254780923

254780923

hypothetical protein CLIBASIA_04110

GeneID in NCBI database:8209943Locus tag:CLIBASIA_04110
Protein GI in NCBI database:254780923Protein Accession:YP_003065336.1
Gene range:+(905128, 906225)Protein Length:365aa
Gene description:hypothetical protein
COG prediction:[M] Lipopolysaccharide biosynthesis protein
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-----
MPVSGCSKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWTLFYKRSKKLCYDENYVVAYGSRSGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVDCILGYRKSLSQN
ccccccccEEEEEEEcccccccccccccEEEEEEEHHHHHHHHHHHHHHHccccccccEEEEEEccccccHHHcccEEEEEHHHcccHHHHHHHHHHHHHHccccccHHHHHcccccEEEEEEEEcHHHHHHHHHHHHHccccEEEEEEEcHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHcccccccccEEEEEEcccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccccEEEccccccccccccccccccccHHHHHHHHHHcccccccccccccccEEEEEEHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHccEEcccHHHHHHHHHHHcc
cccccccccEEEEEcccccccEccccccEHEEEcHHHHHHHHHHHHHHHcccccccccEEEEEcccccccccHHHHHHHHHHHHHHccccccccccHHHHcccccccccccccccccEEEEEEEEcHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHccccccEEEEEEccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHccccEEEEcccccccccccccHHHHHHccHHHHHHHHHHccccccccccccccccEEEEcHHHHHHHHHccccHHHccccccccccHHHHHHHHHHHHHHHHcccEEEEHHHHcccccccccc
mpvsgcskgyfLFTShfkswnfysdhfnIEKVNLWGGFFFWFWTLFYKrskklcydenyvvaygsrsgkkffaQSNLYMMERELhfdgqrihhfpqllhgwespamGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMenhgrdvlpFLILLETEQLSNYDYVCKIhgkkskrkgyswwegdLWRRWLFYDLLGAPGVVFKIIRTFDthrdigmigsrayrypnkycdytcslgkNREMICTLAgrmgitfqdqkldffagtMFWVRTEaldpiknlrlsryfepkvhkaLDGEIEHAVERCFSLSVkkanfrisDVDCILGyrkslsqn
MPVSGCSKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWTLFYKRSKKLCYDENYVVAYGSRSGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKihgkkskrkgyswWEGDLWRRWLFYDLLGAPGVVFKIIRTfdthrdigmigsrayrypnkYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLsvkkanfrisdvDCILGyrkslsqn
MPVSGCSKGYFLFTSHFKSWNFYSDHFNIEKVNLwggfffwfwTLFYKRSKKLCYDENYVVAYGSRSGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQiaikakiaiVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVDCILGYRKSLSQN
*****CSKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWTLFYKRSKKLCYDENYVVAYGSRSGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWE***************IAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVDC***********
MPVSGCSKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWTLFYKRSKKLCYDENYVVAYGSRSGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVDCILGYRKSLSQN
****GCSKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWTLFYKRSKKLCYDENYVVAYGSRSGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVDCILGYRKS****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPVSGCSKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWTLFYKRSKKLCYDENYVVAYGSRSGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVDCILGYRKSLSQN
MPVSGCSKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWTLFYKRSKKLCYDENYVVAYGSRSGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVDCILGYRKSLSQN
MPVSGCSKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWTLFYKRSKKLCYDENYVVAYGSRSGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQIAIKAKIAIVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMENHGRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVDCILGYRKSLSQN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target365 hypothetical protein CLIBASIA_04110 [Candidatus Liberib
254780201394 hypothetical protein CLIBASIA_00430 [Candidatus Li 8e-74
>gi|254780201|ref|YP_003064614.1| hypothetical protein CLIBASIA_00430 [Candidatus Liberibacter asiaticus str. psy62] Length = 394 Back     alignment
 Score =  268 bits (686), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 146/356 (41%), Positives = 212/356 (59%), Gaps = 4/356 (1%)

Query: 9   GYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWT-LFYKRSKKLCYDENYVVAYGSRS 67
           GY++  S        S   + ++++++  F FW  + L + +  KL +    +  YGSR 
Sbjct: 40  GYYVLWSFSPKQRITSKDVHFQELSIFESFIFWLRSFLAFSKYSKLSFPSCRIFFYGSRK 99

Query: 68  GKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGW-ESPAMGKVMQIAIKAKIAIVVHLYY 126
            +K F + N +M    + FD ++  +  +L  GW + P+  K   + IK+KIAIVVH YY
Sbjct: 100 EQKAFLRLNRFMSNSRMPFDSEKFLYVKELFEGWNDRPSSPKKSGLTIKSKIAIVVHCYY 159

Query: 127 IDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMENHGRDVLPFLIL 186
            D WIEI+++L  L+  FDL VT+V  +   + ++LK FP+A++++MEN GRDV PFL L
Sbjct: 160 QDTWIEISHILLRLNFDFDLFVTVVEANKDFEQDVLKYFPSAQLYVMENKGRDVRPFLYL 219

Query: 187 LETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRD 246
           LE      YDY+CKIHGKKS+R+GY   EG +WRRWLF+DLLG   +  +II TF+ +  
Sbjct: 220 LELGVFDRYDYLCKIHGKKSQREGYHPIEGIIWRRWLFFDLLGFSDIAIRIINTFEQNPC 279

Query: 247 IGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMFWVRTEAL 306
           +GMIGSR YR   ++  +       R +I  LA R G   +   LDFF GTMFWV+ + L
Sbjct: 280 LGMIGSRRYRRYKRWSFFAKRSEVYRRVI-DLAKRAGFPTKRLHLDFFNGTMFWVKPKCL 338

Query: 307 DPIKNLRLSRYFEPKVHKALDGEIEHAVERCFSLSVKKANFRISDVDCILGYRKSL 362
           +P++NL L   FE +     DG +EHAVER F+ SV+   F I  VDC+  Y + L
Sbjct: 339 EPLRNLHLIGEFEEE-RNLKDGALEHAVERFFACSVRYTEFSIESVDCVAEYERLL 393

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target365 hypothetical protein CLIBASIA_04110 [Candidatus Liberib
315122651405 hypothetical protein CKC_04515 [Candidatus Liberibacter 1 1e-129
315122628399 hypothetical protein CKC_04400 [Candidatus Liberibacter 1 7e-71
254780201394 hypothetical protein CLIBASIA_00430 [Candidatus Liberib 1 7e-70
13474020386 hypothetical protein mll4799 [Mesorhizobium loti MAFF30 1 8e-45
299133415408 Rhamnan synthesis F [Afipia sp. 1NLS2] Length = 408 1 1e-34
3129624081308 lipopolysaccharide biosynthesis protein-like protein [P 1 2e-28
218455303568 WxocB [Xanthomonas oryzae pv. oryzicola] Length = 568 1 2e-28
218455307568 WxocB [Xanthomonas oryzae pv. oryzicola] Length = 568 1 9e-28
218455296568 glycosyltransferase [Xanthomonas oryzae pv. oryzicola] 1 1e-27
166713474568 hypothetical protein Xoryp_19045 [Xanthomonas oryzae pv 1 2e-27
>gi|315122651|ref|YP_004063140.1| hypothetical protein CKC_04515 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 405 Back     alignment and organism information
 Score =  465 bits (1196), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 221/357 (61%), Positives = 280/357 (78%), Gaps = 7/357 (1%)

Query: 1   MPVSGCSKGYFLFTSHFKSWNFYSDHFNIEKVNLWGGFFFWFWTLF-YKRSKKLCYDENY 59
           +PVSGC KGY LF S  ++WNF S+H  I KV+ + GFFFW  +LF +KR + L YDEN 
Sbjct: 38  LPVSGCRKGYLLFVSRRENWNFDSNHLVIRKVSFFLGFFFWIRSLFLFKRYQTLRYDENR 97

Query: 60  VVAYGSRSGKKFFAQSNLYMMERELHFDGQRIHHFPQLLHGWESPAMGKVMQIAIKAKIA 119
           ++AYGSR GKKFFA SN  M+ R + FDG++IH FP+LLHGW+SP+  K+  + I++++A
Sbjct: 98  IIAYGSRIGKKFFACSNKDMLARGVPFDGEKIHRFPRLLHGWDSPSSEKIASVKIQSRVA 157

Query: 120 IVVHLYYIDLWIEIANLLSNLSISFDLHVTLVTESASIKSEILKIFPAARIHIMENHGRD 179
           IVVH+YY DLW EIANLLS L+ SFDLH+TLVTE ASIKSEILK FP A I++MEN+GRD
Sbjct: 158 IVVHIYYADLWAEIANLLSGLNFSFDLHITLVTEIASIKSEILKRFPNAHIYVMENYGRD 217

Query: 180 VLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIR 239
           +  FL LLE  +L +YDYVCKIHGKKSKR G+ WW+GDLWRRWLF+DLLGAPG+  +II+
Sbjct: 218 IRSFLKLLEGGKLDSYDYVCKIHGKKSKRNGHVWWDGDLWRRWLFFDLLGAPGIALEIIK 277

Query: 240 TFDTHRDIGMIGSRAYRYPNKYCDYTCSLGKNREMICTLAGRMGITFQDQKLDFFAGTMF 299
           TF+ +  IGMIGSR YRY     D   SLG NRE +C +A +MG++F+D K+DFF GTMF
Sbjct: 278 TFEKYPKIGMIGSRTYRY-----DQKISLGNNREFVCAIANKMGVSFEDTKIDFFGGTMF 332

Query: 300 WVRTEALDPIKNLRLSRYFEPKVHK-ALDGEIEHAVERCFSLSVKKANFRISDVDCI 355
           WVR +ALDPIKNL L++YF+ KV    LDG +EHA+ERCFS+SV+KANF ++ VDC+
Sbjct: 333 WVRPQALDPIKNLALTQYFKSKVDMVGLDGCLEHAIERCFSISVEKANFDLAYVDCL 389


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122628|ref|YP_004063117.1| hypothetical protein CKC_04400 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 399 Back     alignment and organism information
>gi|254780201|ref|YP_003064614.1| hypothetical protein CLIBASIA_00430 [Candidatus Liberibacter asiaticus str. psy62] Length = 394 Back     alignment and organism information
>gi|13474020|ref|NP_105588.1| hypothetical protein mll4799 [Mesorhizobium loti MAFF303099] Length = 386 Back     alignment and organism information
>gi|299133415|ref|ZP_07026610.1| Rhamnan synthesis F [Afipia sp. 1NLS2] Length = 408 Back     alignment and organism information
>gi|312962408|ref|ZP_07776899.1| lipopolysaccharide biosynthesis protein-like protein [Pseudomonas fluorescens WH6] Length = 1308 Back     alignment and organism information
>gi|218455303|gb|AAX19606.2| WxocB [Xanthomonas oryzae pv. oryzicola] Length = 568 Back     alignment and organism information
>gi|218455307|gb|AAX19610.2| WxocB [Xanthomonas oryzae pv. oryzicola] Length = 568 Back     alignment and organism information
>gi|218455296|gb|AAV67426.2| glycosyltransferase [Xanthomonas oryzae pv. oryzicola] Length = 568 Back     alignment and organism information
>gi|166713474|ref|ZP_02244681.1| hypothetical protein Xoryp_19045 [Xanthomonas oryzae pv. oryzicola BLS256] Length = 568 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target365 hypothetical protein CLIBASIA_04110 [Candidatus Liberib
pfam05045498 pfam05045, RgpF, Rhamnan synthesis protein F 6e-27
COG3754595 COG3754, RgpF, Lipopolysaccharide biosynthesis protein 7e-33
>gnl|CDD|113802 pfam05045, RgpF, Rhamnan synthesis protein F Back     alignment and domain information
>gnl|CDD|33549 COG3754, RgpF, Lipopolysaccharide biosynthesis protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 365 hypothetical protein CLIBASIA_04110 [Candidatus Liberib
pfam05045498 RgpF Rhamnan synthesis protein F. This family consists 100.0
COG3754595 RgpF Lipopolysaccharide biosynthesis protein [Cell enve 100.0
cd06421234 CESA_CelA_like CESA_CelA_like are involved in the elong 97.28
cd06434235 GT2_HAS Hyaluronan synthases catalyze polymerization of 95.39
cd06439251 CESA_like_1 CESA_like_1 is a member of the cellulose sy 94.7
cd06435236 CESA_NdvC_like NdvC_like proteins in this family are pu 94.17
cd04186166 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 94.04
cd02520196 Glucosylceramide_synthase Glucosylceramide synthase cat 93.66
PRK11204 421 N-glycosyltransferase PgaC; Provisional 92.06
COG3754595 RgpF Lipopolysaccharide biosynthesis protein [Cell enve 96.57
TIGR03030 713 CelA cellulose synthase catalytic subunit (UDP-forming) 95.11
PRK05454 663 glucosyltransferase MdoH; Provisional 91.86
cd06423180 CESA_like CESA_like is the cellulose synthase superfami 91.85
>pfam05045 RgpF Rhamnan synthesis protein F Back     alignment and domain information
>COG3754 RgpF Lipopolysaccharide biosynthesis protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd06421 CESA_CelA_like CESA_CelA_like are involved in the elongation of the glucan chain of cellulose Back     alignment and domain information
>cd06434 GT2_HAS Hyaluronan synthases catalyze polymerization of hyaluronan Back     alignment and domain information
>cd06439 CESA_like_1 CESA_like_1 is a member of the cellulose synthase (CESA) superfamily Back     alignment and domain information
>cd06435 CESA_NdvC_like NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase Back     alignment and domain information
>cd04186 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd02520 Glucosylceramide_synthase Glucosylceramide synthase catalyzes the first glycosylation step of glycosphingolipid synthesis Back     alignment and domain information
>PRK11204 N-glycosyltransferase PgaC; Provisional Back     alignment and domain information
>COG3754 RgpF Lipopolysaccharide biosynthesis protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03030 CelA cellulose synthase catalytic subunit (UDP-forming) Back     alignment and domain information
>PRK05454 glucosyltransferase MdoH; Provisional Back     alignment and domain information
>cd06423 CESA_like CESA_like is the cellulose synthase superfamily Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target365 hypothetical protein CLIBASIA_04110 [Candidatus Liberib
1qg8_A255 Protein (spore coat polysaccharide biosynthesis protein 95.21
2z86_A625 Chondroitin synthase; GT-A, glycosyltransferase A, fold 93.41
>1qg8_A Protein (spore coat polysaccharide biosynthesis protein SPSA); glycosyltransferase; 1.50A {Bacillus subtilis} SCOP: c.68.1.1 PDB: 1h7q_A* 1h7l_A 1qgq_A* 1qgs_A* Back     alignment and structure
Probab=95.21  E-value=0.16  Score=28.07  Aligned_cols=115  Identities=16%  Similarity=0.267  Sum_probs=68.4

Q ss_pred             CCEEEEEEEC-CHHHHHHHHHHHHHCCC-CCCEEEEECCCHHHHHHHHHHHCC--CCEEEEECCCC-----CHHHHHHHH
Q ss_conf             7559999943-67779999999981899-831899808631799999985258--83799945667-----317899975
Q gi|254780923|r  116 AKIAIVVHLY-YIDLWIEIANLLSNLSI-SFDLHVTLVTESASIKSEILKIFP--AARIHIMENHG-----RDVLPFLIL  186 (365)
Q Consensus       116 ~KIAV~lHly-Y~DLl~Ei~~~L~~ip~-~~DL~ITt~~~~~~~~~~i~~~~~--~~~I~vv~NRG-----RDI~PfLv~  186 (365)
                      |||.|++=.| -++.+.++++-+.+-.. .++++|.-..........+.+..+  ++++...+|.|     +..+.- ..
T Consensus         1 P~vSIiip~yN~~~~l~~~l~Si~~qt~~~~eiiivdd~S~d~t~~~~~~~~~~~~i~~~~~~~~~~~~~~~n~g~~-~a   79 (255)
T 1qg8_A            1 PKVSVIMTSYNKSDYVAKSISSILSQTFSDFELFIMDDNSNEETLNVIRPFLNDNRVRFYQSDISGVKERTEKTRYA-AL   79 (255)
T ss_dssp             CCEEEEEEESSCTTTHHHHHHHHHTCSCCCEEEEEEECSCCHHHHHHHGGGGGSTTEEEEECCCCSHHHHHSSCHHH-HH
T ss_pred             CEEEEEEECCCCHHHHHHHHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHHHCCCCCHHHCCCCCCCCCCCCCCHH-HH
T ss_conf             97999995389889999999999828899859999989797318999999732011110002344320011335599-99


Q ss_pred             HCH-HHHCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEECC
Q ss_conf             064-4526868899965686767777733447899999987559999999999998628964898156
Q gi|254780923|r  187 LET-EQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSR  253 (365)
Q Consensus       187 ~~~-~~l~~YD~v~kiHTKKS~~~~~h~~~G~~WR~~Ll~~LLGs~~~V~~Il~~F~~np~lGlv~P~  253 (365)
                      .+. ....+.|+|+.+++=                     .++ +++.++.+++.|+++|++++|++.
T Consensus        80 ~N~gi~~a~g~~i~~lD~D---------------------d~~-~p~~l~~~~~~~~~~~~~~~v~~~  125 (255)
T 1qg8_A           80 INQAIEMAEGEYITYATDD---------------------NIY-MPDRLLKMVRELDTHPEKAVIYSA  125 (255)
T ss_dssp             HHHHHHHCCCSEEEEEETT---------------------EEE-CTTHHHHHHHHHHHCTTCCEEEEE
T ss_pred             HHHHHHCCCCCEEEEECCC---------------------CCC-CCCHHHHHHHHHHHCCCEEEEEEE
T ss_conf             9855431587546773266---------------------431-123799999999868981699933



>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target365 hypothetical protein CLIBASIA_04110 [Candidatus Liberib
3ckj_A_329 Putative uncharacterized protein; mycobacteria, un 94.33
1omz_A_293 Alpha-1,4-N-acetylhexosaminyltransferase EXTL2; ro 92.93
>3ckj_A (A:) Putative uncharacterized protein; mycobacteria, unknown function; HET: CIT; 1.80A {Mycobacterium paratuberculosis} PDB: 3ckn_A* 3cko_A* 3ckq_A* 3ckv_A* 3e26_A 3e25_A Back     alignment and structure
Probab=94.33  E-value=0.18  Score=28.60  Aligned_cols=178  Identities=13%  Similarity=-0.000  Sum_probs=93.2

Q ss_pred             CCCCCCCCCCCCEEEEEEECC-HHHHHHHHHHHHHCC--CCCCEEEEECC--C-HHHHHHHHHHHCCCCEEEE---ECCC
Q ss_conf             787543122475599999436-777999999998189--98318998086--3-1799999985258837999---4566
Q gi|254780923|r  106 MGKVMQIAIKAKIAIVVHLYY-IDLWIEIANLLSNLS--ISFDLHVTLVT--E-SASIKSEILKIFPAARIHI---MENH  176 (365)
Q Consensus       106 ~~~~~~~~~k~KIAV~lHlyY-~DLl~Ei~~~L~~ip--~~~DL~ITt~~--~-~~~~~~~i~~~~~~~~I~v---v~NR  176 (365)
                      .++.+.....++|+|++=.|= .+.+.++++.+.+-.  .++.++|.-+.  + ..++.++.....+...+.+   -.|.
T Consensus        38 ~~~~~~~~~~p~vsIiIp~yN~~~~l~~~l~sl~~q~~~~~~eiivvDd~S~D~t~~~~~~~~~~~~~~~~~~~~~~~~~  117 (329)
T 3ckj_A           38 VAELEAAKAGRTISVVLPALDEEDTIGSVIDSISPLVDGLVDELIVLDSGSTDDTEIRAVAAGARVVSREQALPEVPIRP  117 (329)
T ss_dssp             HHHHHHTTTTCCEEEEEEESSCTTTHHHHHHHHGGGBTTTBSEEEEEECSCCSSHHHHHHHTTCEEEEHHHHCTTSCCCC
T ss_pred             HHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHCCCCCCCCCEEEECCCCC
T ss_conf             45565333799799998268788899999999985157999689999896963489999872322235541577244300


Q ss_pred             CCHHHHHHHHHCHHHHCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCEEEEECCCCC
Q ss_conf             73178999750644526868899965686767777733447899999987559999999999998628964898156654
Q gi|254780923|r  177 GRDVLPFLILLETEQLSNYDYVCKIHGKKSKRKGYSWWEGDLWRRWLFYDLLGAPGVVFKIIRTFDTHRDIGMIGSRAYR  256 (365)
Q Consensus       177 GRDI~PfLv~~~~~~l~~YD~v~kiHTKKS~~~~~h~~~G~~WR~~Ll~~LLGs~~~V~~Il~~F~~np~lGlv~P~~~~  256 (365)
                      |.- +..-.++   ...+.|+|+.+.+=-                     .+-+++.++.++..++.+|..+++++....
T Consensus       118 g~~-~a~n~~~---~~a~~~~i~~~D~Dd---------------------~~~~p~~l~~l~~~~~~~~~~~~~~~~~~~  172 (329)
T 3ckj_A          118 GKG-EALWRSL---AASRGDIVVFVDSDL---------------------INPHPMFVPWLVGPLLTGDGVHLVKSFYRR  172 (329)
T ss_dssp             SHH-HHHHHHH---HHCCCSEEEECCTTE---------------------ESCCTTHHHHHHHHHHSCSSCCEEEEEEEC
T ss_pred             HHH-HHHHHHH---HHCCCCCEEEECCCC---------------------CCCCHHHHHHHHHHHHCCCCCCCEEEEEEE
T ss_conf             499-9999999---964746069973788---------------------889999999999999739865422013300


Q ss_pred             CCCCCCCC--CCCCHHHH--HHHHHHHHHCCCCCCCCCCCCCCEEEEEEEHHHHHHH
Q ss_conf             43333234--45410228--9999999984899873326637701477329888878
Q gi|254780923|r  257 YPNKYCDY--TCSLGKNR--EMICTLAGRMGITFQDQKLDFFAGTMFWVRTEALDPI  309 (365)
Q Consensus       257 ~~~~~~~~--~~~wg~N~--~~~~~L~~rlgi~~~~~~~~FpaGSMFW~Rp~AL~pL  309 (365)
                      ........  ...+..+.  ........... .........+.|+.+-.|.+++..+
T Consensus       173 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~r~~~~~~~  228 (329)
T 3ckj_A          173 PLNVGDAGGGAGATGGGRVTELVARPLLAAL-RPELGCILQPLGGEYAATRELLTSV  228 (329)
T ss_dssp             C---------------CHHHHHTHHHHHHHH-CGGGGGCSCTTCSCEEEEHHHHTTS
T ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHHHH-HHHCCCEEECCCCCEEEEHHHHHHC
T ss_conf             2555544554332222188999999999986-4220330015764478749999768



>1omz_A (A:) Alpha-1,4-N-acetylhexosaminyltransferase EXTL2; rossmann fold, DXD motif; HET: UD2; 2.10A {Mus musculus} Back     alignment and structure