihyd 96.83
PRK05690245 molybdopterin biosynthesis protein MoeB; Provisional 96.23
PRK08664350 aspartate-semialdehyde dehydrogenase; Reviewed 96.13
TIGR02823330 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP f 96.09
PRK11199374 tyrA bifunctional chorismate mutase/prephenate dehydrog 96.01
PRK05579392 bifunctional phosphopantothenoylcysteine decarboxylase/ 95.99
pfam00899134 ThiF ThiF family. This family contains a repeated domai 95.89
PRK07417280 arogenate dehydrogenase; Reviewed 95.75
PRK00711416 D-amino acid dehydrogenase small subunit; Validated 95.67
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 95.65
PRK11863314 N-acetyl-gamma-glutamyl-phosphate reductase; Provisiona 95.61
pfam01118121 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding 95.59
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provisional 95.57
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 95.38
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino 95.31
KOG1198347 consensus 95.27
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding 95.17
PRK06598348 aspartate-semialdehyde dehydrogenase; Reviewed 95.08
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 94.95
PRK08644209 thiamine biosynthesis protein ThiF; Provisional 94.7
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 94.67
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily of act 94.63
cd01488291 Uba3_RUB Ubiquitin activating enzyme (E1) subunit UBA3. 94.28
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 94.2
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like 94.2
TIGR00978358 asd_EA aspartate-semialdehyde dehydrogenase; InterPro: 93.96
PRK08328230 hypothetical protein; Provisional 93.65
pfam01210159 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd 93.46
PRK08507275 prephenate dehydrogenase; Validated 93.4
PRK12409410 D-amino acid dehydrogenase small subunit; Provisional 93.35
pfam02670129 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoi 93.22
PRK06444197 prephenate dehydrogenase; Provisional 92.88
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like prot 92.81
cd01491286 Ube1_repeat1 Ubiquitin activating enzyme (E1), repeat 1 92.76
KOG1496332 consensus 92.72
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino acid tr 92.65
cd01483143 E1_enzyme_family Superfamily of activating enzymes (E1) 92.51
PRK12475337 thiamine/molybdopterin biosynthesis MoeB-like protein; 92.34
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelop 92.33
PRK07588391 hypothetical protein; Provisional 92.1
PRK07261171 topology modulation protein; Provisional 92.01
PRK08229341 2-dehydropantoate 2-reductase; Provisional 91.99
PRK08762379 molybdopterin biosynthesis protein MoeB; Validated 91.99
cd03802335 GT1_AviGT4_like This family is most closely related to 91.97
PRK06522307 2-dehydropantoate 2-reductase; Reviewed 91.68
PRK13982476 bifunctional SbtC-like/phosphopantothenoylcysteine deca 91.48
PRK06753373 hypothetical protein; Provisional 91.17
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 90.98
PRK11259377 solA N-methyltryptophan oxidase; Provisional 90.93
PRK07411390 hypothetical protein; Validated 90.91
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisio 90.91
TIGR01758325 MDH_euk_cyt malate dehydrogenase, NAD-dependent; InterP 90.74
COG2085211 Predicted dinucleotide-binding enzymes [General functio 90.49
PRK05708305 2-dehydropantoate 2-reductase; Provisional 90.43
pfam00056142 Ldh_1_N lactate/malate dehydrogenase, NAD binding domai 96.84
COG3268382 Uncharacterized conserved protein [Function unknown] 95.96
KOG0023360 consensus 94.87
PRK13771332 putative alcohol dehydrogenase; Provisional 93.53
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 91.93
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General funct 90.95
COG2130340 Putative NADP-dependent oxidoreductases [General functi 90.52
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 91.12
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 90.58
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase; InterPro: IPR005888 The conversion of dTDP-glucose into dTDP-4-keto-6-deoxyglucose by Escherichia coli dTDP-glucose 4,6-dehydratase) takes place in the active site in three steps: dehydrogenation to dTDP-4-ketoglucose, dehydration to dTDP-4-ketoglucose-5,6-ene, and rereduction of C6 to the methyl group Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose 4-epimerase; InterPro: IPR005886 Synonym: UDP-galactose 4-epimerase UDP-glucose 4-epimerase (5 Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>KOG0747 consensus Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase; InterPro: IPR013445 This entry contains CDP-glucose 4,6-dehydratases from a variety of Gram-negative and Gram-positive bacteria Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>KOG1429 consensus Back     alignment and domain information
>KOG1371 consensus Back     alignment and domain information
>pfam04321 RmlD_sub_bind RmlD substrate binding domain Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase; InterPro: IPR006368 This family represent GDP-mannose 4,6-dehydratase, also known as GDP-D-mannose dehydratase Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase; InterPro: IPR011912 Lipopolysaccharides (LPS) are glycolipids that consitutes the outer monolayer of the outer membranes of most Gram-negative bacteria Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1431 consensus Back     alignment and domain information
>KOG1372 consensus Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1430 consensus Back     alignment and domain information
>KOG1502 consensus Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777; InterPro: IPR010099 This entry represents proteins of unknown function including the Escherichia coli YfcH protein Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>KOG2774 consensus Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>KOG2865 consensus Back     alignment and domain information
>KOG3019 consensus Back     alignment and domain information
>pfam02719 Polysacc_synt_2 Polysaccharide biosynthesis protein Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>pfam01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information