254780922

254780922

glucose-1-phosphate thymidylyltransferase

GeneID in NCBI database:8209942Locus tag:CLIBASIA_04105
Protein GI in NCBI database:254780922Protein Accession:YP_003065335.1
Gene range:+(904097, 904975)Protein Length:292aa
Gene description:glucose-1-phosphate thymidylyltransferase
COG prediction:[M] dTDP-glucose pyrophosphorylase
KEGG prediction:rfbA; glucose-1-phosphate thymidylyltransferase; K00973 glucose-1-phosphate thymidylyltransferase [EC:2.7.7.24]
SEED prediction:Glucose-1-phosphate thymidylyltransferase (EC 2.7.7.24)
Pathway involved in KEGG:Polyketide sugar unit biosynthesis [PATH:las00523]
Streptomycin biosynthesis [PATH:las00521]
Subsystem involved in SEED:dTDP-rhamnose synthesis;
Rhamnose containing glycans
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290--
MKGIVLAGGSGTRLRPLTDLLSKQMLPIYNKPMIYYPVSTLMDAGIREILIISTPRDLPVLKEFLGSGEKWGVQFSYIEQLVPAGLAQSYILGAEFIGDSSSVLILGDNVFYGSDISDIFHKARARRNSATVVGCHVQNPQRYGVVEVDSSNQAISIEEKPNNPKSSFAVTGIYFYDQEVVNIARNIRPSARGELEITDVNSYYLDKGLLAVEFLREGSAWFDAGTPESLLDTAVFVRNIENRLGLYVACPEEIAYRHDFINESQFFQLIDHFGNSPYGLYLRQVVEKKKRI
cEEEEEccccccccHHHHccccccEEEEccEEHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHccccccccEEEEEEccccccHHHHHHHHHHHHccccEEEEEcccEEccccHHHHHHHHHHccccEEEEEEEccccccccEEEEcccccEEEEEEccccccccEEEEEEEEEcHHHHHHHHHcccccccccHHHHHHHHHHHccccEEEEEccccEEEEcccHHHHHHHHHHHHcccHHcccEEccccHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHccccc
cEEEEEccccccccccccccccHHHcEEccEEccHHHHHHHHHccccEEEEEEccccHHHHHHHHcccHHHccEEEEEEccccccHHHHHHHcHHHHccccEEEEEccccEEcccHHHHHHHHHcccccEEEEEEEcccccccEEEEEccccEEEEEEEccccccccEEcccEEEEcccHHHHHHHccccccccccHHHHHHHHHHcccEEEEEEccccEEcccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHHcccccc
mkgivlaggsgtrlrpltdllskqmlpiynkpmiyypvstlmdaGIREILIistprdlpVLKEFlgsgekwgvQFSYIEQLVPAGLAQSYILGAefigdsssvlilgdnvfygsdiSDIFHKARArrnsatvvgchvqnpqrygvvevdssnqaisieekpnnpkssfavtgiyfyDQEVVNIARnirpsargeleitdvnsyyldkGLLAVEFLREgsawfdagtpeslLDTAVFVRNIENrlglyvacpeeiayRHDFINESQFFQLIdhfgnspyglYLRQVVEKKKRI
mkgivlaggsgtrlrplTDLLSKQMLPIYNKPMIYYPVSTLMDAGIREILIISTPRDLPVLKEFLGSGEKWGVQFSYIEQLVPAGLAQSYILGAEFIGDSSSVLILGDNVFYGSDISDIFHKARARRNSatvvgchvqnpqrYGVVEVDSSNQAIsieekpnnpkssFAVTGIYFYDQEVVNIARNirpsargeleitdvnsyYLDKGLLAVEFLREGSAWFDAGTPESLLDTAVFVRNIENRLGLYVACPEEIAYRHDFINESQFFQLIDHFGNSPYGLylrqvvekkkri
MKGIVLAGGSGTRLRPLTDLLSKQMLPIYNKPMIYYPVSTLMDAGIREILIISTPRDLPVLKEFLGSGEKWGVQFSYIEQLVPAGLAQSYILGAEFIGDSSSVLILGDNVFYGSDISDIFHKARARRNSATVVGCHVQNPQRYGVVEVDSSNQAISIEEKPNNPKSSFAVTGIYFYDQEVVNIARNIRPSARGELEITDVNSYYLDKGLLAVEFLREGSAWFDAGTPESLLDTAVFVRNIENRLGLYVACPEEIAYRHDFINESQFFQLIDHFGNSPYGLYLRQVVEKKKRI
MKGIVLAGGSGTRLRPLTDLLSKQMLPIYNKPMIYYPVSTLMDAGIREILIISTPRDLPVLKEFLGSGEKWGVQFSYIEQLVPAGLAQSYILGAEFIGDSSSVLILGDNVFYGSDISDIFHK*RARRNSATVVGCHVQNPQRYGVVEVDSSNQAISIEEKPNNPKSSFAVTGIYFYDQEVVNIARNIRPSARGELEITDVNSYYLDKGLLAVEFLREGSAWFDAGTPESLLDTAVFVRNIENRLGLYVACPEEIAYRHDFINESQFFQLIDHFGNSPYGLYLRQVVEK****
MKGIVLAGGSGTRLRPLTDLLSKQMLPIYNKPMIYYPVSTLMDAGIREILIISTPRDLPVLKEFLGSGEKWGVQFSYIEQLVPAGLAQSYILGAEFIGDSSSVLILGDNVFYGSDISDIFHKARARRNSATVVGCHVQNPQRYGVVEVDSSNQAISIEEKPNNPKSSFAVTGIYFYDQEVVNIARNIRPSARGELEITDVNSYYLDKGLLAVEFLREGSAWFDAGTPESLLDTAVFVRNIENRLGLYVACPEEIAYRHDFINESQFFQLIDHFGNSPYGLYLRQVVEKKKRI
MKGIVLAGGSGTRLRPLTDLLSKQMLPIYNKPMIYYPVSTLMDAGIREILIISTPRDLPVLKEFLGSGEKWGVQFSYIEQLVPAGLAQSYILGAEFIGDSSSVLILGDNVFYGSDISDIFHKARARRNSATVVGCHVQNPQRYGVVEVDSSNQAISIEEKPNNPKSSFAVTGIYFYDQEVVNIARNIRPSARGELEITDVNSYYLDKGLLAVEFLREGSAWFDAGTPESLLDTAVFVRNIENRLGLYVACPEEIAYRHDFINESQFFQLIDHFGNSPYGLYLRQVVEKK***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGIVLAGGSGTRLRPLTDLLSKQMLPIYNKPMIYYPVSTLMDAGIREILIISTPRDLPVLKEFLGSGEKWGVQFSYIEQLVPAGLAQSYILGAEFIGDSSSVLILGDNVFYGSDISDIFHKARARRNSATVVGCHVQNPQRYGVVEVDSSNQAISIEEKPNNPKSSFAVTGIYFYDQEVVNIARNIRPSARGELEITDVNSYYLDKGLLAVEFLREGSAWFDAGTPESLLDTAVFVRNIENRLGLYVACPEEIAYRHDFINESQFFQLIDHFGNSPYGLYLRQVVEKKKRI
MKGIVLAGGSGTRLRPLTDLLSKQMLPIYNKPMIYYPVSTLMDAGIREILIISTPRDLPVLKEFLGSGEKWGVQFSYIEQLVPAGLAQSYILGAEFIGDSSSVLILGDNVFYGSDISDIFHKARARRNSATVVGCHVQNPQRYGVVEVDSSNQAISIEEKPNNPKSSFAVTGIYFYDQEVVNIARNIRPSARGELEITDVNSYYLDKGLLAVEFLREGSAWFDAGTPESLLDTAVFVRNIENRLGLYVACPEEIAYRHDFINESQFFQLIDHFGNSPYGLYLRQVVEKKKRI
MKGIVLAGGSGTRLRPLTDLLSKQMLPIYNKPMIYYPVSTLMDAGIREILIISTPRDLPVLKEFLGSGEKWGVQFSYIEQLVPAGLAQSYILGAEFIGDSSSVLILGDNVFYGSDISDIFHKARARRNSATVVGCHVQNPQRYGVVEVDSSNQAISIEEKPNNPKSSFAVTGIYFYDQEVVNIARNIRPSARGELEITDVNSYYLDKGLLAVEFLREGSAWFDAGTPESLLDTAVFVRNIENRLGLYVACPEEIAYRHDFINESQFFQLIDHFGNSPYGLYLRQVVEKKKRI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target292 glucose-1-phosphate thymidylyltransferase [Candidatus L
254780365299 UTP-glucose-1-phosphate uridylyltransferase protei 2e-08
254780942 442 UDP-N-acetylglucosamine pyrophosphorylase protein 7e-05
>gi|254780365|ref|YP_003064778.1| UTP-glucose-1-phosphate uridylyltransferase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 299 Back     alignment
 Score = 51.6 bits (122), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 101/235 (42%), Gaps = 40/235 (17%)

Query: 2   KGIVLAGGSGTRLRPLTDLLSKQMLPIYNKPMIYYPVSTLMDAGIREILIISTPRDLPVL 61
           K +    G G R  P++ ++ K+ML I ++P+I Y +   ++AG+ + + + T R   ++
Sbjct: 9   KAVFPIAGLGMRFFPISKVIPKEMLAIVDRPVIQYVIEEALEAGLTDFVFV-TGRGKGLI 67

Query: 62  KEFLG---------SGEKWGVQFSYIEQLVPA-------------GLAQSYILGAEFIGD 99
           K++                  + + + + +P+             GL  +       IGD
Sbjct: 68  KDYFDIQFELEQSLRKRNKKAELTLLAESIPSIGNAVFTWQYERKGLGHAVWCARNIIGD 127

Query: 100 SSSVLILGDNVF-------YGSDISDIFHKARARRNSATVVGCHVQNPQRYGVVEVDSS- 151
           +   L+L D +          +++  ++ K  A  N   V  C  Q   +YG+V+V  + 
Sbjct: 128 NPFALLLPDMIMSPLEGENCMANMIKLYEKEGA--NILAVSECDPQLSCKYGMVQVGKAI 185

Query: 152 -NQAISIEEKPNNPKSS-----FAVTGIYFYDQEVVNIARNIRPS-ARGELEITD 199
            +Q   I +    P SS     F + G Y    ++ +I  + + +  +GE+++TD
Sbjct: 186 DHQVFHISDMIEKPDSSTFISNFFINGRYILHPDIFSILNDWKENEGKGEIQLTD 240

>gi|254780942|ref|YP_003065355.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 442 Back     alignment
 Score = 39.3 bits (90), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 79/199 (39%), Gaps = 44/199 (22%)

Query: 3   GIVLAGGSGTRLRPLTDLLSKQMLPIYNKPMIYYPVSTLMDAGIREILIISTPRDLPVLK 62
            IVLA G G R++  +   SK +  I  KPMI + + T+  AGI  + ++          
Sbjct: 7   AIVLAAGRGHRMKSSS---SKVLQKIAGKPMISHVMETIAAAGIENVALV---------- 53

Query: 63  EFLGSGEKWGVQFSYIEQLVPAGLAQSYILGAEFIGDSSSVLILGDNVFYGSD------- 115
             LG G +   + ++     P  L+  Y +     G + +VL   D +  G D       
Sbjct: 54  --LGYGAEEITRINF-----PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYG 106

Query: 116 -----ISDIFHKAR---ARRNSATVVGCHVQNPQRYG--------VVEVDSSNQAISIEE 159
                 S    KA    A+  S  VVG +  NP+ YG        ++ +   N A   E 
Sbjct: 107 DVPLVSSHTLKKAMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEER 166

Query: 160 KPNNPKSSF-AVTGIYFYD 177
           K +   S   A+ G+Y  D
Sbjct: 167 KIHYCNSGLMAIDGLYIMD 185

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target292 glucose-1-phosphate thymidylyltransferase [Candidatus L
315122652292 glucose-1-phosphate thymidylyltransferase [Candidatus L 1 1e-124
254418177291 glucose-1-phosphate thymidylyltransferase [Brevundimona 1 5e-98
222148117287 glucose-1-phosphate thymidylyltransferase [Agrobacteriu 1 1e-97
16125393289 glucose-1-phosphate thymidylyltransferase [Caulobacter 1 5e-97
222148463287 glucose-1-phosphate thymidylyltransferase [Agrobacteriu 1 1e-96
302382263288 glucose-1-phosphate thymidylyltransferase [Brevundimona 1 4e-96
148556922289 glucose-1-phosphate thymidylyltransferase [Sphingomonas 1 8e-95
115374653293 glucose-1-phosphate thymidylyltransferase [Stigmatella 1 1e-94
254468107289 glucose-1-phosphate thymidylyltransferase [beta proteob 1 1e-94
149176683294 glucose-1-phosphate thymidylyltransferase [Planctomyces 1 2e-94
>gi|315122652|ref|YP_004063141.1| glucose-1-phosphate thymidylyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 292 Back     alignment and organism information
 Score =  448 bits (1152), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 210/290 (72%), Positives = 249/290 (85%)

Query: 1   MKGIVLAGGSGTRLRPLTDLLSKQMLPIYNKPMIYYPVSTLMDAGIREILIISTPRDLPV 60
           M+GI+LAGGSGTRL+P+TDL+SKQ LP+YNKPMIYYP+S LM++GIREILIIS PRDL  
Sbjct: 1   MRGIILAGGSGTRLKPMTDLISKQALPVYNKPMIYYPLSVLMNSGIREILIISAPRDLLF 60

Query: 61  LKEFLGSGEKWGVQFSYIEQLVPAGLAQSYILGAEFIGDSSSVLILGDNVFYGSDISDIF 120
            K+ LGSGEKWG+ FSYIEQ  P GLAQ+YILGAEF+GDS SVLILGDN+FYG++I   F
Sbjct: 61  FKKLLGSGEKWGMSFSYIEQPFPGGLAQAYILGAEFVGDSPSVLILGDNIFYGAEIPTFF 120

Query: 121 HKARARRNSATVVGCHVQNPQRYGVVEVDSSNQAISIEEKPNNPKSSFAVTGIYFYDQEV 180
            KAR ++  AT+V CH Q+P RYG+VEVDS N+AISIEEKP  PKSSFAVTG+YFYD+EV
Sbjct: 121 QKAREQKKGATIVACHTQDPNRYGIVEVDSCNRAISIEEKPITPKSSFAVTGLYFYDKEV 180

Query: 181 VNIARNIRPSARGELEITDVNSYYLDKGLLAVEFLREGSAWFDAGTPESLLDTAVFVRNI 240
           VNIAR+++PSARGELEITDVN +YL +GLL+V+FL E SAWFDAGTPESL DT++FVRNI
Sbjct: 181 VNIARSLQPSARGELEITDVNCHYLKEGLLSVDFLSENSAWFDAGTPESLFDTSLFVRNI 240

Query: 241 ENRLGLYVACPEEIAYRHDFINESQFFQLIDHFGNSPYGLYLRQVVEKKK 290
           ENRLG   A PEEIAYR +FI+  QF +LID+FGNS YGLYL+ V+E KK
Sbjct: 241 ENRLGFGFAYPEEIAYRRNFISLDQFVRLIDNFGNSSYGLYLKNVIEHKK 290


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|254418177|ref|ZP_05031901.1| glucose-1-phosphate thymidylyltransferase [Brevundimonas sp. BAL3] Length = 291 Back     alignment and organism information
>gi|222148117|ref|YP_002549074.1| glucose-1-phosphate thymidylyltransferase [Agrobacterium vitis S4] Length = 287 Back     alignment and organism information
>gi|16125393|ref|NP_419957.1| glucose-1-phosphate thymidylyltransferase [Caulobacter crescentus CB15] Length = 289 Back     alignment and organism information
>gi|222148463|ref|YP_002549420.1| glucose-1-phosphate thymidylyltransferase [Agrobacterium vitis S4] Length = 287 Back     alignment and organism information
>gi|302382263|ref|YP_003818086.1| glucose-1-phosphate thymidylyltransferase [Brevundimonas subvibrioides ATCC 15264] Length = 288 Back     alignment and organism information
>gi|148556922|ref|YP_001264504.1| glucose-1-phosphate thymidylyltransferase [Sphingomonas wittichii RW1] Length = 289 Back     alignment and organism information
>gi|115374653|ref|ZP_01461931.1| glucose-1-phosphate thymidylyltransferase [Stigmatella aurantiaca DW4/3-1] Length = 293 Back     alignment and organism information
>gi|254468107|ref|ZP_05081513.1| glucose-1-phosphate thymidylyltransferase [beta proteobacterium KB13] Length = 289 Back     alignment and organism information
>gi|149176683|ref|ZP_01855295.1| glucose-1-phosphate thymidylyltransferase [Planctomyces maris DSM 8797] Length = 294 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target292 glucose-1-phosphate thymidylyltransferase [Candidatus L
TIGR01207286 TIGR01207, rmlA, glucose-1-phosphate thymidylyltransfer 1e-113
COG1209286 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cell env 3e-96
PRK15480292 PRK15480, PRK15480, glucose-1-phosphate thymidylyltrans 2e-92
pfam00483247 pfam00483, NTP_transferase, Nucleotidyl transferase 2e-68
cd04189236 cd04189, G1P_TT_long, G1P_TT_long represents the long f 2e-59
TIGR01208353 TIGR01208, rmlA_long, glucose-1-phosphate thymidylylran 7e-51
cd04181217 cd04181, NTP_transferase, NTP_transferases catalyze the 5e-50
COG1208358 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophospho 3e-34
COG1210291 COG1210, GalU, UDP-glucose pyrophosphorylase [Cell enve 5e-25
cd06426220 cd06426, NTP_transferase_like_2, NTP_trnasferase_like_2 9e-25
cd02541267 cd02541, UGPase_prokaryotic, Prokaryotic UGPase catalys 2e-24
KOG1322371 KOG1322, KOG1322, KOG1322, GDP-mannose pyrophosphorylas 3e-23
TIGR01099260 TIGR01099, galU, UTP-glucose-1-phosphate uridylyltransf 1e-18
cd06915223 cd06915, NTP_transferase_WcbM_like, WcbM_like is a subf 1e-17
cd06422221 cd06422, NTP_transferase_like_1, NTP_transferase_like_1 2e-13
cd02523229 cd02523, PC_cytidylyltransferase, Phosphocholine cytidy 2e-10
cd06428257 cd06428, M1P_guanylylT_A_like_N, N-terminal domain of M 5e-10
PRK14358 481 PRK14358, glmU, bifunctional N-acetylglucosamine-1-phos 1e-08
PRK05293380 PRK05293, glgC, glucose-1-phosphate adenylyltransferase 2e-08
COG1213239 COG1213, COG1213, Predicted sugar nucleotidyltransferas 3e-08
cd02538240 cd02538, G1P_TT_short, G1P_TT_short is the short form o 1e-110
cd06425233 cd06425, M1P_guanylylT_B_like_N, N-terminal domain of t 1e-20
COG0448393 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydr 3e-17
TIGR02091361 TIGR02091, glgC, glucose-1-phosphate adenylyltransferas 3e-15
PRK13389302 PRK13389, PRK13389, UTP--glucose-1-phosphate uridylyltr 8e-12
cd02540229 cd02540, GT2_GlmU_N_bac, N-terminal domain of bacterial 6e-11
KOG1460 407 KOG1460, KOG1460, KOG1460, GDP-mannose pyrophosphorylas 9e-11
PRK14355 459 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phos 1e-10
PRK10122297 PRK10122, PRK10122, GalU regulator GalF; Provisional 1e-10
TIGR01105297 TIGR01105, galF, UTP-glucose-1-phosphate uridylyltransf 6e-10
COG1207 460 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltr 3e-09
PRK00725425 PRK00725, glgC, glucose-1-phosphate adenylyltransferase 3e-09
PRK14354 458 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phos 8e-08
PRK14357 448 PRK14357, glmU, bifunctional N-acetylglucosamine-1-phos 1e-07
TIGR02092369 TIGR02092, glgD, glucose-1-phosphate adenylyltransferas 1e-06
PRK00844407 PRK00844, glgC, glucose-1-phosphate adenylyltransferase 1e-06
TIGR01173 451 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylas 2e-06
cd04198214 cd04198, eIF-2B_gamma_N, The N-terminal domain of gamma 1e-13
KOG1462 433 KOG1462, KOG1462, KOG1462, Translation initiation facto 2e-09
cd02516218 cd02516, CDP-ME_synthetase, CDP-ME synthetase is involv 2e-05
PRK02862 429 PRK02862, glgC, glucose-1-phosphate adenylyltransferase 4e-05
COG1211230 COG1211, IspD, 4-diphosphocytidyl-2-methyl-D-erithritol 8e-05
PRK00155227 PRK00155, ispD, 2-C-methyl-D-erythritol 4-phosphate cyt 2e-04
COG2266177 COG2266, COG2266, GTP:adenosylcobinamide-phosphate guan 3e-04
PLN02241 436 PLN02241, PLN02241, glucose-1-phosphate adenylyltransfe 6e-04
cd02509274 cd02509, GDP-M1P_Guanylyltransferase, GDP-M1P_Guanylylt 0.001
COG0746192 COG0746, MobA, Molybdopterin-guanine dinucleotide biosy 0.002
PRK09382378 PRK09382, ispDF, bifunctional 2-C-methyl-D-erythritol 4 0.002
cd02507216 cd02507, eIF-2B_gamma_N_like, The N-terminal of eIF-2B_ 2e-11
cd02524253 cd02524, G1P_cytidylyltransferase, G1P_cytidylyltransfe 8e-09
COG4750231 COG4750, LicC, CTP:phosphocholine cytidylyltransferase 3e-08
KOG1461 673 KOG1461, KOG1461, KOG1461, Translation initiation facto 6e-08
TIGR02623254 TIGR02623, G1P_cyt_trans, glucose-1-phosphate cytidylyl 3e-07
cd04197217 cd04197, eIF-2B_epsilon_N, The N-terminal domain of eps 1e-05
cd04183231 cd04183, GT2_BcE_like, GT2_BcbE_like is likely involved 3e-05
COG2068199 COG2068, COG2068, Uncharacterized MobA-related protein 1e-04
PRK14353 446 PRK14353, glmU, bifunctional N-acetylglucosamine-1-phos 8e-04
cd02508200 cd02508, ADP_Glucose_PP, ADP-glucose pyrophosphorylase 4e-09
TIGR00453217 TIGR00453, ispD, 2-C-methyl-D-erythritol 4-phosphate cy 3e-07
cd04182186 cd04182, GT_2_like_f, GT_2_like_f is a subfamily of the 4e-05
TIGR00454183 TIGR00454, TIGR00454, conserved hypothetical protein TI 0.002
TIGR03310188 TIGR03310, matur_ygfJ, molybdenum hydroxylase accessory 0.003
>gnl|CDD|130274 TIGR01207, rmlA, glucose-1-phosphate thymidylyltransferase, short form Back     alignment and domain information
>gnl|CDD|31402 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|185377 PRK15480, PRK15480, glucose-1-phosphate thymidylyltransferase RfbA; Provisional Back     alignment and domain information
>gnl|CDD|144176 pfam00483, NTP_transferase, Nucleotidyl transferase Back     alignment and domain information
>gnl|CDD|133032 cd04189, G1P_TT_long, G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>gnl|CDD|162250 TIGR01208, rmlA_long, glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>gnl|CDD|133024 cd04181, NTP_transferase, NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>gnl|CDD|31401 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|31403 COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|133048 cd06426, NTP_transferase_like_2, NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family Back     alignment and domain information
>gnl|CDD|133021 cd02541, UGPase_prokaryotic, Prokaryotic UGPase catalyses the synthesis of UDP-glucose Back     alignment and domain information
>gnl|CDD|36536 KOG1322, KOG1322, KOG1322, GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>gnl|CDD|162203 TIGR01099, galU, UTP-glucose-1-phosphate uridylyltransferase Back     alignment and domain information
>gnl|CDD|133065 cd06915, NTP_transferase_WcbM_like, WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>gnl|CDD|133044 cd06422, NTP_transferase_like_1, NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>gnl|CDD|133014 cd02523, PC_cytidylyltransferase, Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline Back     alignment and domain information
>gnl|CDD|133050 cd06428, M1P_guanylylT_A_like_N, N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
>gnl|CDD|172834 PRK14358, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|179997 PRK05293, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|31406 COG1213, COG1213, Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|133019 cd02538, G1P_TT_short, G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>gnl|CDD|133047 cd06425, M1P_guanylylT_B_like_N, N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
>gnl|CDD|30797 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|162696 TIGR02091, glgC, glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>gnl|CDD|184021 PRK13389, PRK13389, UTP--glucose-1-phosphate uridylyltransferase subunit GalU; Provisional Back     alignment and domain information
>gnl|CDD|133020 cd02540, GT2_GlmU_N_bac, N-terminal domain of bacterial GlmU Back     alignment and domain information
>gnl|CDD|36673 KOG1460, KOG1460, KOG1460, GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis, Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|172831 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|182252 PRK10122, PRK10122, GalU regulator GalF; Provisional Back     alignment and domain information
>gnl|CDD|130175 TIGR01105, galF, UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit Back     alignment and domain information
>gnl|CDD|31400 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|179099 PRK00725, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184644 PRK14357, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|162697 TIGR02092, glgD, glucose-1-phosphate adenylyltransferase, GlgD subunit Back     alignment and domain information
>gnl|CDD|179140 PRK00844, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|162235 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|133041 cd04198, eIF-2B_gamma_N, The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>gnl|CDD|36675 KOG1462, KOG1462, KOG1462, Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|133009 cd02516, CDP-ME_synthetase, CDP-ME synthetase is involved in mevalonate-independent isoprenoid production Back     alignment and domain information
>gnl|CDD|179486 PRK02862, glgC, glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|31404 COG1211, IspD, 4-diphosphocytidyl-2-methyl-D-erithritol synthase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|178905 PRK00155, ispD, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|32447 COG2266, COG2266, GTP:adenosylcobinamide-phosphate guanylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|177884 PLN02241, PLN02241, glucose-1-phosphate adenylyltransferase Back     alignment and domain information
>gnl|CDD|133003 cd02509, GDP-M1P_Guanylyltransferase, GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose Back     alignment and domain information
>gnl|CDD|31089 COG0746, MobA, Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|181813 PRK09382, ispDF, bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional Back     alignment and domain information
>gnl|CDD|133001 cd02507, eIF-2B_gamma_N_like, The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity Back     alignment and domain information
>gnl|CDD|133015 cd02524, G1P_cytidylyltransferase, G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose Back     alignment and domain information
>gnl|CDD|34365 COG4750, LicC, CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|36674 KOG1461, KOG1461, KOG1461, Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|131672 TIGR02623, G1P_cyt_trans, glucose-1-phosphate cytidylyltransferase Back     alignment and domain information
>gnl|CDD|133040 cd04197, eIF-2B_epsilon_N, The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>gnl|CDD|133026 cd04183, GT2_BcE_like, GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule Back     alignment and domain information
>gnl|CDD|32251 COG2068, COG2068, Uncharacterized MobA-related protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|184642 PRK14353, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133002 cd02508, ADP_Glucose_PP, ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch Back     alignment and domain information
>gnl|CDD|129545 TIGR00453, ispD, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information
>gnl|CDD|133025 cd04182, GT_2_like_f, GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function Back     alignment and domain information
>gnl|CDD|129546 TIGR00454, TIGR00454, conserved hypothetical protein TIGR00454 Back     alignment and domain information
>gnl|CDD|163213 TIGR03310, matur_ygfJ, molybdenum hydroxylase accessory protein, YgfJ family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 292 glucose-1-phosphate thymidylyltransferase [Candidatus L
COG1209286 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biog 100.0
TIGR01207286 rmlA glucose-1-phosphate thymidylyltransferase; InterPr 100.0
cd02518233 GT2_SpsF SpsF is a glycosyltrnasferase implicated in th 98.55
TIGR01208361 rmlA_long glucose-1-phosphate thymidylyltransferase; In 100.0
cd02538240 G1P_TT_short G1P_TT_short is the short form of glucose- 100.0
PRK10122297 UTP--glucose-1-phosphate uridylyltransferase subunit Ga 100.0
PRK13389302 UTP--glucose-1-phosphate uridylyltransferase subunit Ga 100.0
TIGR01099270 galU UTP-glucose-1-phosphate uridylyltransferase; Inter 100.0
pfam00483247 NTP_transferase Nucleotidyl transferase. This family in 100.0
cd04189236 G1P_TT_long G1P_TT_long represents the long form of glu 100.0
cd02541267 UGPase_prokaryotic Prokaryotic UGPase catalyses the syn 100.0
cd06425233 M1P_guanylylT_B_like_N N-terminal domain of the M1P-gua 100.0
cd06428257 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanyly 100.0
PRK05293381 glgC glucose-1-phosphate adenylyltransferase; Provision 100.0
TIGR02091421 glgC glucose-1-phosphate adenylyltransferase; InterPro: 100.0
cd06915223 NTP_transferase_WcbM_like WcbM_like is a subfamily of n 100.0
COG1210291 GalU UDP-glucose pyrophosphorylase [Cell envelope bioge 100.0
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase inv 100.0
cd04181217 NTP_transferase NTP_transferases catalyze the transfer 100.0
cd06422221 NTP_transferase_like_1 NTP_transferase_like_1 is a memb 100.0
cd06426220 NTP_transferase_like_2 NTP_trnasferase_like_2 is a memb 100.0
cd02540229 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU. The 100.0
PRK03282406 consensus 100.0
PRK00844409 glgC glucose-1-phosphate adenylyltransferase; Provision 100.0
cd02524253 G1P_cytidylyltransferase G1P_cytidylyltransferase catal 100.0
KOG1322371 consensus 100.0
PRK04928405 consensus 100.0
PRK00725431 glgC glucose-1-phosphate adenylyltransferase; Provision 100.0
PRK03701431 consensus 100.0
PRK01884435 consensus 100.0
PRK02862 429 glgC glucose-1-phosphate adenylyltransferase; Provision 100.0
cd04183231 GT2_BcE_like GT2_BcbE_like is likely involved in the bi 100.0
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transp 100.0
PRK09451 456 glmU bifunctional N-acetylglucosamine-1-phosphate uridy 100.0
cd02523229 PC_cytidylyltransferase Phosphocholine cytidylyltransfe 100.0
TIGR01173 461 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPr 100.0
cd02508200 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involve 100.0
COG1207 460 GlmU N-acetylglucosamine-1-phosphate uridyltransferase 100.0
TIGR02623256 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase; 99.97
TIGR01105297 galF regulatory protein GalF; InterPro: IPR005774 This 99.97
KOG1460407 consensus 99.96
COG1213239 Predicted sugar nucleotidyltransferases [Cell envelope 99.94
cd02509274 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase 99.94
COG0836333 {ManC} Mannose-1-phosphate guanylyltransferase [Cell en 99.84
TIGR02092383 glgD glucose-1-phosphate adenylyltransferase, GlgD subu 99.82
KOG1462433 consensus 99.79
pfam01128221 IspD Uncharacterized protein family UPF0007. 99.62
TIGR03310188 matur_ygfJ molybdenum hydroxylase accessory protein, Yg 99.58
PRK00155228 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 99.54
TIGR00453226 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 99.53
cd04182186 GT_2_like_f GT_2_like_f is a subfamily of the glycosylt 99.51
cd02516218 CDP-ME_synthetase CDP-ME synthetase is involved in meva 99.47
COG2266177 GTP:adenosylcobinamide-phosphate guanylyltransferase [C 99.44
PRK13385238 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferas 99.42
PRK13368238 3-deoxy-manno-octulosonate cytidylyltransferase; Provis 99.41
COG1211230 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synthase 99.37
TIGR03202190 pucB xanthine dehydrogenase accessory protein pucB. In 99.35
PRK05450248 3-deoxy-manno-octulosonate cytidylyltransferase; Provis 99.34
PRK00317193 mobA molybdopterin-guanine dinucleotide biosynthesis pr 99.34
cd02517239 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the act 99.34
COG2068199 Uncharacterized MobA-related protein [General function 99.29
PRK09382 382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate 99.15
PRK00560196 molybdopterin-guanine dinucleotide biosynthesis protein 99.02
COG1212247 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cel 98.8
TIGR01479 478 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose 98.79
COG1083228 NeuA CMP-N-acetylneuraminic acid synthetase [Cell envel 98.61
cd02513223 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acety 98.51
TIGR03584222 PseF pseudaminic acid CMP-transferase. The sequences in 98.3
TIGR00466246 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase; 98.07
cd06442224 DPM1_like DPM1_like represents putative enzymes similar 92.75
cd04188211 DPG_synthase DPG_synthase is involved in protein N-link 92.34
cd04198214 eIF-2B_gamma_N The N-terminal domain of gamma subunit o 100.0
KOG1461 673 consensus 99.52
TIGR00454204 TIGR00454 conserved hypothetical protein TIGR00454; Int 99.38
cd02503181 MobA MobA catalyzes the formation of molybdopterin guan 99.09
COG0746192 MobA Molybdopterin-guanine dinucleotide biosynthesis pr 99.01
PRK02726200 molybdopterin-guanine dinucleotide biosynthesis protein 98.92
TIGR02665202 molyb_mobA molybdopterin-guanine dinucleotide biosynthe 98.56
cd04180266 UGPase_euk_like Eukaryotic UGPase-like includes UDPase 98.21
cd00761156 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A 97.73
COG1861241 SpsF Spore coat polysaccharide biosynthesis protein F, 97.72
cd00897300 UGPase_euk Eukaryotic UGPase catalyses the synthesis of 97.34
cd04184202 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like proteins 95.16
pfam00535168 Glycos_transf_2 Glycosyl transferase family 2. Diverse 94.66
cd06433202 GT_2_WfgS_like WfgS and WfeV are involved in O-antigen 93.9
cd04195201 GT2_AmsE_like GT2_AmsE_like is involved in exopolysacch 91.21
cd04197217 eIF-2B_epsilon_N The N-terminal domain of epsilon subun 99.98
cd02507216 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma_like 99.97
COG4750231 LicC CTP:phosphocholine cytidylyltransferase involved i 99.87
pfam02348197 CTP_transf_3 Cytidylyltransferase. This family consists 98.96
cd04193323 UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catalayzes 98.6
PTZ00339499 UDP-N-acetylglucosamine pyrophosphorylase; Provisional 98.44
COG4284472 UDP-glucose pyrophosphorylase [Carbohydrate transport a 97.7
cd04187181 DPM1_like_bac Bacterial DPM1_like enzymes are related t 90.31
cd06424315 UGGPase UGGPase catalyzes the synthesis of UDP-Glucose/ 98.04
KOG2388477 consensus 96.52
pfam01704416 UDPGP UTP--glucose-1-phosphate uridylyltransferase. Thi 95.58
PRK00576178 molybdopterin-guanine dinucleotide biosynthesis protein 92.61
cd02526237 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl transfe 94.05
>COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01207 rmlA glucose-1-phosphate thymidylyltransferase; InterPro: IPR005907 Synonym: dTDP-D-glucose synthase This group of proteins comprises a tightly conserved but broadly distributed subfamily (here designated as short form) of known and putative bacterial glucose-1-phosphate thymidylyltransferases (2 Back     alignment and domain information
>cd02518 GT2_SpsF SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylyltransferase; InterPro: IPR005908 Synonym: dTDP-D-glucose synthase This group of proteins comprises a tightly conserved but broadly distributed subfamily of known and putative bacterial glucose-1-phosphate thymidylyltransferases (2 Back     alignment and domain information
>cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>PRK10122 UTP--glucose-1-phosphate uridylyltransferase subunit GalF; Provisional Back     alignment and domain information
>PRK13389 UTP--glucose-1-phosphate uridylyltransferase subunit GalU; Provisional Back     alignment and domain information
>TIGR01099 galU UTP-glucose-1-phosphate uridylyltransferase; InterPro: IPR005771 Uridine 5'-triphosphate:glucose-1-phosphate uridylyltransferase (uridine diphosphoglucose pyrophosphorylase, 2 Back     alignment and domain information
>pfam00483 NTP_transferase Nucleotidyl transferase Back     alignment and domain information
>cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose Back     alignment and domain information
>cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
>cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase; InterPro: IPR011831 This enzyme, glucose-1-phosphate adenylyltransferase, is also called ADP-glucose pyrophosphorylase Back     alignment and domain information
>cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>COG1210 GalU UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family Back     alignment and domain information
>cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU Back     alignment and domain information
>PRK03282 consensus Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose Back     alignment and domain information
>KOG1322 consensus Back     alignment and domain information
>PRK04928 consensus Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK03701 consensus Back     alignment and domain information
>PRK01884 consensus Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPro: IPR005882 N-Acetylglucosamine-1-PO(4) uridyltransferase (GlmU, 2 Back     alignment and domain information
>cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02623 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase; InterPro: IPR013446 Glucose-1-phosphate cytidylyltransferases, also known as CDP-glucose pyrophosphorylase, are the product of the rfbF gene and produce CDP-D-glucose Back     alignment and domain information
>TIGR01105 galF regulatory protein GalF; InterPro: IPR005774 This family of proteins, GalF, represents a non-catalytic subunit of the UTP-glucose pyrophosphorylase modulating the enzyme activity to increase the formation of UDP-glucose Back     alignment and domain information
>KOG1460 consensus Back     alignment and domain information
>COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose Back     alignment and domain information
>COG0836 {ManC} Mannose-1-phosphate guanylyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit; InterPro: IPR011832 This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, IPR011831 from INTERPRO) in a subset of bacteria that use GlgC for glycogen biosynthesis Back     alignment and domain information
>KOG1462 consensus Back     alignment and domain information
>pfam01128 IspD Uncharacterized protein family UPF0007 Back     alignment and domain information
>TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family Back     alignment and domain information
>PRK00155 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed Back     alignment and domain information
>TIGR00453 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; InterPro: IPR001228 The bacterial ispD protein catalyzes the third step of the deoxyxylulose-5-phosphate pathway (DXP) of isoprenoid biosynthesis; the formation of 4-diphosphocytidyl-2C-methyl-D-erythritol from CTP and 2C-methyl-D-erythritol 4-phosphate Back     alignment and domain information
>cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function Back     alignment and domain information
>cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production Back     alignment and domain information
>COG2266 GTP:adenosylcobinamide-phosphate guanylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional Back     alignment and domain information
>PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>COG1211 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synthase [Lipid metabolism] Back     alignment and domain information
>TIGR03202 pucB xanthine dehydrogenase accessory protein pucB Back     alignment and domain information
>PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein A; Reviewed Back     alignment and domain information
>cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide Back     alignment and domain information
>COG2068 Uncharacterized MobA-related protein [General function prediction only] Back     alignment and domain information
>PRK09382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional Back     alignment and domain information
>PRK00560 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>COG1212 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01479 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase; InterPro: IPR006375 This enzyme is known to be bifunctional, as both mannose-6-phosphate isomerase (5 Back     alignment and domain information
>COG1083 NeuA CMP-N-acetylneuraminic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd02513 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety Back     alignment and domain information
>TIGR03584 PseF pseudaminic acid CMP-transferase Back     alignment and domain information
>TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase; InterPro: IPR004528 3-Deoxy-D-manno-octulosonate cytidylyltransferase (2 Back     alignment and domain information
>cd06442 DPM1_like DPM1_like represents putative enzymes similar to eukaryotic DPM1 Back     alignment and domain information
>cd04188 DPG_synthase DPG_synthase is involved in protein N-linked glycosylation Back     alignment and domain information
>cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>KOG1461 consensus Back     alignment and domain information
>TIGR00454 TIGR00454 conserved hypothetical protein TIGR00454; InterPro: IPR005245 This entry describes a family of conserved hypothetical proteins with no known function Back     alignment and domain information
>cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide Back     alignment and domain information
>COG0746 MobA Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism] Back     alignment and domain information
>PRK02726 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A; InterPro: IPR013482 In many molybdopterin-containing enzymes, including nitrate reductase and dimethylsulphoxide reductase, the cofactor is molybdopterin-guanine dinucleotide Back     alignment and domain information
>cd04180 UGPase_euk_like Eukaryotic UGPase-like includes UDPase and UDPGlcNAc pyrophosphorylase enzymes Back     alignment and domain information
>cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>COG1861 SpsF Spore coat polysaccharide biosynthesis protein F, CMP-KDO synthetase homolog [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd00897 UGPase_euk Eukaryotic UGPase catalyses the synthesis of UDP-Glucose Back     alignment and domain information
>cd04184 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis Back     alignment and domain information
>pfam00535 Glycos_transf_2 Glycosyl transferase family 2 Back     alignment and domain information
>cd06433 GT_2_WfgS_like WfgS and WfeV are involved in O-antigen biosynthesis Back     alignment and domain information
>cd04195 GT2_AmsE_like GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis Back     alignment and domain information
>cd04197 eIF-2B_epsilon_N The N-terminal domain of epsilon subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>cd02507 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity Back     alignment and domain information
>COG4750 LicC CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam02348 CTP_transf_3 Cytidylyltransferase Back     alignment and domain information
>cd04193 UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catalayzes the synthesis of UDPGlcNAc Back     alignment and domain information
>PTZ00339 UDP-N-acetylglucosamine pyrophosphorylase; Provisional Back     alignment and domain information
>COG4284 UDP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd04187 DPM1_like_bac Bacterial DPM1_like enzymes are related to eukaryotic DPM1 Back     alignment and domain information
>cd06424 UGGPase UGGPase catalyzes the synthesis of UDP-Glucose/UDP-Galactose Back     alignment and domain information
>KOG2388 consensus Back     alignment and domain information
>pfam01704 UDPGP UTP--glucose-1-phosphate uridylyltransferase Back     alignment and domain information
>PRK00576 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>cd02526 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl transferase Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target292 glucose-1-phosphate thymidylyltransferase [Candidatus L
3pkp_A292 Q83s Variant Of S. Enterica Rmla With Datp Length = 4e-55
3pkq_A292 Q83d Variant Of S. Enterica Rmla With Dgtp Length = 4e-55
1fxo_A293 The Structural Basis Of The Catalytic Mechanism And 6e-55
1lvw_A295 Crystal Structure Of Glucose-1-Phosphate Thymidylyl 6e-55
1h5t_A293 Thymidylyltransferase Complexed With Thymidylyldiph 6e-54
1h5s_D293 Thymidylyltransferase Complexed With Tmp Length = 2 6e-54
1h5s_A293 Thymidylyltransferase Complexed With Tmp Length = 2 1e-53
1h5r_B293 Thymidylyltransferase Complexed With Thimidine And 1e-53
1mp3_A292 L89t Variant Of S. Enterica Rmla Length = 292 4e-53
1iim_A292 Thymidylyltransferase Complexed With Ttp Length = 2 5e-53
1mp5_A292 Y177f Variant Of S. Enterica Rmla Length = 292 5e-53
1mp4_A292 W224h Variant Of S. Enterica Rmla Length = 292 8e-53
1g23_A293 The Structural Basis Of The Catalytic Mechanism And 1e-52
1mc3_A296 Crystal Structure Of Rffh Length = 296 7e-52
1jyk_A254 Catalytic Mechanism Of Ctp:phosphocholine Cytidylyt 9e-19
2e3d_A302 Crystal Structure Of E. Coli Glucose-1-Phosphate Ur 1e-18
1jyl_A254 Catalytic Mechanism Of Ctp:phosphocholine Cytidylyt 2e-18
3hl3_A269 2.76 Angstrom Crystal Structure Of A Putative Gluco 2e-17
1tzf_A259 X-Ray Crystal Structure Of Alpha-D-Glucose-1-Phosph 8e-17
2ggo_A 401 Crystal Structure Of Glucose-1-Phosphate Thymidylyl 1e-16
2ux8_A297 Crystal Structure Of Sphingomonas Elodea Atcc 31461 1e-15
3fww_A 456 The Crystal Structure Of The Bifunctional N-Acetylg 2e-14
2v0h_A 456 Characterization Of Substrate Binding And Catalysis 8e-13
1hv9_A 456 Structure Of E. Coli Glmu: Analysis Of Pyrophosphor 2e-10
1fwy_A331 Crystal Structure Of N-Acetylglucosamine 1-Phosphat 2e-10
2pa4_A323 Crystal Structure Of Udp-Glucose Pyrophosphorylase 5e-10
3juj_A281 The Crystal Structure Of Apo- Udp-Glucose Pyrophosp 2e-14
3brk_X420 Crystal Structure Of Adp-Glucose Pyrophosphorylase 2e-12
>gi|317455451|pdb|3PKP|A Chain A, Q83s Variant Of S. Enterica Rmla With Datp Length = 292 Back     alignment and structure
 Score =  219 bits (557), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 154/287 (53%), Positives = 205/287 (71%)

Query: 2   KGIVLAGGSGTRLRPLTDLLSKQMLPIYNKPMIYYPVSTLMDAGIREILIISTPRDLPVL 61
           KGI+LAGGSGTRL P+T  +SKQ+LPIY+KPMIYYP+STLM AGIR+ILIISTP+D P  
Sbjct: 5   KGIILAGGSGTRLYPVTMAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPQDTPRF 64

Query: 62  KEFLGSGEKWGVQFSYIEQLVPAGLAQSYILGAEFIGDSSSVLILGDNVFYGSDISDIFH 121
           ++ LG G +WG+   Y     P GLAQ++I+G EFIG     L+LGDN+FYG D+  +  
Sbjct: 65  QQLLGDGSQWGLNLQYKVSPSPDGLAQAFIIGEEFIGHDDCALVLGDNIFYGHDLPKLME 124

Query: 122 KARARRNSATVVGCHVQNPQRYGVVEVDSSNQAISIEEKPNNPKSSFAVTGIYFYDQEVV 181
            A  + + ATV   HV +P+RYGVVE D    A+S+EEKP  PKS++AVTG+YFYD  VV
Sbjct: 125 AAVNKESGATVFAYHVNDPERYGVVEFDQKGTAVSLEEKPLQPKSNYAVTGLYFYDNSVV 184

Query: 182 NIARNIRPSARGELEITDVNSYYLDKGLLAVEFLREGSAWFDAGTPESLLDTAVFVRNIE 241
            +A+N++PSARGELEITD+N  Y+++G L+V  +  G AW D GT +SL++ + F+  IE
Sbjct: 185 EMAKNLKPSARGELEITDINRIYMEQGRLSVAMMGRGYAWLDTGTHQSLIEASNFIATIE 244

Query: 242 NRLGLYVACPEEIAYRHDFINESQFFQLIDHFGNSPYGLYLRQVVEK 288
            R GL V+CPEEIA+R +FIN  Q  +L      + YG YL ++V+ 
Sbjct: 245 ERQGLKVSCPEEIAFRKNFINAQQVIELAGPLSKNDYGKYLLKMVKG 291


>gi|317455459|pdb|3PKQ|A Chain A, Q83d Variant Of S. Enterica Rmla With Dgtp Length = 292 Back     alignment and structure
gi|12084194|pdb|1FXO|A Chain A, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Tmp Complex. Length = 293 Back     alignment and structure
>gi|34810937|pdb|1LVW|A Chain A, Crystal Structure Of Glucose-1-Phosphate Thymidylyltransferase, Rmla, Complex With Dtdp Length = 295 Back     alignment and structure
gi|17942749|pdb|1H5T|A Chain A, Thymidylyltransferase Complexed With Thymidylyldiphosphate- Glucose Length = 293 Back     alignment and structure
>gi|17942756|pdb|1H5S|D Chain D, Thymidylyltransferase Complexed With Tmp Length = 293 Back     alignment and structure
>gi|17942753|pdb|1H5S|A Chain A, Thymidylyltransferase Complexed With Tmp Length = 293 Back     alignment and structure
>gi|17942758|pdb|1H5R|B Chain B, Thymidylyltransferase Complexed With Thimidine And Glucose- 1-Phospate Length = 293 Back     alignment and structure
>gi|24987782|pdb|1MP3|A Chain A, L89t Variant Of S. Enterica Rmla Length = 292 Back     alignment and structure
>gi|14277974|pdb|1IIM|A Chain A, Thymidylyltransferase Complexed With Ttp Length = 292 Back     alignment and structure
>gi|24987786|pdb|1MP5|A Chain A, Y177f Variant Of S. Enterica Rmla Length = 292 Back     alignment and structure
>gi|24987784|pdb|1MP4|A Chain A, W224h Variant Of S. Enterica Rmla Length = 292 Back     alignment and structure
>gi|12084242|pdb|1G23|A Chain A, The Structural Basis Of The Catalytic Mechanism And Regulation Of Glucose-1-Phosphate Thymidylyltransferase (Rmla). Glucose-1-Phosphate Complex. Length = 293 Back     alignment and structure
>gi|27065634|pdb|1MC3|A Chain A, Crystal Structure Of Rffh Length = 296 Back     alignment and structure
>gi|20150595|pdb|1JYK|A Chain A, Catalytic Mechanism Of Ctp:phosphocholine Cytidylytransferase From Streptococcus Pneumoniae (Licc) Length = 254 Back     alignment and structure
gi|122920109|pdb|2E3D|A Chain A, Crystal Structure Of E. Coli Glucose-1-Phosphate Uridylyltransferase Length = 302 Back     alignment and structure
>gi|20150596|pdb|1JYL|A Chain A, Catalytic Mechanism Of Ctp:phosphocholine Cytidylytransferase From Streptococcus Pneumoniae (Licc) Length = 254 Back     alignment and structure
>gi|239782171|pdb|3HL3|A Chain A, 2.76 Angstrom Crystal Structure Of A Putative Glucose-1- Phosphate Thymidylyltransferase From Bacillus Anthracis In Complex With A Sucrose Length = 269 Back     alignment and structure
>gi|55670083|pdb|1TZF|A Chain A, X-Ray Crystal Structure Of Alpha-D-Glucose-1-Phosphate Cytidylyltransferase From Salmonella Typhi Length = 259 Back     alignment and structure
gi|145579381|pdb|2GGO|A Chain A, Crystal Structure Of Glucose-1-Phosphate Thymidylyltransferase From Sulfolobus Tokodaii Length = 401 Back     alignment and structure
>gi|149243828|pdb|2UX8|A Chain A, Crystal Structure Of Sphingomonas Elodea Atcc 31461 Glucose- 1-Phosphate Uridylyltransferase In Complex With Glucose-1- Phosphate. Length = 297 Back     alignment and structure
gi|225734164|pdb|3FWW|A Chain A, The Crystal Structure Of The Bifunctional N-Acetylglucosamine-1- Phosphate UridyltransferaseGLUCOSAMINE-1-Phosphate Acetyltransferase From Yersinia Pestis Co92 Length = 456 Back     alignment and structure
gi|165761161|pdb|2V0H|A Chain A, Characterization Of Substrate Binding And Catalysis Of The Potential Antibacterial Target N-Acetylglucosamine-1- Phosphate Uridyltransferase (Glmu) Length = 456 Back     alignment and structure
gi|13399862|pdb|1HV9|A Chain A, Structure Of E. Coli Glmu: Analysis Of Pyrophosphorylase And Acetyltransferase Active Sites Length = 456 Back     alignment and structure
>gi|11514554|pdb|1FWY|A Chain A, Crystal Structure Of N-Acetylglucosamine 1-Phosphate Uridyltransferase Bound To Udp-Glcnac Length = 331 Back     alignment and structure
>gi|146387696|pdb|2PA4|A Chain A, Crystal Structure Of Udp-Glucose Pyrophosphorylase From Corynebacteria Glutamicum In Complex With Magnesium And Udp-Glucose Length = 323 Back     alignment and structure
>gi|292659656|pdb|3JUJ|A Chain A, The Crystal Structure Of Apo- Udp-Glucose Pyrophosphorylase Length = 281 Back     alignment and structure
>gi|185177849|pdb|3BRK|X Chain X, Crystal Structure Of Adp-Glucose Pyrophosphorylase From Agrobacterium Tumefaciens Length = 420 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target292 glucose-1-phosphate thymidylyltransferase [Candidatus L
1mc3_A296 Glucose-1-phosphate thymidylyltransferase; glucose-1-ph 1e-113
1lvw_A295 Glucose-1-phosphate thymidylyltransferase; protein nucl 6e-98
1fxo_A293 Glucose-1-phosphate thymidylyltransferase; rhamnose, nu 5e-78
1yp2_A 451 Glucose-1-phosphate adenylyltransferase small subunit; 7e-26
3juk_A281 UDP-glucose pyrophosphorylase (GALU); transfer; HET: UP 7e-54
3hl3_A269 Glucose-1-phosphate thymidylyltransferase; IDP01254, su 1e-53
2ggo_A 401 401AA long hypothetical glucose-1-phosphate thymidylylt 9e-40
2ux8_A297 Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyr 1e-38
2e3d_A302 UTP--glucose-1-phosphate uridylyltransferase; UDP-gluco 2e-38
2pa4_A323 UTP-glucose-1-phosphate uridylyltransferase; phosphoryl 8e-36
1jyk_A254 LICC protein, CTP:phosphocholine cytidylytransferase; 3 3e-35
2x65_A336 Mannose-1-phosphate guanylyltransferase; GDP-mannose bi 4e-34
1tzf_A259 Glucose-1-phosphate cytidylyltransferase; nucleotidyltr 2e-21
2vsh_A236 TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltran 6e-13
2dpw_A232 Hypothetical protein TTHA0179; transferase, structural 2e-11
1ezi_A228 CMP-N-acetylneuraminic acid synthetase; homodimer, alph 9e-09
1e5k_A201 Molybdopterin-guanine dinucleotide biosynthesis protein 2e-07
3dk5_A 495 Bifunctional protein GLMU; acetyltransferase, pyrophosp 2e-28
3brk_X420 Glucose-1-phosphate adenylyltransferase; ADP-glucose py 9e-21
2qh5_A308 PMI, ALGA, mannose-6-phosphate isomerase; structural ge 3e-18
2wee_A197 MOBA-related protein; unknown function; 1.65A {Mycobact 4e-09
2cu2_A337 Putative mannose-1-phosphate guanylyl transferase; mann 9e-09
3okr_A231 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; TB s 1e-08
2v0h_A 456 Bifunctional protein GLMU; cell WALL, magnesium, cell s 3e-25
1hv9_A 456 UDP-N-acetylglucosamine pyrophosphorylase; LEFT-handed 4e-24
1hm9_A 468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe 4e-23
3f1c_A246 Putative 2-C-methyl-D-erythritol 4-phosphate cytidylylt 7e-10
1i52_A236 4-diphosphocytidyl-2-C-methylerythritol synthase; cytid 5e-06
2waw_A199 MOBA relate protein; unknown function; HET: PGE; 1.60A 3e-07
3d5n_A197 Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, 3e-06
1vgw_A231 4-diphosphocytidyl-2C-methyl-D-erythritol synthase; str 1e-05
3oam_A252 3-deoxy-manno-octulosonate cytidylyltransferase; center 0.002
1w77_A228 2C-methyl-D-erythritol 4-phosphate cytidylyltransferase 4e-07
1vpa_A234 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferas 1e-06
1w55_A371 ISPD/ISPF bifunctional enzyme; biosynthetic pathway, is 2e-05
2px7_A236 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferas 2e-05
3ngw_A208 Molybdopterin-guanine dinucleotide biosynthesis P (MOBA 2e-04
>1mc3_A Glucose-1-phosphate thymidylyltransferase; glucose-1-phosphate thymidylytransferase, RFFH; HET: TTP; 2.60A {Escherichia coli} SCOP: c.68.1.6 Length = 296 Back     alignment and structure
 Score =  402 bits (1035), Expect = e-113
 Identities = 146/291 (50%), Positives = 198/291 (68%)

Query: 1   MKGIVLAGGSGTRLRPLTDLLSKQMLPIYNKPMIYYPVSTLMDAGIREILIISTPRDLPV 60
           MKGI+LAGGSGTRL P+T  +SKQ+LPIY+KPMIYYP+S LM AGIREILII+TP D   
Sbjct: 4   MKGIILAGGSGTRLHPITRGVSKQLLPIYDKPMIYYPLSVLMLAGIREILIITTPEDKGY 63

Query: 61  LKEFLGSGEKWGVQFSYIEQLVPAGLAQSYILGAEFIGDSSSVLILGDNVFYGSDISDIF 120
            +  LG G ++G+Q  Y EQ  P GLAQ++I+G  F+    S L+LGDN+F+G   S   
Sbjct: 64  FQRLLGDGSEFGIQLEYAEQPSPDGLAQAFIIGETFLNGEPSCLVLGDNIFFGQGFSPKL 123

Query: 121 HKARARRNSATVVGCHVQNPQRYGVVEVDSSNQAISIEEKPNNPKSSFAVTGIYFYDQEV 180
               AR   ATV G  V +P+R+GVVE D + +AIS+EEKP  PKS++AVTG+YFYD +V
Sbjct: 124 RHVAARTEGATVFGYQVMDPERFGVVEFDDNFRAISLEEKPKQPKSNWAVTGLYFYDSKV 183

Query: 181 VNIARNIRPSARGELEITDVNSYYLDKGLLAVEFLREGSAWFDAGTPESLLDTAVFVRNI 240
           V  A+ ++PS RGELEIT +N  YL+ G L VE L  G AW D GT +SL++ + FV+ +
Sbjct: 184 VEYAKQVKPSERGELEITSINQMYLEAGNLTVELLGRGFAWLDTGTHDSLIEASTFVQTV 243

Query: 241 ENRLGLYVACPEEIAYRHDFINESQFFQLIDHFGNSPYGLYLRQVVEKKKR 291
           E R G  +AC EEIA+R+ ++++    +       + YG YL +++  + R
Sbjct: 244 EKRQGFKIACLEEIAWRNGWLDDEGVKRAASSLAKTGYGQYLLELLRARPR 294


>1lvw_A Glucose-1-phosphate thymidylyltransferase; protein nucleotide complex, nucleotide binding fold, structural genomics, PSI; HET: TYD; 1.70A {Methanothermobacterthermautotrophicus} SCOP: c.68.1.6 Length = 295 Back     alignment and structure