254780924

254780924

potassium-efflux system protein

GeneID in NCBI database:8209944Locus tag:CLIBASIA_04115
Protein GI in NCBI database:254780924Protein Accession:YP_003065337.1
Gene range:+(906694, 908523)Protein Length:609aa
Gene description:potassium-efflux system protein
COG prediction:[P] Kef-type K+ transport system, predicted NAD-binding component
KEGG prediction:potassium-efflux system protein; K03455 monovalent cation:H+ antiporter-2, CPA2 family
SEED prediction:Binding-protein-dependent transport systems inner membrane component:ATP/GTP-binding site motif A (P-loop) :TrkA-N:Potassium e
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Potassium homeostasis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM10 TM-Helix
TOPPRED11 TM-Helix
HMMTOP12 TM-Helix
MEMSAT10 TM-Helix
MEMSAT_SVM12 TM-Helix
PHOBIUS12 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------61
MTTIIWGFVLAFIFGAIANRCRLPTLIGYLVAGILVGPRTPGFVASQSLVPALAEIGIILLMFGVGLHFSVKDLISVRGIALPGALIQIILGTALGALMGMVMGWSLGGSVVFGLALSIASTVVLLKALQENRILETDRGKIAVGWLIVEDLIIVLALVLIPAAATNYSAEPSSMTHPWTSFITQQMGFEVGMPGLIMITLLKVVAFIGVMLIFGRRVIPWILHMIFYTGSRELFRLGVLAIALGFAYGSSKLFGVSLSLGAFFAGMILAESELSQSAAQESLPLRDAFSVLFFISVGMMFNPDILISNPILLMMAVIIVIIGKALIAFIVVIAFGRSVATALTIAASLSQIGEFSFILANLGVELGILPDQARDLILASSIISIILNPLVFVLAEFLQSFLVLRFARVTSSTEQYSHICVEQDTKQEVPVESILEQQEVTIQKTDLCDHVILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGIDVIYGNATITKILLMANIEKARSLVVSISTAFEAAYITQEARNSNPSILIIALADSDSEVEHLTRYGADTVVMSAREIALGMLDRLNQVHHEKVTCDRSNKDEIDSKDDSSVLSVNL
cHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEcccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHcccEEEEcccccHHHHHHccHHHccEEEEEcccHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHccccEEEcHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccc
ccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHEEEccccccccccHHHHHHHHHHHHHEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHcccccHcccccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcHHHHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHccccccccccccccccccccccccEEEEEccHHHHHHHHHHHHccccEEEEEccHHHHHHHHHccccEEEccccHHHHHHHccHHHHEEEEEEcccHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcc
MTTIIWGFVLAFIFGAianrcrlpTLIGYLVAGilvgprtpgfvasqsLVPALAEIGIILLMFGVGLHFSVKDLISVRGIALPGALIQIILGTALGALMGMVMGWSLGGSVVFGLALSIASTVVLLKALQEnriletdrgkiaVGWLIVEDLIIVLALVLIPaaatnysaepssmthpwtsfitqqmgfevgmpGLIMITLLKVVAFIGVMLIFGRRVIPWILHMIFYTGSRELFRLGVLAIALGFAYGSSKLFGVSLSLGAFFAGMILAESELSQsaaqeslplrdaFSVLFFISVgmmfnpdilisnpILLMMAVIIVIIGKALIAFIVVIAFGRSVATALTIAASLSQIGEFSFILANLGVELGILPDQARDLILASSIISIILNPLVFVLAEFLQSFLVLRFarvtssteqyshicveqdtkqevpveSILEQQEVTiqktdlcdhvilvGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGIDVIYGNATITKILLMANIEKARSLVVSISTAFEAAYITQEARNSNPSILIIALAdsdsevehlTRYGADTVVMSAREIALGMLDRlnqvhhekvtcdrsnkdeidskddssvlsvnl
MTTIIWGFVLAFIFGAIANRCRLPTLIGYLVAGILVGPRTPGFVASQSLVPALAEIGIILLMFGVGLHFSVKDLISVRGIALPGALIQIILGTALGALMGMVMGWSLGGSVVFGLALSIASTVVLLKALQenriletdrgkiAVGWLIVEDLIIVLALVLIPAAATNYSAEPSSMTHPWTSFITQQMGFEVGMPGLIMITLLKVVAFIGVMLIFGRRVIPWILHMIFYTGSRELFRLGVLAIALGFAYGSSKLFGVSLSLGAFFAGMILAESELSQSAAQESLPLRDAFSVLFFISVGMMFNPDILISNPILLMMAVIIVIIGKALIAFIVVIAFGRSVATALTIAASLSQIGEFSFILANLGVELGILPDQARDLILASSIISIILNPLVFVLAEFLQSFLVLRFARVTSSTEQYSHIcveqdtkqevPVESILEQQEVTIQKTDLCDHVILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSlgidviygNATITKILLMANIEKARSLVVSISTAFEAAYITQEARNSNPSILIIALADSDSEVEHLTRYGADTVVMSAREIALGMLDRLNQVHHEkvtcdrsnkdeidskddssvlsvnl
MTTIIWGFVLAFIFGAIANRCRLPTLIGYLVAGILVGPRTPGFVASQSLVPALAEIGIILLMFGVGLHFSVKDLISVRGIALPGALIQIILGTALGALMGMVMGWSLGGSVVFGLALSIASTVVLLKALQENRILETDRGKIAVGWlivedliivlalvlipaaaTNYSAEPSSMTHPWTSFITQQMGFEVGMPGLIMITLLKVVAFIGVMLIFGRRVIPWILHMIFYTGSRELFRLGVLAIALGFAYGSSKLFGVSLSLGAFFAGMIlaeselsqsaaqeslPLRDAFSVLFFISVGMMFNPDILISNPillmmaviiviiGKALIAFIVVIAFGRSVATALTIAASLSQIGEFSFILANLGVELGILPDQARDlilassiisiilNPLVFVLAEFLQSFLVLRFARVTSSTEQYSHICVEQDTKQEVPVESILEQQEVTIQKTDLCDHVILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGIDVIYGNATITKILLMANIEKARSLVVSISTAFEAAYITQEARNSNPSILIIALADSDSEVEHLTRYGADTVVMSAREIALGMLDRLNQVHHEKVTCDRSNKDEIDSKDDSSVLSVNL
MTTIIWGFVLAFIFGAIANRCRLPTLIGYLVAGILVGPRTPGFVASQSLVPALAEIGIILLMFGVGLHFSVKDLISVRGIALPGALIQIILGTALGALMGMVMGWSLGGSVVFGLALSIASTVVLLKALQEN******RGKIAVGWLIVEDLIIVLALVLIPAAATNYSAEPSSMTHPWTSFITQQMGFEVGMPGLIMITLLKVVAFIGVMLIFGRRVIPWILHMIFYTGSRELFRLGVLAIALGFAYGSSKLFGVSLSLGAFFAGMILAESELSQSAAQESLPLRDAFSVLFFISVGMMFNPDILISNPILLMMAVIIVIIGKALIAFIVVIAFGRSVATALTIAASLSQIGEFSFILANLGVELGILPDQARDLILASSIISIILNPLVFVLAEFLQSFLVLRFARVTSS*********************************DLCDHVILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGIDVIYGNATITKILLMANIEKARSLVVSISTAFEAAYITQEARNSNPSILIIALADSDSEVEHLTRYGADTVVMSAREIALGMLDRLNQVHHEKVTCD**********DDS*******
MTTIIWGFVLAFIFGAIANRCRLPTLIGYLVAGILVGPRTPGFVASQSLVPALAEIGIILLMFGVGLHFSVKDLISVRGIALPGALIQIILGTALGALMGMVMGWSLGGSVVFGLALSIASTVVLLKALQENRILETDRGKIAVGWLIVEDLIIVLALVLIPAAATNYSAEPSSMTHPWTSFITQQMGFEVGMPGLIMITLLKVVAFIGVMLIFGRRVIPWILHMIFYTGSRELFRLGVLAIALGFAYGSSKLFGVSLSLGAFFAGMILAESELSQSAAQESLPLRDAFSVLFFISVGMMFNPDILISNPILLMMAVIIVIIGKALIAFIVVIAFGRSVATALTIAASLSQIGEFSFILANLGVELGILPDQARDLILASSIISIILNPLVFVLAEFLQSFLVLRFARVTSSTEQYSHICVEQDTKQEVPVESILEQQEVTIQKTDLCDHVILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGIDVIYGNATITKILLMANIEKARSLVVSISTAFEAAYITQEARNSNPSILIIALADSDSEVEHLTRYGADTVVMSAREIALGMLDRLNQVHHEKVTCDRSNK****************
MTTIIWGFVLAFIFGAIANRCRLPTLIGYLVAGILVGPRTPGFVASQSLVPALAEIGIILLMFGVGLHFSVKDLISVRGIALPGALIQIILGTALGALMGMVMGWSLGGSVVFGLALSIASTVVLLKALQENRILETDRGKIAVGWLIVEDLIIVLALVLIPAAATNYSAEPSSM**PWTSFITQQMGFEVGMPGLIMITLLKVVAFIGVMLIFGRRVIPWILHMIFYTGSRELFRLGVLAIALGFAYGSSKLFGVSLSLGAFFAGMILAESELSQSAAQESLPLRDAFSVLFFISVGMMFNPDILISNPILLMMAVIIVIIGKALIAFIVVIAFGRSVATALTIAASLSQIGEFSFILANLGVELGILPDQARDLILASSIISIILNPLVFVLAEFLQSFLVL*************************************IQKTDLCDHVILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGIDVIYGNATITKILLMANIEKARSLVVSISTAFEAAYITQEARNSNPSILIIALADSDSEVEHLTRYGADTVVMSAREIALGMLDRLNQVHHEKVTCDRSNKDEIDSKDDSSVLS***
oooHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
HHHHHHHHHHHHHHHHHHHHxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTIIWGFVLAFIFGAIANRCRLPTLIGYLVAGILVGPRTPGFVASQSLVPALAEIGIILLMFGVGLHFSVKDLISVRGIALPGALIQIILGTALGALMGMVMGWSLGGSVVFGLALSIASTVVLLKALQENRILETDRGKIAVGWLIVEDLIIVLALVLIPAAATNYSAEPSSMTHPWTSFITQQMGFEVGMPGLIMITLLKVVAFIGVMLIFGRRVIPWILHMIFYTGSRELFRLGVLAIALGFAYGSSKLFGVSLSLGAFFAGMILAESELSQSAAQESLPLRDAFSVLFFISVGMMFNPDILISNPILLMMAVIIVIIGKALIAFIVVIAFGRSVATALTIAASLSQIGEFSFILANLGVELGILPDQARDLILASSIISIILNPLVFVLAEFLQSFLVLRFARVTSSTEQYSHICVEQDTKQEVPVESILEQQEVTIQKTDLCDHVILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGIDVIYGNATITKILLMANIEKARSLVVSISTAFEAAYITQEARNSNPSILIIALADSDSEVEHLTRYGADTVVMSAREIALGMLDRLNQVHHEKVTCDRSNKDEIDSKDDSSVLSVNL
MTTIIWGFVLAFIFGAIANRCRLPTLIGYLVAGILVGPRTPGFVASQSLVPALAEIGIILLMFGVGLHFSVKDLISVRGIALPGALIQIILGTALGALMGMVMGWSLGGSVVFGLALSIASTVVLLKALQENRILETDRGKIAVGWLIVEDLIIVLALVLIPAAATNYSAEPSSMTHPWTSFITQQMGFEVGMPGLIMITLLKVVAFIGVMLIFGRRVIPWILHMIFYTGSRELFRLGVLAIALGFAYGSSKLFGVSLSLGAFFAGMILAESELSQSAAQESLPLRDAFSVLFFISVGMMFNPDILISNPILLMMAVIIVIIGKALIAFIVVIAFGRSVATALTIAASLSQIGEFSFILANLGVELGILPDQARDLILASSIISIILNPLVFVLAEFLQSFLVLRFARVTSSTEQYSHICVEQDTKQEVPVESILEQQEVTIQKTDLCDHVILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGIDVIYGNATITKILLMANIEKARSLVVSISTAFEAAYITQEARNSNPSILIIALADSDSEVEHLTRYGADTVVMSAREIALGMLDRLNQVHHEKVTCDRSNKDEIDSKDDSSVLSVNL
MTTIIWGFVLAFIFGAIANRCRLPTLIGYLVAGILVGPRTPGFVASQSLVPALAEIGIILLMFGVGLHFSVKDLISVRGIALPGALIQIILGTALGALMGMVMGWSLGGSVVFGLALSIASTVVLLKALQENRILETDRGKIAVGWLIVEDLIIVLALVLIPAAATNYSAEPSSMTHPWTSFITQQMGFEVGMPGLIMITLLKVVAFIGVMLIFGRRVIPWILHMIFYTGSRELFRLGVLAIALGFAYGSSKLFGVSLSLGAFFAGMILAESELSQSAAQESLPLRDAFSVLFFISVGMMFNPDILISNPILLMMAVIIVIIGKALIAFIVVIAFGRSVATALTIAASLSQIGEFSFILANLGVELGILPDQARDLILASSIISIILNPLVFVLAEFLQSFLVLRFARVTSSTEQYSHICVEQDTKQEVPVESILEQQEVTIQKTDLCDHVILVGYGRIGKVIVQNLKAAGIALLVIEDSEKKIEELRSLGIDVIYGNATITKILLMANIEKARSLVVSISTAFEAAYITQEARNSNPSILIIALADSDSEVEHLTRYGADTVVMSAREIALGMLDRLNQVHHEKVTCDRSNKDEIDSKDDSSVLSVNL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target609 potassium-efflux system protein [Candidatus Liberibacte
315122650618 potassium-efflux system protein [Candidatus Liberibacte 1 0.0
222084838617 potassium-efflux system protein [Agrobacterium radiobac 1 0.0
116250454607 transmembrane ion efflux system protein [Rhizobium legu 1 0.0
241203077606 sodium/hydrogen exchanger [Rhizobium leguminosarum bv. 1 0.0
209547900606 sodium/hydrogen exchanger [Rhizobium leguminosarum bv. 1 0.0
190890334608 cation efflux system protein [Rhizobium etli CIAT 652] 1 0.0
327191504608 putative cation efflux system protein [Rhizobium etli C 1 0.0
86356284605 putative potassium-efflux system protein [Rhizobium etl 1 0.0
182678825613 sodium/hydrogen exchanger [Beijerinckia indica subsp. i 1 1e-169
312114986611 potassium efflux system protein [Rhodomicrobium vanniel 1 1e-168
>gi|315122650|ref|YP_004063139.1| potassium-efflux system protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 618 Back     alignment and organism information
 Score =  995 bits (2572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/607 (83%), Positives = 565/607 (93%), Gaps = 6/607 (0%)

Query: 1   MTTIIWGFVLAFIFGAIANRCRLPTLIGYLVAGILVGPRTPGFVASQSLVPALAEIGIIL 60
           MTTII GFVLAFIFGAIANRCRLPTLIGYLVAGILVGPRTPGFVASQSLVPALAEIGIIL
Sbjct: 8   MTTIIGGFVLAFIFGAIANRCRLPTLIGYLVAGILVGPRTPGFVASQSLVPALAEIGIIL 67

Query: 61  LMFGVGLHFSVKDLISVRGIALPGALIQIILGTALGALMGMVMGWSLGGSVVFGLALSIA 120
           LMFGVGLHFSVKDL+SVRGIA PGA+IQI+L T LGALMG+V+GWSLGGS+VFGLALSIA
Sbjct: 68  LMFGVGLHFSVKDLLSVRGIAFPGAIIQIVLSTVLGALMGIVVGWSLGGSIVFGLALSIA 127

Query: 121 STVVLLKALQENRILETDRGKIAVGWLIVEDLIIVLALVLIPAAATNYSAEPSSMTHPWT 180
           STVVLLKALQENRILETDRGKIAVGWLIVEDL+IVLALV IPAAA++YS   SS  +P +
Sbjct: 128 STVVLLKALQENRILETDRGKIAVGWLIVEDLVIVLALVFIPAAASSYSL-GSSAANPLS 186

Query: 181 SFITQQMGFEVGMPGLIMITLLKVVAFIGVMLIFGRRVIPWILHMIFYTGSRELFRLGVL 240
           SF++Q +GF++G+PGLI+ITLLKVVAFIGVML+FGRRVIPWILHMIFYTGSRELFRLGVL
Sbjct: 187 SFVSQCVGFDIGIPGLIIITLLKVVAFIGVMLVFGRRVIPWILHMIFYTGSRELFRLGVL 246

Query: 241 AIALGFAYGSSKLFGVSLSLGAFFAGMILAESELSQSAAQESLPLRDAFSVLFFISVGMM 300
           AIALGFAYGSS+LFGVSLSLGAFFAGMILAESELSQSAAQESLPLRDAFSVLFFISVGMM
Sbjct: 247 AIALGFAYGSSQLFGVSLSLGAFFAGMILAESELSQSAAQESLPLRDAFSVLFFISVGMM 306

Query: 301 FNPDILISNPILLMMAVIIVIIGKALIAFIVVIAFGRSVATALTIAASLSQIGEFSFILA 360
           FNPD+LISNPILL+M+VI+V+ GK+LIAF+VVIAFGRSVATALTIAASLSQIGEFSFILA
Sbjct: 307 FNPDVLISNPILLIMSVIVVVFGKSLIAFMVVIAFGRSVATALTIAASLSQIGEFSFILA 366

Query: 361 NLGVELGILPDQARDLILASSIISIILNPLVFVLAEFLQSFLVLRFARVTSST----EQY 416
            LGVELGILPD+ARDLI+ASSIISIILNPL+F+LAE LQS ++ R +++   T    E  
Sbjct: 367 ALGVELGILPDRARDLIVASSIISIILNPLIFILAESLQSIIIFRCSKLLRKTSGCMESD 426

Query: 417 SHICVEQDTKQEVPVESILEQQEVTIQKTDLCDHVILVGYGRIGKVIVQNLKAAGIALLV 476
           +H C+EQD ++EV +ES+LEQ+EV +QKTDLCDHV+LVGYG IGK+IVQNLKAAGI++LV
Sbjct: 427 AHTCIEQDVQEEVLMESVLEQKEVDLQKTDLCDHVVLVGYGHIGKIIVQNLKAAGISILV 486

Query: 477 IEDSEKKIEELRSLGIDVIYGNATITKILLMANIEKARSLVVSISTAFEAAYITQEARNS 536
           IEDSEK+IEELRSL IDVIYGNAT+T++L MANIEKARSLVVSISTAFEAAYITQEARN+
Sbjct: 487 IEDSEKRIEELRSLEIDVIYGNATLTEVLSMANIEKARSLVVSISTAFEAAYITQEARNA 546

Query: 537 NPSILIIALADSDSEVEHLTRYGADTVVMSAREIALGMLDRLNQVHHEKVTCDR-SNKDE 595
           NPS+LIIALA S+SE+EHLTRYGADTVVMSAREIA GMLDRLNQVHHE VT ++ S+KD 
Sbjct: 547 NPSVLIIALAGSESEIEHLTRYGADTVVMSAREIAFGMLDRLNQVHHETVTYNKGSSKDN 606

Query: 596 IDSKDDS 602
           ID KD S
Sbjct: 607 IDLKDQS 613


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084838|ref|YP_002543367.1| potassium-efflux system protein [Agrobacterium radiobacter K84] Length = 617 Back     alignment and organism information
>gi|116250454|ref|YP_766292.1| transmembrane ion efflux system protein [Rhizobium leguminosarum bv. viciae 3841] Length = 607 Back     alignment and organism information
>gi|241203077|ref|YP_002974173.1| sodium/hydrogen exchanger [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 606 Back     alignment and organism information
>gi|209547900|ref|YP_002279817.1| sodium/hydrogen exchanger [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 606 Back     alignment and organism information
>gi|190890334|ref|YP_001976876.1| cation efflux system protein [Rhizobium etli CIAT 652] Length = 608 Back     alignment and organism information
>gi|327191504|gb|EGE58520.1| putative cation efflux system protein [Rhizobium etli CNPAF512] Length = 608 Back     alignment and organism information
>gi|86356284|ref|YP_468176.1| putative potassium-efflux system protein [Rhizobium etli CFN 42] Length = 605 Back     alignment and organism information
>gi|182678825|ref|YP_001832971.1| sodium/hydrogen exchanger [Beijerinckia indica subsp. indica ATCC 9039] Length = 613 Back     alignment and organism information
>gi|312114986|ref|YP_004012582.1| potassium efflux system protein [Rhodomicrobium vannielii ATCC 17100] Length = 611 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target609 potassium-efflux system protein [Candidatus Liberibacte
PRK10669558 PRK10669, PRK10669, putative cation:proton antiport pro 1e-163
PRK03659601 PRK03659, PRK03659, glutathione-regulated potassium-eff 4e-48
PRK03562621 PRK03562, PRK03562, glutathione-regulated potassium-eff 1e-43
TIGR00932273 TIGR00932, 2a37, transporter, monovalent cation:proton 6e-49
pfam00999371 pfam00999, Na_H_Exchanger, Sodium/hydrogen exchanger fa 7e-48
COG0475397 COG0475, KefB, Kef-type K+ transport systems, membrane 8e-39
KOG1650 769 KOG1650, KOG1650, KOG1650, Predicted K+/H+-antiporter [ 2e-12
PLN03159 832 PLN03159, PLN03159, cation/H(+) antiporter 15; Provisio 3e-07
COG4651408 COG4651, RosB, Kef-type K+ transport system, predicted 1e-124
pfam02254115 pfam02254, TrkA_N, TrkA-N domain 2e-20
COG1226212 COG1226, Kch, Kef-type K+ transport systems, predicted 4e-12
COG0569225 COG0569, TrkA, K+ transport systems, NAD-binding compon 5e-10
>gnl|CDD|182633 PRK10669, PRK10669, putative cation:proton antiport protein; Provisional Back     alignment and domain information
>gnl|CDD|179625 PRK03659, PRK03659, glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>gnl|CDD|179594 PRK03562, PRK03562, glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>gnl|CDD|162117 TIGR00932, 2a37, transporter, monovalent cation:proton antiporter-2 (CPA2) family Back     alignment and domain information
>gnl|CDD|144551 pfam00999, Na_H_Exchanger, Sodium/hydrogen exchanger family Back     alignment and domain information
>gnl|CDD|30823 COG0475, KefB, Kef-type K+ transport systems, membrane components [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|36863 KOG1650, KOG1650, KOG1650, Predicted K+/H+-antiporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|178704 PLN03159, PLN03159, cation/H(+) antiporter 15; Provisional Back     alignment and domain information
>gnl|CDD|34270 COG4651, RosB, Kef-type K+ transport system, predicted NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|145418 pfam02254, TrkA_N, TrkA-N domain Back     alignment and domain information
>gnl|CDD|31419 COG1226, Kch, Kef-type K+ transport systems, predicted NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|30915 COG0569, TrkA, K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 609 potassium-efflux system protein [Candidatus Liberibacte
PRK10669558 putative cation:proton antiport protein; Provisional 100.0
PRK03659602 glutathione-regulated potassium-efflux system protein K 100.0
PRK03562615 glutathione-regulated potassium-efflux system protein K 100.0
COG0475397 KefB Kef-type K+ transport systems, membrane components 100.0
COG4651408 RosB Kef-type K+ transport system, predicted NAD-bindin 100.0
pfam00999371 Na_H_Exchanger Sodium/hydrogen exchanger family. Na/H a 100.0
PRK05326563 potassium/proton antiporter; Reviewed 100.0
KOG1650 769 consensus 100.0
COG3263574 NhaP-type Na+/H+ and K+/H+ antiporters with a unique C- 99.96
TIGR00840627 b_cpa1 sodium/hydrogen exchanger 3; InterPro: IPR004709 99.28
pfam05684379 DUF819 Protein of unknown function (DUF819). This famil 98.03
COG0385319 Predicted Na+-dependent transporter [General function p 94.19
TIGR00932314 2a37 transporter, monovalent cation:proton antiporter-2 100.0
TIGR00831541 a_cpa1 Na+/H+ antiporter; InterPro: IPR004705 Na^+/H^+ 99.75
PRK10537356 voltage-gated potassium channel; Provisional 99.97
pfam02254115 TrkA_N TrkA-N domain. This domain is found in a wide va 99.92
COG1226212 Kch Kef-type K+ transport systems, predicted NAD-bindin 99.71
CHL00194 319 ycf39 Ycf39; Provisional 98.33
COG1748 389 LYS9 Saccharopine dehydrogenase and related proteins [A 98.19
pfam03435 384 Saccharop_dh Saccharopine dehydrogenase. This family co 98.16
PRK08306296 dipicolinate synthase subunit A; Reviewed 98.08
pfam03446163 NAD_binding_2 NAD binding domain of 6-phosphogluconate 98.01
PRK09599 301 6-phosphogluconate dehydrogenase-like protein; Reviewed 97.96
PRK12490 298 6-phosphogluconate dehydrogenase-like protein; Reviewed 97.93
PRK11559 295 garR tartronate semialdehyde reductase; Provisional 97.9
PRK06522 307 2-dehydropantoate 2-reductase; Reviewed 97.89
pfam02558150 ApbA Ketopantoate reductase PanE/ApbA. This is a family 97.71
pfam00670162 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD 97.69
TIGR02964270 xanthine_xdhC xanthine dehydrogenase accessory protein 97.64
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 97.63
pfam10727111 Rossmann-like Rossmann-like domain. This family of prot 97.6
PRK05708 305 2-dehydropantoate 2-reductase; Provisional 97.58
COG1893 307 ApbA Ketopantoate reductase [Coenzyme metabolism] 97.57
COG2084 286 MmsB 3-hydroxyisobutyrate dehydrogenase and related bet 97.56
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucin 97.53
PRK10637457 cysG siroheme synthase; Provisional 97.53
TIGR00745 332 apbA_panE 2-dehydropantoate 2-reductase; InterPro: IPR0 97.43
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 97.42
COG1023 300 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohy 97.4
PRK09288 395 purT phosphoribosylglycinamide formyltransferase 2; Val 97.39
TIGR00872 341 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylati 97.28
PRK06019 377 phosphoribosylaminoimidazole carboxylase ATPase subunit 97.09
pfam01408120 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossman 97.08
PRK10693 337 response regulator of RpoS; Provisional 96.83
TIGR03649 285 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G 96.8
TIGR02632 709 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol 96.8
PTZ00082 322 L-lactate dehydrogenase; Provisional 96.74
COG2085211 Predicted dinucleotide-binding enzymes [General functio 96.51
PRK11083229 DNA-binding response regulator CreB; Provisional 96.39
PRK09468239 ompR osmolarity response regulator; Provisional 96.35
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate de 96.14
PRK00258275 aroE shikimate 5-dehydrogenase; Reviewed 96.08
PTZ00325 313 malate dehydrogenase; Provisional 96.06
TIGR01179 341 galE UDP-glucose 4-epimerase; InterPro: IPR005886 Synon 96.01
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provi 96.01
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transport an 95.95
cd01337 310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochond 95.92
pfam00208237 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine de 95.89
PRK08223 287 hypothetical protein; Validated 95.83
PRK03612516 spermidine synthase; Provisional 95.81
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of gluta 95.81
cd05292 308 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate 95.74
PRK10610129 chemotaxis regulatory protein CheY; Provisional 95.72
PRK06436303 glycerate dehydrogenase; Provisional 95.7
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimat 95.66
COG0026 375 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR sy 95.55
PRK05134233 3-demethylubiquinone-9 3-methyltransferase; Provisional 95.53
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases [Cell 95.53
COG1087 329 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, 95.46
TIGR01161 386 purK phosphoribosylaminoimidazole carboxylase, ATPase s 95.46
PRK10161229 transcriptional regulator PhoB; Provisional 95.14
PRK11173237 two-component response regulator; Provisional 95.12
PRK01581363 speE spermidine synthase; Validated 95.08
PRK11199374 tyrA bifunctional chorismate mutase/prephenate dehydrog 95.07
COG0057 335 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose 95.04
PRK10840216 transcriptional regulator RcsB; Provisional 95.04
PRK10710240 DNA-binding transcriptional regulator BaeR; Provisional 95.02
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/shikima 95.01
pfam02310121 B12-binding B12 binding domain. This domain binds to B1 94.98
PRK10403215 transcriptional regulator NarP; Provisional 94.98
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] 94.91
PRK04965378 nitric oxide reductase; Provisional 94.85
COG0458 400 CarB Carbamoylphosphate synthase large subunit (split g 94.83
pfam00289109 CPSase_L_chain Carbamoyl-phosphate synthase L chain, N- 94.8
pfam03709111 OKR_DC_1_N Orn/Lys/Arg decarboxylase, N-terminal domain 94.78
TIGR02352 357 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727 94.74
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate de 94.69
cd05290 307 LDH_3 A subgroup of L-lactate dehydrogenases. L-lactate 94.59
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Ami 94.51
PRK12549284 shikimate 5-dehydrogenase; Reviewed 94.5
PRK12480330 D-lactate dehydrogenase; Provisional 94.47
PRK00048265 dihydrodipicolinate reductase; Provisional 94.46
PRK07476323 threonine dehydratase; Provisional 94.24
PRK05086 312 malate dehydrogenase; Provisional 94.06
COG0025429 NhaP NhaP-type Na+/H+ and K+/H+ antiporters [Inorganic 99.97
TIGR00844 923 c_cpa1 sodium/hydrogen antiporter; InterPro: IPR004712 99.72
KOG1965575 consensus 99.7
KOG4505467 consensus 99.61
KOG1966670 consensus 98.55
pfam03616368 Glt_symporter Sodium/glutamate symporter. 97.93
COG0786404 GltS Na+/glutamate symporter [Amino acid transport and 97.19
PRK09496455 trkA potassium transporter peripheral membrane componen 99.95
PRK09496 455 trkA potassium transporter peripheral membrane componen 99.94
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 99.93
TIGR01771 302 L-LDH-NAD L-lactate dehydrogenase; InterPro: IPR011304 94.41
PRK09958204 DNA-binding transcriptional activator EvgA; Provisional 94.03
PRK09561388 nhaA pH-dependent sodium/proton antiporter; Reviewed 98.63
pfam06965374 Na_H_antiport_1 Na+/H+ antiporter 1. This family contai 98.31
TIGR00773415 NhaA Na+/H+ antiporter NhaA; InterPro: IPR004670 The Es 96.46
PRK12460308 2-keto-3-deoxygluconate permease; Provisional 98.45
PRK09560382 nhaA pH-dependent sodium/proton antiporter; Reviewed 98.3
pfam05368232 NmrA NmrA-like family. NmrA is a negative transcription 98.37
PRK05562222 precorrin-2 dehydrogenase; Provisional 98.05
PRK07417 280 arogenate dehydrogenase; Reviewed 97.92
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 97.89
PRK06718202 precorrin-2 dehydrogenase; Reviewed 97.79
PRK06719157 precorrin-2 dehydrogenase; Validated 97.77
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 97.7
COG1648210 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelat 97.68
PRK08507 275 prephenate dehydrogenase; Validated 97.54
COG0499420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabol 97.49
pfam01210159 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd 97.46
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 97.41
PTZ00075476 S-adenosyl-L-homocysteine hydrolase; Provisional 97.39
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycas 97.35
PRK12921 306 2-dehydropantoate 2-reductase; Provisional 97.34
COG0287 279 TyrA Prephenate dehydrogenase [Amino acid transport and 97.33
PRK00094 325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogena 97.31
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 97.31
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of gl 97.27
PRK05476427 S-adenosyl-L-homocysteine hydrolase; Provisional 97.25
pfam01488134 Shikimate_DH Shikimate / quinate 5-dehydrogenase. This 97.23
PRK09880343 L-idonate 5-dehydrogenase; Provisional 97.23
pfam05221430 AdoHcyase S-adenosyl-L-homocysteine hydrolase. 97.19
PRK00045429 hemA glutamyl-tRNA reductase; Reviewed 97.18
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 97.17
COG0240 329 GpsA Glycerol-3-phosphate dehydrogenase [Energy product 97.13
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisio 97.1
TIGR00936422 ahcY adenosylhomocysteinase; InterPro: IPR000043 S-aden 97.06
pfam0380793 F420_oxidored NADP oxidoreductase coenzyme F420-depende 97.06
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-am 97.05
TIGR01035436 hemA glutamyl-tRNA reductase; InterPro: IPR000343 Tetra 97.04
PRK05808 282 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.03
PRK12439 340 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; P 97.03
PRK06483236 short chain dehydrogenase; Provisional 97.03
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General funct 97.02
PRK06035 291 3-hydroxyacyl-CoA dehydrogenase; Validated 97.02
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 97.0
PRK04207 338 glyceraldehyde-3-phosphate dehydrogenase; Provisional 96.96
PRK08293 288 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.95
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 96.95
PRK05650270 short chain dehydrogenase; Provisional 96.93
PRK06130 310 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.89
cd05293 312 LDH_1 A subgroup of L-lactate dehydrogenases. L-lactate 96.88
PRK10083339 putative dehydrogenase; Provisional 96.87
PRK05294 1063 carB carbamoyl phosphate synthase large subunit; Review 96.87
PRK08340259 glucose-1-dehydrogenase; Provisional 96.85
PRK07530 292 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.85
PRK09260 289 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.84
PRK05872 296 short chain dehydrogenase; Provisional 96.82
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 96.81
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 96.8
PRK08277278 D-mannonate oxidoreductase; Provisional 96.79
PRK06182 273 short chain dehydrogenase; Validated 96.79
PRK07024256 short chain dehydrogenase; Provisional 96.75
PRK07819 284 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.75
PRK06129 308 3-hydroxyacyl-CoA dehydrogenase; Validated 96.74
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 96.74
PRK04148135 hypothetical protein; Provisional 96.73
PRK06949258 short chain dehydrogenase; Provisional 96.73
PRK09117 282 consensus 96.73
PRK07660 283 consensus 96.71
PRK12491 272 pyrroline-5-carboxylate reductase; Reviewed 96.66
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA deh 96.65
PRK07041240 short chain dehydrogenase; Provisional 96.65
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 96.64
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.62
PRK05693 274 short chain dehydrogenase; Provisional 96.61
KOG1370434 consensus 96.61
PRK06057255 short chain dehydrogenase; Provisional 96.61
PRK07231250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.6
PRK05717255 oxidoreductase; Validated 96.59
PRK08324676 short chain dehydrogenase; Validated 96.58
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene tetr 96.58
PRK07831261 short chain dehydrogenase; Provisional 96.57
pfam00056142 Ldh_1_N lactate/malate dehydrogenase, NAD binding domai 96.54
PRK13940414 glutamyl-tRNA reductase; Provisional 96.53
PRK12829264 short chain dehydrogenase; Provisional 96.52
TIGR01692 290 HIBADH 3-hydroxyisobutyrate dehydrogenase; InterPro: IP 96.52
PRK08265261 short chain dehydrogenase; Provisional 96.51
COG1179263 Dinucleotide-utilizing enzymes involved in molybdopteri 96.5
PRK05866290 short chain dehydrogenase; Provisional 96.49
COG1063350 Tdh Threonine dehydrogenase and related Zn-dependent de 96.48
cd00755231 YgdL_like Family of activating enzymes (E1) of ubiquiti 96.47
PRK05867253 short chain dehydrogenase; Provisional 96.46
PRK07825273 short chain dehydrogenase; Provisional 96.42
PRK06953222 short chain dehydrogenase; Provisional 96.42
PRK07832272 short chain dehydrogenase; Provisional 96.41
pfam02826176 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogen 96.4
PRK08213259 gluconate 5-dehydrogenase; Provisional 96.4
PRK06841255 short chain dehydrogenase; Provisional 96.39
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenas 96.37
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like 96.34
COG0702 275 Predicted nucleoside-diphosphate-sugar epimerases [Cell 96.33
PRK13771332 putative alcohol dehydrogenase; Provisional 96.31
PRK06223 312 malate dehydrogenase; Reviewed 96.31
PRK11730 715 fadB multifunctional fatty acid oxidation complex subun 96.3
PRK06124259 gluconate 5-dehydrogenase; Provisional 96.28
PRK07067256 sorbitol dehydrogenase; Provisional 96.26
PRK00066 315 ldh L-lactate dehydrogenase; Reviewed 96.25
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.25
PRK09422338 alcohol dehydrogenase; Provisional 96.24
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase 96.24
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelop 96.24
PRK07774250 short chain dehydrogenase; Provisional 96.23
PRK07523251 gluconate 5-dehydrogenase; Provisional 96.21
cd05291 306 HicDH_like L-2-hydroxyisocapronate dehydrogenases and s 96.2
PRK08251248 short chain dehydrogenase; Provisional 96.2
PRK07576260 short chain dehydrogenase; Provisional 96.2
COG0686371 Ald Alanine dehydrogenase [Amino acid transport and met 96.2
COG2910211 Putative NADH-flavin reductase [General function predic 96.19
PRK08267258 short chain dehydrogenase; Provisional 96.19
PRK06463254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.18
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Revie 96.18
PRK07035252 short chain dehydrogenase; Provisional 96.18
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 96.17
PRK07680 273 late competence protein ComER; Validated 96.17
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF; InterPro: 96.16
PRK06500249 short chain dehydrogenase; Provisional 96.16
PRK12939250 short chain dehydrogenase; Provisional 96.16
PRK08085254 gluconate 5-dehydrogenase; Provisional 96.14
PRK12828239 short chain dehydrogenase; Provisional 96.13
PRK06227256 consensus 96.13
PRK06138252 short chain dehydrogenase; Provisional 96.11
PRK08177225 short chain dehydrogenase; Provisional 96.09
PRK07060245 short chain dehydrogenase; Provisional 96.09
PRK07478254 short chain dehydrogenase; Provisional 96.08
cd00300 300 LDH_like L-lactate dehydrogenase-like enzymes. Members 96.07
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 96.05
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisional 96.05
PRK08644209 thiamine biosynthesis protein ThiF; Provisional 96.04
KOG0024354 consensus 96.04
PRK06346251 consensus 96.01
PRK06172253 short chain dehydrogenase; Provisional 96.0
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 95.96
PRK10643222 DNA-binding transcriptional regulator BasR; Provisional 95.95
PRK08862227 short chain dehydrogenase; Provisional 95.95
PRK07097265 gluconate 5-dehydrogenase; Provisional 95.94
PRK09072262 short chain dehydrogenase; Provisional 95.93
PTZ00117 313 malate dehydrogenase; Provisional 95.93
TIGR03025 445 EPS_sugtrans exopolysaccharide biosynthesis polyprenyl 95.93
PRK06940 277 short chain dehydrogenase; Provisional 95.92
PRK08339263 short chain dehydrogenase; Provisional 95.92
PRK06198268 short chain dehydrogenase; Provisional 95.91
PRK09242258 tropinone reductase; Provisional 95.9
PRK07109 338 short chain dehydrogenase; Provisional 95.89
PRK08219226 short chain dehydrogenase; Provisional 95.86
PRK07479252 consensus 95.85
PRK07063259 short chain dehydrogenase; Provisional 95.83
PRK06114262 short chain dehydrogenase; Provisional 95.82
PRK09836226 DNA-binding transcriptional activator CusR; Provisional 95.79
PRK08762379 molybdopterin biosynthesis protein MoeB; Validated 95.78
PRK07775275 short chain dehydrogenase; Provisional 95.78
PRK07814263 short chain dehydrogenase; Provisional 95.78
PRK07201 663 short chain dehydrogenase; Provisional 95.77
COG0451 314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell enve 95.76
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 95.76
COG1255129 Uncharacterized protein conserved in archaea [Function 95.74
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 95.72
PRK09853 1032 putative selenate reductase subunit YgfK; Provisional 95.72
PRK05690245 molybdopterin biosynthesis protein MoeB; Provisional 95.71
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-li 95.71
pfam01370235 Epimerase NAD dependent epimerase/dehydratase family. T 95.7
PRK10538248 3-hydroxy acid dehydrogenase; Provisional 95.68
PRK09291257 short chain dehydrogenase; Provisional 95.67
PRK08643256 acetoin reductase; Validated 95.65
PRK07806248 short chain dehydrogenase; Provisional 95.65
PRK07454241 short chain dehydrogenase; Provisional 95.63
PRK09186255 flagellin modification protein A; Provisional 95.61
PRK12826253 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed 95.56
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisional 95.53
cd01339 300 LDH-like_MDH L-lactate dehydrogenase-like malate dehydr 95.53
PRK06125259 short chain dehydrogenase; Provisional 95.52
PRK06181263 short chain dehydrogenase; Provisional 95.49
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 95.48
PRK13243333 glyoxylate reductase; Reviewed 95.45
PRK11154 706 fadJ multifunctional fatty acid oxidation complex subun 95.37
COG0300265 DltE Short-chain dehydrogenases of various substrate sp 95.37
PRK12742237 oxidoreductase; Provisional 95.36
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like prot 95.36
pfam01073 280 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase 95.36
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 95.35
PRK12935247 acetoacetyl-CoA reductase; Provisional 95.34
PRK12825250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.34
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 95.33
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 95.32
PRK10124 464 putative UDP-glucose lipid carrier transferase; Provisi 95.31
COG1052324 LdhA Lactate dehydrogenase and related dehydrogenases [ 95.31
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Reviewed 95.29
PRK07102243 short chain dehydrogenase; Provisional 95.27
TIGR02817338 adh_fam_1 zinc-binding alcohol dehydrogenase family pro 95.27
COG0677436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Ce 95.26
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogena 95.26
PRK00536262 speE spermidine synthase; Provisional 95.25
PRK07890258 short chain dehydrogenase; Provisional 95.24
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisional 95.23
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisional 95.23
PRK07326235 short chain dehydrogenase; Provisional 95.19
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisional 95.18
COG0039 313 Mdh Malate/lactate dehydrogenases [Energy production an 95.18
PRK13512 438 coenzyme A disulfide reductase; Provisional 95.17
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 95.16
PRK10336219 DNA-binding transcriptional regulator QseB; Provisional 95.15
PRK07679 279 pyrroline-5-carboxylate reductase; Reviewed 95.13
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 95.11
PRK08328230 hypothetical protein; Provisional 95.09
pfam00072111 Response_reg Response regulator receiver domain. This d 95.09
PRK12746254 short chain dehydrogenase; Provisional 95.07
PRK07533254 enoyl-(acyl carrier protein) reductase; Provisional 94.96
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 94.96
PRK08628258 short chain dehydrogenase; Provisional 94.95
PRK07792 303 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 94.93
TIGR01087 476 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase; I 94.9
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-am 94.89
PRK08309182 short chain dehydrogenase; Provisional 94.88
KOG0069336 consensus 94.87
pfam02719280 Polysacc_synt_2 Polysaccharide biosynthesis protein. Th 94.87
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisional 94.85
TIGR03385 427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 94.83
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 94.83
pfam07021193 MetW Methionine biosynthesis protein MetW. This family 94.83
pfam07991165 IlvN Acetohydroxy acid isomeroreductase, catalytic doma 94.82
PRK13581 524 D-3-phosphoglycerate dehydrogenase; Provisional 94.82
TIGR01082 491 murC UDP-N-acetylmuramate--alanine ligase; InterPro: IP 94.8
PRK07666238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 94.79
PRK08263 275 short chain dehydrogenase; Provisional 94.76
PRK13403 335 ketol-acid reductoisomerase; Provisional 94.75
PRK07776252 consensus 94.75
PRK06988 313 putative formyltransferase; Provisional 94.73
pfam00389313 2-Hacid_dh D-isomer specific 2-hydroxyacid dehydrogenas 94.73
PRK08220253 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 94.71
PRK12744257 short chain dehydrogenase; Provisional 94.71
PRK07370259 enoyl-(acyl carrier protein) reductase; Validated 94.71
TIGR03023 451 WcaJ_sugtrans Undecaprenyl-phosphate glucose phosphotra 94.68
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 94.64
PRK06914 280 short chain dehydrogenase; Provisional 94.64
PRK05472211 redox-sensing transcriptional repressor Rex; Provisiona 94.59
PRK12475 337 thiamine/molybdopterin biosynthesis MoeB-like protein; 94.58
PRK06550237 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 94.57
PRK11880 267 pyrroline-5-carboxylate reductase; Reviewed 94.56
COG0345 266 ProC Pyrroline-5-carboxylate reductase [Amino acid tran 94.55
PRK06180 277 short chain dehydrogenase; Provisional 94.44
PRK01045304 ispH 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 94.44
PRK10816223 DNA-binding transcriptional regulator PhoP; Provisional 94.41
PRK06476255 pyrroline-5-carboxylate reductase; Reviewed 94.38
COG0111324 SerA Phosphoglycerate dehydrogenase and related dehydro 94.34
PRK07985294 oxidoreductase; Provisional 94.33
pfam02153 258 PDH Prephenate dehydrogenase. Members of this family ar 94.32
pfam03686127 UPF0146 Uncharacterized protein family (UPF0146). The f 94.29
cd01484234 E1-2_like Ubiquitin activating enzyme (E1), repeat 2-li 94.27
PRK08605332 D-lactate dehydrogenase; Validated 94.25
cd01493 425 APPBP1_RUB Ubiquitin activating enzyme (E1) subunit APP 94.19
PRK12550272 shikimate 5-dehydrogenase; Reviewed 94.19
PRK09009235 C factor cell-cell signaling protein; Provisional 94.19
TIGR01809291 Shik-DH-AROM shikimate-5-dehydrogenase; InterPro: IPR01 94.13
PRK12827251 short chain dehydrogenase; Provisional 94.04
TIGR01546 335 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenas 94.03
pfam03812314 KdgT 2-keto-3-deoxygluconate permease. 98.34
PRK05274305 2-keto-3-deoxygluconate permease; Provisional 97.93
pfam03601305 Cons_hypoth698 Conserved hypothetical protein 698. 98.33
COG2855334 Predicted membrane protein [Function unknown] 98.25
PRK03818552 hypothetical protein; Validated 98.15
PRK04972558 hypothetical protein; Provisional 97.74
pfam03956191 DUF340 Membrane protein of unknown function (DUF340). M 97.45
TIGR01625165 YidE_YbjL_dupl YidE/YbjL duplication; InterPro: IPR0065 96.9
TIGR03082156 Gneg_AbrB_dup membrane protein AbrB duplication. The mo 96.06
TIGR00946608 2a69 Auxin Efflux Carrier; InterPro: IPR014024 This ent 96.05
pfam06826169 Asp-Al_Ex Predicted Permease Membrane Region. This fami 96.03
COG3180352 AbrB Putative ammonia monooxygenase [General function p 94.75
PRK03659602 glutathione-regulated potassium-efflux system protein K 98.26
PRK03369487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 97.52
PRK11728400 hypothetical protein; Provisional 97.06
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 97.03
PRK06545 357 prephenate dehydrogenase; Validated 96.92
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.83
PRK09126392 hypothetical protein; Provisional 96.81
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 96.81
PRK08268503 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.81
PRK07364413 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 96.8
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 96.76
PRK06185409 hypothetical protein; Provisional 96.63
pfam00899134 ThiF ThiF family. This family contains a repeated domai 96.58
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validated 96.57
KOG1298 509 consensus 96.4
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.38
PRK07494386 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 96.36
TIGR02356210 adenyl_thiF thiazole biosynthesis adenylyltransferase T 96.33
PRK11749460 putative oxidoreductase; Provisional 96.31
pfam01494349 FAD_binding_3 FAD binding domain. This domain is involv 96.22
PRK07608389 hypothetical protein; Provisional 96.21
PRK08774402 consensus 96.2
PRK08013400 hypothetical protein; Provisional 96.16
PRK05868372 hypothetical protein; Validated 95.96
PRK10365 441 transcriptional regulatory protein ZraR; Provisional 95.89
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 95.88
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 95.82
PRK07045388 putative monooxygenase; Reviewed 95.81
cd01483143 E1_enzyme_family Superfamily of activating enzymes (E1) 95.71
COG0579 429 Predicted dehydrogenase [General function prediction on 95.6
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 95.56
PRK10157 428 putative oxidoreductase FixC; Provisional 95.55
PRK12409410 D-amino acid dehydrogenase small subunit; Provisional 95.55
KOG0409 327 consensus 95.42
PRK13984 604 putative oxidoreductase; Provisional 95.38
pfam0007082 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 95.37
PRK10015 429 hypothetical protein; Provisional 95.33
PRK06753373 hypothetical protein; Provisional 95.31
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 95.09
PRK06484 530 short chain dehydrogenase; Validated 94.98
PRK01747 660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 94.89
PRK12814 652 putative NADPH-dependent glutamate synthase small subun 94.88
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisional 94.84
PRK00711416 D-amino acid dehydrogenase small subunit; Validated 94.83
PRK11361 457 acetoacetate metabolism regulatory protein AtoC; Provis 94.73
pfam01266309 DAO FAD dependent oxidoreductase. This family includes 94.52
PRK08948392 consensus 94.51
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Reviewed 94.42
KOG2304 298 consensus 94.41
PRK12770 350 putative glutamate synthase subunit beta; Provisional 94.21
PRK05976 464 dihydrolipoamide dehydrogenase; Validated 94.02
PRK03562615 glutathione-regulated potassium-efflux system protein K 98.18
PRK10669558 putative cation:proton antiport protein; Provisional 97.9
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.48
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 94.61
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequences 97.72
PRK08017256 short chain dehydrogenase; Provisional 97.03
PRK10675 338 UDP-galactose-4-epimerase; Provisional 96.98
PRK05993 277 short chain dehydrogenase; Provisional 96.95
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; Review 96.94
PRK05884223 short chain dehydrogenase; Provisional 96.73
COG0654 387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and relat 96.49
PRK08945245 short chain dehydrogenase; Provisional 96.42
PRK05855582 short chain dehydrogenase; Validated 96.24
PRK06720169 hypothetical protein; Provisional 96.13
PRK06194 301 hypothetical protein; Provisional 96.1
PRK06101241 short chain dehydrogenase; Provisional 95.99
PRK06484530 short chain dehydrogenase; Validated 95.89
TIGR02032 343 GG-red-SF geranylgeranyl reductase family; InterPro: IP 95.78
COG0644 396 FixC Dehydrogenases (flavoproteins) [Energy production 95.36
KOG1201300 consensus 95.31
PRK06139 324 short chain dehydrogenase; Provisional 95.3
PRK05876 275 short chain dehydrogenase; Provisional 95.23
PRK08642254 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.12
PRK08594256 enoyl-(acyl carrier protein) reductase; Provisional 94.94
TIGR01988 445 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/Ub 94.94
KOG1430 361 consensus 94.74
PRK06196 316 oxidoreductase; Provisional 94.7
PRK06197 306 short chain dehydrogenase; Provisional 94.33
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 94.15
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisional 94.15
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 94.14
PRK07856254 short chain dehydrogenase; Provisional 94.08
COG0475397 KefB Kef-type K+ transport systems, membrane components 97.69
TIGR00946608 2a69 Auxin Efflux Carrier; InterPro: IPR014024 This ent 96.56
COG3004390 NhaA Na+/H+ antiporter [Inorganic ion transport and met 97.61
PRK02006501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 97.56
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ce 96.55
PRK07588391 hypothetical protein; Provisional 95.8
PRK07236386 hypothetical protein; Provisional 95.36
PRK07208474 hypothetical protein; Provisional 95.12
PRK07538413 hypothetical protein; Provisional 94.34
TIGR02853288 spore_dpaA dipicolinic acid synthetase, A subunit; Inte 97.53
PRK00141476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 97.49
PRK11101545 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; P 95.49
pfam04321284 RmlD_sub_bind RmlD substrate binding domain. L-rhamnose 94.81
pfam06408471 consensus 94.47
PTZ00142474 6-phosphogluconate dehydrogenase; Provisional 97.41
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; Review 97.28
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 97.27
PRK05294 1063 carB carbamoyl phosphate synthase large subunit; Review 97.05
KOG0370 1435 consensus 94.88
PRK06834488 hypothetical protein; Provisional 96.89
PRK08244494 hypothetical protein; Provisional 96.87
PRK06184503 hypothetical protein; Provisional 96.81
PRK06183554 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validat 96.7
PRK06126545 hypothetical protein; Provisional 96.7
PRK07190480 hypothetical protein; Provisional 96.57
COG2431297 Predicted membrane protein [Function unknown] 96.03
PRK08132549 hypothetical protein; Provisional 96.87
PRK08294634 phenol 2-monooxygenase; Provisional 96.56
pfam03616368 Glt_symporter Sodium/glutamate symporter. 96.06
TIGR00932314 2a37 transporter, monovalent cation:proton antiporter-2 96.52
PRK08655441 prephenate dehydrogenase; Provisional 96.51
pfam01758188 SBF Sodium Bile acid symporter family. This family cons 96.33
pfam03601305 Cons_hypoth698 Conserved hypothetical protein 698. 96.19
COG2855334 Predicted membrane protein [Function unknown] 96.17
COG2985544 Predicted permease [General function prediction only] 95.67
KOG1650769 consensus 94.13
PRK13856241 two-component response regulator VirG; Provisional 95.32
PRK09935210 transcriptional regulator FimZ; Provisional 94.63
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>COG0475 KefB Kef-type K+ transport systems, membrane components [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4651 RosB Kef-type K+ transport system, predicted NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam00999 Na_H_Exchanger Sodium/hydrogen exchanger family Back     alignment and domain information
>PRK05326 potassium/proton antiporter; Reviewed Back     alignment and domain information
>KOG1650 consensus Back     alignment and domain information
>COG3263 NhaP-type Na+/H+ and K+/H+ antiporters with a unique C-terminal domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00840 b_cpa1 sodium/hydrogen exchanger 3; InterPro: IPR004709 Na^+/H^+ exchange proteins eject protons from cells, effectively eliminating excess acid from actively metabolising cells Back     alignment and domain information
>pfam05684 DUF819 Protein of unknown function (DUF819) Back     alignment and domain information
>COG0385 Predicted Na+-dependent transporter [General function prediction only] Back     alignment and domain information
>TIGR00932 2a37 transporter, monovalent cation:proton antiporter-2 (CPA2) family; InterPro: IPR004771 Na^+/H^+ exchange proteins eject protons from cells, effectively eliminating excess acid from actively metabolising cells Back     alignment and domain information
>TIGR00831 a_cpa1 Na+/H+ antiporter; InterPro: IPR004705 Na^+/H^+ exchange proteins eject protons from cells, effectively eliminating excess acid from actively metabolising cells Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>pfam02254 TrkA_N TrkA-N domain Back     alignment and domain information
>COG1226 Kch Kef-type K+ transport systems, predicted NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>pfam03435 Saccharop_dh Saccharopine dehydrogenase Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>pfam03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>pfam02558 ApbA Ketopantoate reductase PanE/ApbA Back     alignment and domain information
>pfam00670 AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD binding domain Back     alignment and domain information
>TIGR02964 xanthine_xdhC xanthine dehydrogenase accessory protein XdhC; InterPro: IPR014308 Members of this protein are the accessory protein XdhC, found in baceria, that is responsible for insertion of the molybdenum cofactor into the xanthine dehydrogenase large chain, XdhB Back     alignment and domain information
>pfam03721 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain Back     alignment and domain information
>pfam10727 Rossmann-like Rossmann-like domain Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG1893 ApbA Ketopantoate reductase [Coenzyme metabolism] Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK10637 cysG siroheme synthase; Provisional Back     alignment and domain information
>TIGR00745 apbA_panE 2-dehydropantoate 2-reductase; InterPro: IPR003710 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG1023 Gnd Predicted 6-phosphogluconate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating); InterPro: IPR004849 This family resembles a larger family of bacterial and eukaryotic 6-phosphogluconate dehydrogenases (Gnd) but differs from it by a deep split in a UPGMA similarity clustering tree and the lack of a central region of about 140 residues Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>pfam01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold Back     alignment and domain information
>PRK10693 response regulator of RpoS; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase; InterPro: IPR013454 Rhamnose is a methyl-pentose sugar which is found as a constituent of pectin within the cell walls of dicotyledonous plants and has also been found in the mucilage of a number of legume plants Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PRK11083 DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>PRK09468 ompR osmolarity response regulator; Provisional Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose 4-epimerase; InterPro: IPR005886 Synonym: UDP-galactose 4-epimerase UDP-glucose 4-epimerase (5 Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>pfam00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK10610 chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional Back     alignment and domain information