254780921

254780921

dTDP-4-dehydrorhamnose reductase

GeneID in NCBI database:8209941Locus tag:CLIBASIA_04100
Protein GI in NCBI database:254780921Protein Accession:YP_003065334.1
Gene range:+(903201, 904073)Protein Length:290aa
Gene description:dTDP-4-dehydrorhamnose reductase
COG prediction:[M] dTDP-4-dehydrorhamnose reductase
KEGG prediction:rfbD; dTDP-4-dehydrorhamnose reductase; K00067 dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
SEED prediction:dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)
Pathway involved in KEGG:Polyketide sugar unit biosynthesis [PATH:las00523]
Streptomycin biosynthesis [PATH:las00521]
Subsystem involved in SEED:dTDP-rhamnose synthesis;
Rhamnose containing glycans
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290
MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI
cEEEEEccccHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHccccEEEEcccccccHHHHHcHHHHHHHHHHHHHHHHHHHHHccccEEEEcccEEEccccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEcccccccccccHHHHHHHHHHcccccEEEEcccccEEEHHHHHHHHHHHHHHcccccccccccEEEEccccccccHHHHHHHHHHHHHHHccccccEEEccHHHccccccccccccccHHHHHHHHccccccHHHHHHHHHHHc
cEEEEEcccccHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHcccEEEEccccccHHHHcccHHHHHHHHcHHHHHHHHHHcccccEEEEEEEHHHccccccccEccccccccccHHHHHHHHHHHHHHHHcccEEEEEEccEEccccccHHHHHHHHHHHccEEEEEcccEEccEEHHHHHHHHHHHHHHHHHcccccccEEEEEccccccccHHHHHHHHHHHHHHcccccccEcccccccccccccccccccccHHHHHHHcccccccHHHHHHHHHHcc
mkclvignngqIAQSLSSMcvqdveiirvgrpdidllkpkdfasfflsfspdviinpaaytavdkaedepeiafSINAEGAGAIAKAadsigipciyistdyvfdglsrtpidefsptnplniygksklageEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVcdqfgtptSALQIARAIIQIAHNliensdtslRGIFHmtadggpvswaDFAEYIFWEsaerggpysKVYRIFTkqyptkahrpayscldcsklanthniriSTWKEGVRNILVNI
MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRtpidefsptnpLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHniristwkegvrnilvni
MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSinaegagaiakaadsigiPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSalqiaraiiqiaHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI
MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI
MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI
MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI
MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI
MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFGTPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPYSKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILVNI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target290 dTDP-4-dehydrorhamnose reductase [Candidatus Liberibact
254780920358 dTDP-glucose 4,6-dehydratase [Candidatus Liberibac 0.013
254780569357 phosphoribosylaminoimidazole synthetase [Candidatu 0.039
>gi|254780920|ref|YP_003065333.1| dTDP-glucose 4,6-dehydratase [Candidatus Liberibacter asiaticus str. psy62] Length = 358 Back     alignment
 Score = 32.0 bits (71), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 51/122 (41%), Gaps = 12/122 (9%)

Query: 34  IDLLKPKDFASFFLSFSPDVIINPAAYTAVDKAEDEPEIAFSINAEGAGAIAKAADSIGI 93
           +D+   +   S    F PD I+N AA + VD++    +   + N  G   + +    +  
Sbjct: 57  VDICDRECIRSALKEFQPDAIVNFAAESHVDRSILGADEFITTNIIGTFILLEET-RLWW 115

Query: 94  PCI-----------YISTDYVFDGLSRTPIDEFSPTNPLNIYGKSKLAGEEKVASYTNNY 142
            C+            ISTD V+  L +    E  P NP + Y  +K + +  V ++ + Y
Sbjct: 116 SCLSQDKKDQFRFLQISTDEVYGSLDKGLFSEDMPYNPSSPYSATKASSDYLVLAWGHTY 175

Query: 143 VI 144
            I
Sbjct: 176 GI 177

>gi|254780569|ref|YP_003064982.1| phosphoribosylaminoimidazole synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 357 Back     alignment
 Score = 30.4 bits (67), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 30/140 (21%), Positives = 51/140 (36%), Gaps = 19/140 (13%)

Query: 7   GNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAYTAVDKA 66
           G N  I   L +MCV D+            L       FFL +     +NP   T++ K 
Sbjct: 81  GKNDTIGIDLVAMCVNDI------------LTHGAEPLFFLDYLATSQLNPDQATSIIKG 128

Query: 67  EDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNPLNIYGK 126
                IA      G   I    ++  +P +Y   DY   G +   ++     +P N+   
Sbjct: 129 -----IAAGCCQAGCALI--GGETAEMPGLYHDRDYDLAGFAVGAVERKELLSPENVCAG 181

Query: 127 SKLAGEEKVASYTNNYVILR 146
             + G      ++N + ++R
Sbjct: 182 DLILGLPSSGLHSNGFALVR 201

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target290 dTDP-4-dehydrorhamnose reductase [Candidatus Liberibact
315122653289 dTDP-4-dehydrorhamnose reductase [Candidatus Liberibact 1 1e-122
332715610297 dTDP-4-dehydrorhamnose reductase [Agrobacterium sp. H13 1 2e-77
15890374297 dTDP-4-dehydrorhamnose reductase [Agrobacterium tumefac 1 2e-77
222148116301 dTDP-4-dehydrorhamnose reductase [Agrobacterium vitis S 1 1e-75
192288555297 dTDP-4-dehydrorhamnose reductase [Rhodopseudomonas palu 1 4e-75
222148464301 dTDP-4-dehydrorhamnose reductase [Agrobacterium vitis S 1 9e-75
319784645295 dTDP-4-dehydrorhamnose reductase [Mesorhizobium ciceri 1 2e-72
326385993297 putative dTDP-4-dehydrorhamnose reductase [Novosphingob 1 2e-72
116251390295 dTDP-4-dehydrorhamnose reductase [Rhizobium leguminosar 1 3e-72
110349046295 RfbD [Rhizobium leguminosarum bv. trifolii TA1] Length 1 6e-72
>gi|315122653|ref|YP_004063142.1| dTDP-4-dehydrorhamnose reductase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 289 Back     alignment and organism information
 Score =  441 bits (1134), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 221/288 (76%), Positives = 246/288 (85%)

Query: 1   MKCLVIGNNGQIAQSLSSMCVQDVEIIRVGRPDIDLLKPKDFASFFLSFSPDVIINPAAY 60
           MK LVIGNNGQ+A SL ++  ++ E+IR+GRPDIDLLKPKDF   FLSF+PDVIINPAAY
Sbjct: 1   MKFLVIGNNGQVATSLFNLSGKNTEVIRLGRPDIDLLKPKDFVKIFLSFAPDVIINPAAY 60

Query: 61  TAVDKAEDEPEIAFSINAEGAGAIAKAADSIGIPCIYISTDYVFDGLSRTPIDEFSPTNP 120
           TAVDKAEDEP  AF+IN EGAGA+A AA+SIG+PCI+ISTDYVFDG S+TP+ E SPTNP
Sbjct: 61  TAVDKAEDEPHNAFAINTEGAGAVAAAAESIGVPCIHISTDYVFDGSSQTPLCETSPTNP 120

Query: 121 LNIYGKSKLAGEEKVASYTNNYVILRTAWVYSIFGSNFLLSMLRLAKERREISVVCDQFG 180
           L IYGKSKLAGEEKV S T+NYVILRTAWVYS+FG+NF LSMLRL+KE REISVVCDQFG
Sbjct: 121 LGIYGKSKLAGEEKVMSCTDNYVILRTAWVYSLFGTNFFLSMLRLSKEYREISVVCDQFG 180

Query: 181 TPTSALQIARAIIQIAHNLIENSDTSLRGIFHMTADGGPVSWADFAEYIFWESAERGGPY 240
           TPTSA QIA A+IQIA NL+ NSD SLRGIFHMTA+GGPVSWADFAEYIF  S E GG  
Sbjct: 181 TPTSASQIAIAVIQIARNLVNNSDNSLRGIFHMTANGGPVSWADFAEYIFLVSTELGGNS 240

Query: 241 SKVYRIFTKQYPTKAHRPAYSCLDCSKLANTHNIRISTWKEGVRNILV 288
            KV RI T QYPTKA RPAYS LDCSKL   HN+RIS+WKEGVRNI +
Sbjct: 241 CKVRRISTNQYPTKARRPAYSFLDCSKLEKIHNVRISSWKEGVRNIFI 288


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|332715610|ref|YP_004443076.1| dTDP-4-dehydrorhamnose reductase [Agrobacterium sp. H13-3] Length = 297 Back     alignment and organism information
>gi|15890374|ref|NP_356046.1| dTDP-4-dehydrorhamnose reductase [Agrobacterium tumefaciens str. C58] Length = 297 Back     alignment and organism information
>gi|222148116|ref|YP_002549073.1| dTDP-4-dehydrorhamnose reductase [Agrobacterium vitis S4] Length = 301 Back     alignment and organism information
>gi|192288555|ref|YP_001989160.1| dTDP-4-dehydrorhamnose reductase [Rhodopseudomonas palustris TIE-1] Length = 297 Back     alignment and organism information
>gi|222148464|ref|YP_002549421.1| dTDP-4-dehydrorhamnose reductase [Agrobacterium vitis S4] Length = 301 Back     alignment and organism information
>gi|319784645|ref|YP_004144121.1| dTDP-4-dehydrorhamnose reductase [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 295 Back     alignment and organism information
>gi|326385993|ref|ZP_08207617.1| putative dTDP-4-dehydrorhamnose reductase [Novosphingobium nitrogenifigens DSM 19370] Length = 297 Back     alignment and organism information
>gi|116251390|ref|YP_767228.1| dTDP-4-dehydrorhamnose reductase [Rhizobium leguminosarum bv. viciae 3841] Length = 295 Back     alignment and organism information
>gi|110349046|gb|ABG73090.1| RfbD [Rhizobium leguminosarum bv. trifolii TA1] Length = 295 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target290 dTDP-4-dehydrorhamnose reductase [Candidatus Liberibact
COG1091281 COG1091, RfbD, dTDP-4-dehydrorhamnose reductase [Cell e 4e-77
TIGR01214287 TIGR01214, rmlD, dTDP-4-dehydrorhamnose reductase 2e-73
PRK09987299 PRK09987, PRK09987, dTDP-4-dehydrorhamnose reductase; P 2e-60
COG0451314 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases 4e-15
pfam04321284 pfam04321, RmlD_sub_bind, RmlD substrate binding domain 2e-90
pfam01370235 pfam01370, Epimerase, NAD dependent epimerase/dehydrata 5e-17
KOG1430361 KOG1430, KOG1430, KOG1430, C-3 sterol dehydrogenase/3-b 7e-11
COG1087329 COG1087, GalE, UDP-glucose 4-epimerase [Cell envelope b 2e-09
COG1086588 COG1086, COG1086, Predicted nucleoside-diphosphate suga 1e-07
TIGR01179328 TIGR01179, galE, UDP-glucose-4-epimerase 2e-07
COG1088340 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell env 4e-07
KOG0747331 KOG0747, KOG0747, KOG0747, Putative NAD+-dependent epim 2e-06
KOG1371343 KOG1371, KOG1371, KOG1371, UDP-glucose 4-epimerase/UDP- 3e-06
TIGR01181317 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehydratas 5e-06
pfam02719280 pfam02719, Polysacc_synt_2, Polysaccharide biosynthesis 8e-05
COG1089345 COG1089, Gmd, GDP-D-mannose dehydratase [Cell envelope 0.002
TIGR03589324 TIGR03589, PseB, UDP-N-acetylglucosamine 4,6-dehydratas 0.003
>gnl|CDD|31288 COG1091, RfbD, dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|162255 TIGR01214, rmlD, dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>gnl|CDD|182184 PRK09987, PRK09987, dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>gnl|CDD|30800 COG0451, WcaG, Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|113104 pfam04321, RmlD_sub_bind, RmlD substrate binding domain Back     alignment and domain information
>gnl|CDD|144821 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information
>gnl|CDD|36643 KOG1430, KOG1430, KOG1430, C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism, Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|31284 COG1087, GalE, UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|31283 COG1086, COG1086, Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|130247 TIGR01179, galE, UDP-glucose-4-epimerase Back     alignment and domain information
>gnl|CDD|31285 COG1088, RfbB, dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|35966 KOG0747, KOG0747, KOG0747, Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|36585 KOG1371, KOG1371, KOG1371, UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>gnl|CDD|130249 TIGR01181, dTDP_gluc_dehyt, dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>gnl|CDD|145720 pfam02719, Polysacc_synt_2, Polysaccharide biosynthesis protein Back     alignment and domain information
>gnl|CDD|31286 COG1089, Gmd, GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|132628 TIGR03589, PseB, UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 290 dTDP-4-dehydrorhamnose reductase [Candidatus Liberibact
TIGR01214317 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005 100.0
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 100.0
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope bi 100.0
pfam04321284 RmlD_sub_bind RmlD substrate binding domain. L-rhamnose 100.0
TIGR01181340 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase; InterPro: 100.0
TIGR01179341 galE UDP-glucose 4-epimerase; InterPro: IPR005886 Synon 100.0
PRK10675338 UDP-galactose-4-epimerase; Provisional 100.0
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 100.0
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 100.0
PRK11908347 NAD-dependent epimerase/dehydratase family protein; Pro 100.0
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, 100.0
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biog 100.0
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisio 100.0
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequences 100.0
TIGR02197353 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase; 100.0
KOG0747331 consensus 100.0
TIGR02622361 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase; InterPro: I 100.0
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell enve 100.0
KOG1429350 consensus 100.0
KOG1371343 consensus 100.0
KOG1430361 consensus 100.0
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-am 100.0
KOG1502327 consensus 99.97
CHL00194319 ycf39 Ycf39; Provisional 99.96
KOG1431315 consensus 99.96
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis 99.95
TIGR01472365 gmd GDP-mannose 4,6-dehydratase; InterPro: IPR006368 Th 99.95
TIGR01777307 yfcH conserved hypothetical protein TIGR01777; InterPro 99.93
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [Gener 99.9
KOG1372376 consensus 99.87
PRK12320 699 hypothetical protein; Provisional 99.7
PRK05865 854 hypothetical protein; Provisional 99.66
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G 99.62
KOG2774366 consensus 99.6
KOG3019315 consensus 98.06
pfam02719280 Polysacc_synt_2 Polysaccharide biosynthesis protein. Th 100.0
pfam01370235 Epimerase NAD dependent epimerase/dehydratase family. T 100.0
pfam01073280 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase 100.0
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This enzy 100.0
COG1086588 Predicted nucleoside-diphosphate sugar epimerases [Cell 100.0
PRK07201 663 short chain dehydrogenase; Provisional 99.95
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase 99.93
TIGR01746405 Thioester-redct thioester reductase domain; InterPro: I 99.89
pfam05368232 NmrA NmrA-like family. NmrA is a negative transcription 99.87
KOG2865391 consensus 99.85
KOG1221467 consensus 99.79
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases [Cell 99.56
TIGR01830238 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reducta 99.32
KOG1203411 consensus 99.12
PRK12367250 short chain dehydrogenase; Provisional 98.37
TIGR01759329 MalateDH-SF1 malate dehydrogenase; InterPro: IPR010945 96.33
PTZ00117313 malate dehydrogenase; Provisional 95.97
PTZ00082322 L-lactate dehydrogenase; Provisional 95.51
pfam07993245 NAD_binding_4 Male sterility protein. This family repre 99.94
PRK07578199 short chain dehydrogenase; Provisional 99.65
PRK08219226 short chain dehydrogenase; Provisional 99.6
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 99.54
PRK12825250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.53
PRK06953222 short chain dehydrogenase; Provisional 99.48
PRK05650270 short chain dehydrogenase; Provisional 99.47
PRK09009235 C factor cell-cell signaling protein; Provisional 99.46
PRK07454241 short chain dehydrogenase; Provisional 99.45
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 99.44
PRK05872296 short chain dehydrogenase; Provisional 99.44
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.43
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.41
PRK05599246 hypothetical protein; Provisional 99.4
PRK09072262 short chain dehydrogenase; Provisional 99.4
PRK06181263 short chain dehydrogenase; Provisional 99.39
PRK07825273 short chain dehydrogenase; Provisional 99.37
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.35
PRK09186255 flagellin modification protein A; Provisional 99.35
PRK07024256 short chain dehydrogenase; Provisional 99.35
PRK09730247 hypothetical protein; Provisional 99.35
PRK07326235 short chain dehydrogenase; Provisional 99.34
PRK07666238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.34
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.33
PRK07774250 short chain dehydrogenase; Provisional 99.32
PRK06139324 short chain dehydrogenase; Provisional 99.31
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Revie 99.31
PRK07201663 short chain dehydrogenase; Provisional 99.31
PRK07707239 consensus 99.31
PRK07109338 short chain dehydrogenase; Provisional 99.31
PRK07776252 consensus 99.3
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisional 99.26
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.25
PRK07041240 short chain dehydrogenase; Provisional 99.24
PRK09135249 pteridine reductase; Provisional 99.23
PRK12828239 short chain dehydrogenase; Provisional 99.2
PRK08177225 short chain dehydrogenase; Provisional 99.18
PRK09134256 short chain dehydrogenase; Provisional 99.18
COG4221246 Short-chain alcohol dehydrogenase of unknown specificit 99.17
PRK06077249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.16
PRK12748257 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 99.13
PRK08703239 short chain dehydrogenase; Provisional 99.12
COG0300265 DltE Short-chain dehydrogenases of various substrate sp 99.1
PRK08594256 enoyl-(acyl carrier protein) reductase; Provisional 99.08
PRK08278273 short chain dehydrogenase; Provisional 99.07
PRK12747252 short chain dehydrogenase; Provisional 99.03
PRK12859257 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 99.01
PRK07904253 short chain dehydrogenase; Provisional 98.94
PRK07792303 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.92
COG2910211 Putative NADH-flavin reductase [General function predic 98.87
KOG4288283 consensus 98.83
KOG1200256 consensus 98.56
PRK07424410 bifunctional sterol desaturase/short chain dehydrogenas 98.1
PRK06300298 enoyl-(acyl carrier protein) reductase; Provisional 97.76
COG3320382 Putative dehydrogenase domain of multifunctional non-ri 99.83
PRK08267258 short chain dehydrogenase; Provisional 99.53
PRK10538248 3-hydroxy acid dehydrogenase; Provisional 99.51
PRK06180277 short chain dehydrogenase; Provisional 99.49
PRK05693274 short chain dehydrogenase; Provisional 99.48
PRK08017256 short chain dehydrogenase; Provisional 99.43
PRK05993277 short chain dehydrogenase; Provisional 99.41
PRK07832272 short chain dehydrogenase; Provisional 99.41
PRK06482276 short chain dehydrogenase; Provisional 99.41
PRK07102243 short chain dehydrogenase; Provisional 99.41
PRK06101241 short chain dehydrogenase; Provisional 99.4
PRK12826253 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed 99.4
PRK06182273 short chain dehydrogenase; Validated 99.39
PRK07231250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.37
PRK08340259 glucose-1-dehydrogenase; Provisional 99.36
PRK12827251 short chain dehydrogenase; Provisional 99.35
PRK06179270 short chain dehydrogenase; Provisional 99.34
PRK08263275 short chain dehydrogenase; Provisional 99.34
PRK05875277 short chain dehydrogenase; Provisional 99.33
PRK08220253 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.32
PRK07479252 consensus 99.31
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.31
PRK07856254 short chain dehydrogenase; Provisional 99.31
PRK05717255 oxidoreductase; Validated 99.3
pfam08659181 KR KR domain. This enzymatic domain is part of bacteria 99.3
PRK08251248 short chain dehydrogenase; Provisional 99.29
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.29
PRK06701289 short chain dehydrogenase; Provisional 99.29
PRK06124259 gluconate 5-dehydrogenase; Provisional 99.29
PRK09242258 tropinone reductase; Provisional 99.28
PRK07890258 short chain dehydrogenase; Provisional 99.28
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.28
PRK07060245 short chain dehydrogenase; Provisional 99.28
PRK09291257 short chain dehydrogenase; Provisional 99.27
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogena 99.27
PRK07577234 short chain dehydrogenase; Provisional 99.27
PRK07023243 short chain dehydrogenase; Provisional 99.27
pfam00106167 adh_short short chain dehydrogenase. This family contai 99.27
PRK08324676 short chain dehydrogenase; Validated 99.26
PRK05866290 short chain dehydrogenase; Provisional 99.26
PRK07067256 sorbitol dehydrogenase; Provisional 99.26
PRK07035252 short chain dehydrogenase; Provisional 99.25
PRK06914280 short chain dehydrogenase; Provisional 99.25
PRK06483236 short chain dehydrogenase; Provisional 99.25
PRK12939250 short chain dehydrogenase; Provisional 99.25
PRK07775275 short chain dehydrogenase; Provisional 99.25
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.25
PRK07523251 gluconate 5-dehydrogenase; Provisional 99.25
PRK06398256 aldose dehydrogenase; Validated 99.25
PRK07806248 short chain dehydrogenase; Provisional 99.25
PRK06194301 hypothetical protein; Provisional 99.24
PRK08643256 acetoin reductase; Validated 99.24
PRK06463254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.23
PRK08277278 D-mannonate oxidoreductase; Provisional 99.23
PRK08264235 short chain dehydrogenase; Validated 99.23
PRK06841255 short chain dehydrogenase; Provisional 99.23
PRK07069251 short chain dehydrogenase; Validated 99.23
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.23
PRK06924251 short chain dehydrogenase; Provisional 99.23
PRK06196316 oxidoreductase; Provisional 99.22
PRK07831261 short chain dehydrogenase; Provisional 99.22
PRK12937245 short chain dehydrogenase; Provisional 99.22
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.21
PRK06949258 short chain dehydrogenase; Provisional 99.21
PRK05854314 short chain dehydrogenase; Provisional 99.21
PRK12745259 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona 99.21
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.2
PRK06523260 short chain dehydrogenase; Provisional 99.2
PRK06138252 short chain dehydrogenase; Provisional 99.19
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.19
PRK12743253 acetoin dehydrogenase; Provisional 99.19
PRK07063259 short chain dehydrogenase; Provisional 99.19
PRK06484 530 short chain dehydrogenase; Validated 99.19
PRK06172253 short chain dehydrogenase; Provisional 99.19
PRK06346251 consensus 99.19
PRK08265261 short chain dehydrogenase; Provisional 99.18
PRK08945245 short chain dehydrogenase; Provisional 99.18
PRK07677254 short chain dehydrogenase; Provisional 99.18
PRK07814263 short chain dehydrogenase; Provisional 99.18
PRK06227256 consensus 99.17
PRK06550237 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.17
smart00822180 PKS_KR This enzymatic domain is part of bacterial polyk 99.17
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.17
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase 99.16
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.15
PRK12829264 short chain dehydrogenase; Provisional 99.15
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.15
PRK06125259 short chain dehydrogenase; Provisional 99.15
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenas 99.14
PRK05855582 short chain dehydrogenase; Validated 99.14
PRK07576260 short chain dehydrogenase; Provisional 99.13
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate deh 99.13
PRK06057255 short chain dehydrogenase; Provisional 99.13
PRK08642254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.13
PRK05867253 short chain dehydrogenase; Provisional 99.13
PRK08589272 short chain dehydrogenase; Validated 99.13
PRK06484530 short chain dehydrogenase; Validated 99.12
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisional 99.11
PRK06947252 glucose-1-dehydrogenase; Provisional 99.11
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisional 99.1
PRK08628258 short chain dehydrogenase; Provisional 99.1
PRK08339263 short chain dehydrogenase; Provisional 99.1
PRK06198268 short chain dehydrogenase; Provisional 99.1
PRK08261447 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.09
PRK06500249 short chain dehydrogenase; Provisional 99.09
PRK06197306 short chain dehydrogenase; Provisional 99.09
PRK07062265 short chain dehydrogenase; Provisional 99.09
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisional 99.08
PRK08936261 glucose-1-dehydrogenase; Provisional 99.08
PRK07074256 short chain dehydrogenase; Provisional 99.08
PRK08226263 short chain dehydrogenase; Provisional 99.08
PRK06114262 short chain dehydrogenase; Provisional 99.08
PRK06128300 oxidoreductase; Provisional 99.08
PRK07478254 short chain dehydrogenase; Provisional 99.07
PRK07370259 enoyl-(acyl carrier protein) reductase; Validated 99.07
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.06
PRK07791285 short chain dehydrogenase; Provisional 99.05
PRK07533254 enoyl-(acyl carrier protein) reductase; Provisional 99.04
PRK12744257 short chain dehydrogenase; Provisional 99.04
PRK12746254 short chain dehydrogenase; Provisional 99.03
PRK05876275 short chain dehydrogenase; Provisional 99.03
PRK06123249 short chain dehydrogenase; Provisional 99.03
PRK05884223 short chain dehydrogenase; Provisional 99.02
KOG1205282 consensus 99.0
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisional 98.99
PRK12742237 oxidoreductase; Provisional 98.98
PRK07985294 oxidoreductase; Provisional 98.98
PRK07453322 protochlorophyllide oxidoreductase; Validated 98.96
COG3967245 DltE Short-chain dehydrogenase involved in D-alanine es 98.91
TIGR01963258 PHB_DH 3-hydroxybutyrate dehydrogenase; InterPro: IPR01 98.87
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisional 98.87
COG1028251 FabG Dehydrogenases with different specificities (relat 98.84
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisional 98.84
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 98.83
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisional 98.82
KOG1208314 consensus 98.82
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisional 98.79
TIGR02632709 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol 98.78
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisional 98.75
KOG4039238 consensus 98.75
KOG1209289 consensus 98.71
PRK06940277 short chain dehydrogenase; Provisional 98.69
PRK08862227 short chain dehydrogenase; Provisional 98.66
TIGR02415258 23BDH acetoin reductases; InterPro: IPR014007 One membe 98.64
PRK08303305 short chain dehydrogenase; Provisional 98.63
KOG0725270 consensus 98.62
KOG1610322 consensus 98.54
KOG1201300 consensus 98.49
KOG1611249 consensus 98.2
KOG1207245 consensus 98.15
KOG4169261 consensus 98.13
KOG1014312 consensus 97.95
TIGR01832249 kduD 2-deoxy-D-gluconate 3-dehydrogenase; InterPro: IPR 97.46
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 97.35
pfam08643296 DUF1776 Fungal family of unknown function (DUF1776). Th 97.22
KOG1199260 consensus 97.14
KOG1478341 consensus 96.62
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; Review 96.28
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino 96.18
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 96.1
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, pu 95.85
PRK05294 1063 carB carbamoyl phosphate synthase large subunit; Review 95.74
KOG1204253 consensus 95.65
PRK05294 1063 carB carbamoyl phosphate synthase large subunit; Review 95.43
TIGR01850361 argC N-acetyl-gamma-glutamyl-phosphate reductase; Inter 95.35
KOG1494345 consensus 93.77
COG0458400 CarB Carbamoylphosphate synthase large subunit (split g 91.17
TIGR01772379 MDH_euk_gproteo malate dehydrogenase, NAD-dependent; In 91.16
COG4982 866 3-oxoacyl-[acyl-carrier protein] 90.61
TIGR01829244 AcAcCoA_reduct acetoacetyl-CoA reductase; InterPro: IPR 99.35
PRK12428261 3-alpha-hydroxysteroid dehydrogenase; Provisional 98.87
PRK06720169 hypothetical protein; Provisional 98.55
KOG1210331 consensus 98.24
PRK00436345 argC N-acetyl-gamma-glutamyl-phosphate reductase; Valid 97.1
TIGR02356210 adenyl_thiF thiazole biosynthesis adenylyltransferase T 97.09
pfam02571246 CbiJ Precorrin-6x reductase CbiJ/CobK. This family cons 97.05
PRK11863314 N-acetyl-gamma-glutamyl-phosphate reductase; Provisiona 97.03
PRK05086312 malate dehydrogenase; Provisional 96.92
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate 96.9
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MDH) is 96.86
pfam01113122 DapB_N Dihydrodipicolinate reductase, N-terminus. Dihyd 96.86
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochond 96.76
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Mal 96.65
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehydroge 96.57
PRK06598348 aspartate-semialdehyde dehydrogenase; Reviewed 96.57
PRK05442325 malate dehydrogenase; Provisional 96.52
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like structu 96.47
PRK08057241 cobalt-precorrin-6x reductase; Reviewed 96.24
pfam01118121 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding 95.77
cd05290307 LDH_3 A subgroup of L-lactate dehydrogenases. L-lactate 95.68
PRK05690245 molybdopterin biosynthesis protein MoeB; Provisional 95.47
COG2099257 CobK Precorrin-6x reductase [Coenzyme metabolism] 95.21
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like prot 95.1
PRK12475337 thiamine/molybdopterin biosynthesis MoeB-like protein; 94.96
PRK06223312 malate dehydrogenase; Reviewed 94.87
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino acid tr 94.84
TIGR01289321 LPOR light-dependent protochlorophyllide reductase; Int 94.69
cd01493425 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APP 94.5
TIGR00715260 precor6x_red precorrin-6x reductase; InterPro: IPR00372 94.48
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 94.41
PRK08762379 molybdopterin biosynthesis protein MoeB; Validated 94.38
pfam00899134 ThiF ThiF family. This family contains a repeated domai 94.31
PTZ00325313 malate dehydrogenase; Provisional 94.19
PRK07411390 hypothetical protein; Validated 94.17
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Validated 93.94
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-li 93.91
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 93.87
PRK05600370 thiamine biosynthesis protein ThiF; Validated 93.57
PRK07574385 formate dehydrogenase; Provisional 93.56
COG2201350 CheB Chemotaxis response regulator containing a CheY-li 93.45
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid transpor 93.26
cd01483143 E1_enzyme_family Superfamily of activating enzymes (E1) 93.24
COG1179263 Dinucleotide-utilizing enzymes involved in molybdopteri 92.95
COG0039313 Mdh Malate/lactate dehydrogenases [Energy production an 92.8
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 92.49
PRK08328230 hypothetical protein; Provisional 92.29
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-lactate 92.24
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding 92.12
cd01489312 Uba2_SUMO Ubiquitin activating enzyme (E1) subunit UBA2 91.7
PRK08223287 hypothetical protein; Validated 91.49
KOG2018430 consensus 91.35
cd00755231 YgdL_like Family of activating enzymes (E1) of ubiquiti 91.24
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-li 90.93
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases and s 90.45
COG1748389 LYS9 Saccharopine dehydrogenase and related proteins [A 98.48
pfam03435384 Saccharop_dh Saccharopine dehydrogenase. This family co 98.01
PRK08655 441 prephenate dehydrogenase; Provisional 97.41
PRK09496 455 trkA potassium transporter peripheral membrane componen 97.4
PRK06732228 phosphopantothenate--cysteine ligase; Validated 97.35
TIGR02114253 coaB_strep phosphopantothenate--cysteine ligase; InterP 97.3
COG0027394 PurT Formate-dependent phosphoribosylglycinamide formyl 97.19
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2; Val 97.06
PRK12767325 carbamoyl phosphate synthase-like protein; Provisional 97.04
COG3268382 Uncharacterized conserved protein [Function unknown] 96.71
TIGR00036281 dapB dihydrodipicolinate reductase; InterPro: IPR011770 96.7
KOG2733423 consensus 96.64
KOG1198347 consensus 96.56
PRK05447379 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provis 96.45
PRK11199374 tyrA bifunctional chorismate mutase/prephenate dehydrog 96.44
PRK13301267 putative L-aspartate dehydrogenase; Provisional 96.43
TIGR01758325 MDH_euk_cyt malate dehydrogenase, NAD-dependent; InterP 96.4
PRK13302271 putative L-aspartate dehydrogenase; Provisional 96.12
PRK09620229 hypothetical protein; Provisional 96.07
PRK07417280 arogenate dehydrogenase; Reviewed 96.05
PRK06019377 phosphoribosylaminoimidazole carboxylase ATPase subunit 95.99
pfam01470203 Peptidase_C15 Pyroglutamyl peptidase. 95.89
PRK13304265 L-aspartate dehydrogenase; Reviewed 95.86
PRK13194204 pyrrolidone-carboxylate peptidase; Provisional 95.6
pfam04127197 DFP DNA / pantothenate metabolism flavoprotein. The DNA 95.58
TIGR02817338 adh_fam_1 zinc-binding alcohol dehydrogenase family pro 95.56
PRK06849387 hypothetical protein; Provisional 95.4
PRK13193201 pyrrolidone-carboxylate peptidase; Provisional 95.34
PRK13303265 L-aspartate dehydrogenase; Provisional 95.11
pfam02670129 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoi 95.06
PRK13197215 pyrrolidone-carboxylate peptidase; Provisional 94.86
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; Review 94.66
TIGR02823330 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP f 94.6
COG1712255 Predicted dinucleotide-utilizing enzyme [General functi 94.44
PRK12446352 N-acetylglucosaminyl transferase; Reviewed 94.32
pfam02826176 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogen 94.3
PRK08306296 dipicolinate synthase subunit A; Reviewed 94.27
COG0604326 Qor NADPH:quinone reductase and related Zn-dependent ox 94.04
PRK00885 424 phosphoribosylamine--glycine ligase; Provisional 93.88
pfam01488134 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This 93.28
COG0623259 FabI Enoyl-[acyl-carrier-protein] 93.27
PRK06395 435 phosphoribosylamine--glycine ligase; Provisional 93.02
pfam01408120 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossman 92.76
PRK13195222 pyrrolidone-carboxylate peptidase; Provisional 92.71
PRK13790 415 phosphoribosylamine--glycine ligase; Provisional 92.69
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transport and 92.68
PRK07502307 cyclohexadienyl dehydrogenase; Validated 92.51
PRK00045429 hemA glutamyl-tRNA reductase; Reviewed 92.32
PRK13789 426 phosphoribosylamine--glycine ligase; Provisional 92.3
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR sy 92.17
PRK11559295 garR tartronate semialdehyde reductase; Provisional 92.03
PRK00257379 erythronate-4-phosphate dehydrogenase; Validated 92.0
pfam0007082 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 91.97
pfam02254115 TrkA_N TrkA-N domain. This domain is found in a wide va 91.85
PRK08236207 hypothetical protein; Provisional 91.84
pfam03446163 NAD_binding_2 NAD binding domain of 6-phosphogluconate 91.82
PRK10643222 DNA-binding transcriptional regulator BasR; Provisional 91.22
PRK08644209 thiamine biosynthesis protein ThiF; Provisional 90.96
COG0111324 SerA Phosphoglycerate dehydrogenase and related dehydro 90.91
PRK13196212 pyrrolidone-carboxylate peptidase; Provisional 90.77
COG2039207 Pcp Pyrrolidone-carboxylate peptidase (N-terminal pyrog 90.75
PRK13435141 response regulator; Provisional 90.59
KOG2380 480 consensus 90.32
PRK08309182 short chain dehydrogenase; Provisional 97.69
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene tetr 96.85
pfam00056142 Ldh_1_N lactate/malate dehydrogenase, NAD binding domai 96.59
PRK00048265 dihydrodipicolinate reductase; Provisional 96.32
PRK08507275 prephenate dehydrogenase; Validated 96.28
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 96.11
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 95.78
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketide syn 95.73
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 95.51
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provisional 95.46
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 95.3
PRK08229341 2-dehydropantoate 2-reductase; Provisional 95.12
PRK05579392 bifunctional phosphopantothenoylcysteine decarboxylase/ 95.09
PRK06522307 2-dehydropantoate 2-reductase; Reviewed 95.06
PRK08664350 aspartate-semialdehyde dehydrogenase; Reviewed 95.04
COG2085211 Predicted dinucleotide-binding enzymes [General functio 94.81
PRK00711 416 D-amino acid dehydrogenase small subunit; Validated 94.76
PRK12921306 2-dehydropantoate 2-reductase; Provisional 94.61
TIGR00978358 asd_EA aspartate-semialdehyde dehydrogenase; InterPro: 94.59
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 94.57
COG1004 414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelop 94.56
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like 93.82
PRK08040337 putative semialdehyde dehydrogenase; Provisional 93.68
PRK05708305 2-dehydropantoate 2-reductase; Provisional 93.61
pfam01210159 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd 93.41
COG0743385 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Li 93.38
TIGR02685283 pter_reduc_Leis pteridine reductase; InterPro: IPR01405 92.43
PRK07588 391 hypothetical protein; Provisional 92.32
PRK06753373 hypothetical protein; Provisional 92.29
PRK13982 476 bifunctional SbtC-like/phosphopantothenoylcysteine deca 91.88
PRK06249313 2-dehydropantoate 2-reductase; Provisional 91.74
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogena 91.62
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 91.49
cd04510334 consensus 91.08
PRK12464 392 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provis 90.96
PRK12409 410 D-amino acid dehydrogenase small subunit; Provisional 90.51
cd06334351 PBP1_ABC_ligand_binding_like_1 Type I periplasmic ligan 90.37
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy product 90.34
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 90.33
PRK06444197 prephenate dehydrogenase; Provisional 90.28
PRK00726359 murG N-acetylglucosaminyl transferase; Provisional 92.28
PRK09191261 two-component response regulator; Provisional 91.86
TIGR02853288 spore_dpaA dipicolinic acid synthetase, A subunit; Inte 90.11
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam04321 RmlD_sub_bind RmlD substrate binding domain Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase; InterPro: IPR005888 The conversion of dTDP-glucose into dTDP-4-keto-6-deoxyglucose by Escherichia coli dTDP-glucose 4,6-dehydratase) takes place in the active site in three steps: dehydrogenation to dTDP-4-ketoglucose, dehydration to dTDP-4-ketoglucose-5,6-ene, and rereduction of C6 to the methyl group Back     alignment and domain information
>TIGR01179 galE UDP-glucose 4-epimerase; InterPro: IPR005886 Synonym: UDP-galactose 4-epimerase UDP-glucose 4-epimerase (5 Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase; InterPro: IPR011912 Lipopolysaccharides (LPS) are glycolipids that consitutes the outer monolayer of the outer membranes of most Gram-negative bacteria Back     alignment and domain information
>KOG0747 consensus Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase; InterPro: IPR013445 This entry contains CDP-glucose 4,6-dehydratases from a variety of Gram-negative and Gram-positive bacteria Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1429 consensus Back     alignment and domain information
>KOG1371 consensus Back     alignment and domain information
>KOG1430 consensus Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>KOG1502 consensus Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>KOG1431 consensus Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase; InterPro: IPR006368 This family represent GDP-mannose 4,6-dehydratase, also known as GDP-D-mannose dehydratase Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777; InterPro: IPR010099 This entry represents proteins of unknown function including the Escherichia coli YfcH protein Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>KOG1372 consensus Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>KOG2774 consensus Back     alignment and domain information
>KOG3019 consensus Back     alignment and domain information
>pfam02719 Polysacc_synt_2 Polysaccharide biosynthesis protein Back     alignment and domain information
>pfam01370 Epimerase NAD dependent epimerase/dehydratase family Back     alignment and domain information
>pfam01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain; InterPro: IPR010080 This domain includes the C-terminal domain from the fungal alpha aminoadipate reductase enzyme (also known as aminoadipate semialdehyde dehydrogenase) which is involved in the biosynthesis of lysine , as well as the reductase-containing component of the myxochelin biosynthetic gene cluster, MxcG Back     alignment and domain information
>pfam05368 NmrA NmrA-like family Back     alignment and domain information
>KOG2865 consensus Back     alignment and domain information
>KOG1221 consensus Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase; InterPro: IPR011284 This entry represents 3-oxoacyl-[ACP] reductase, also called 3-ketoacyl-acyl carrier protein reductase, an enzyme of fatty acid biosynthesis found in many plant and bacterial species Back     alignment and domain information
>KOG1203 consensus Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase; InterPro: IPR010945 Malate dehydrogenases catalyse the interconversion of malate and oxaloacetate using dinucleotide cofactors Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>pfam07993 NAD_binding_4 Male sterility protein Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09730 hypothetical protein; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information