254780925

254780925

bifunctional preprotein translocase subunit SecD/SecF

GeneID in NCBI database:8209945Locus tag:CLIBASIA_04120
Protein GI in NCBI database:254780925Protein Accession:YP_003065338.1
Gene range:+(908699, 911200)Protein Length:833aa
Gene description:bifunctional preprotein translocase subunit SecD/SecF
COG prediction:[U] Preprotein translocase subunit SecD
KEGG prediction:bifunctional preprotein translocase subunit SecD/SecF; K12257 SecD/SecF fusion protein
SEED prediction:Protein-export membrane protein SecD (TC 3.A.5.1.1) / Protein-export membrane protein SecF (TC 3.A.5.1.1)
Pathway involved in KEGG:Protein export [PATH:las03060]
Bacterial secretion system [PATH:las03070]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM12 TM-Helix
TOPPRED8 TM-Helix
HMMTOP12 TM-Helix
MEMSAT8 TM-Helix
MEMSAT_SVM11 TM-Helix
PHOBIUS13 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830---
MRNNPWLVILYSMICCIGLLIALPNFLPQSMLDRFPSAMPKNRISLGLDLRGGSHLVLEVDEDDFVNGFLQMYSDELRSFLKKEGIGVFSMRQIQNKITLSFADSRFKENIADKVTLFLQGVNSKLNVDPKKNLLVTTTEKEISIVLSQNNIDQVISHAIEQSMEIIRQRIDQIGISESTIQRLGSHRILIQLPGEQDPSRLRQLLGTTAKMSFHKVLPNNSKKGFMFGVRFLRDSDGNQYLVEDKVEISGIHLNGATANFDPKTHKPVVDISFDEMGARRFFEVTRDNIGKPLAVVLDGRVLTAPVINQAIPSGKAQISGNFTIETAGILAAMLRAGSLPIKLNIVEERNVGADLGSDSIYKGTCAIVAGLVLIVLFMIVLYGKWGLVADFSIFLNVILTLALLSLLGATLTLPSIAGIVLGIGLAVDSNILVNERIREENRKNQSVFCSLDMGFSRAYSTIFDSNITALIATVVLFFFGGGAVRGFAITMGLSILISMFTAISIVRAMMIFIIRYKKMKSIDINPLSRFFLIPDCIAIQFMRARFWGVGISILFSICSICLLFTHGLNYGIDFKGGIQLGVLANRPVDLSVVRSNLESLQIGDISFQNFDGEKNFLVRLQYQPGDSVAQTRVLEMVKKKITEIVPLSTIQNTEIVGPKISRELIRKGIVGVIISAIAMLIYIWIRFKWYFALGAITTLILDITKTLGFFALFGIEFNLTAVAAVLTLIGYSVNDKVVVYDRMRKNMKLYTTSISFRDLIDKSINETLGRSVYTSMAAFISVLPMAVWGGSVIGSFAIPMAFGIVVAASSSIFIAAPILLFIYDWRAKNARI
ccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccccccEEEEEEccHHHHHHHHHHHHHHHHHHHHHHcccccccEEccccEEEEEEcccccHHHHHHHHHHHHHHHccccccccccccEEEccccEEEEEEcHHHHHHccHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEcccccHHHHHHHHccccEEEEEEcccccccccccccccccccccccEEEEccccEEEccEEEEcccccccccccEEEEEEEcHHHHHHHHHHHHHHHcccEEEEEccccccccEEEEEcccccEEEEccccHHHHHHHHHHHHcccccccEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccEEEEEHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEcccccHHHHHHHHHHccccccEEEEEccccEEEEEEEccccccHHHHHHHHHHHHHHcccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEcHHHHHHHHHHHHHHHcccEEEEHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
cccHHHHHHHHHHHHHHHHHHHccccccHHHcHHHHHHHcccccEEcEEcccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccEEEEEEccHHHHHHHHHHHHHHHccccccccccccccEEEEccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEccccEEEEEEcccccHHHHHHHHHcccEEEEEEccccccHHHcccccEEEcccccccEEEEEEEEEcccccccccccccccccccEEEEEEcccccHHHHHHHHccccccEEEEEcccEEEccEEccccccccEEEEccccHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEcccEEEEEEEcccccHHHHHHHHHHccccccEEEEccccccEEEEEEccccccHHHHHHHHHHHHHHcccccccccccccEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHEcHHHHHHHHHHHHccccccEEEEHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
MRNNPWLVILYSMICCIGLLialpnflpqsmldrfpsampknrislgldlrggshlvlevdeddFVNGFLQMYSDELRSFLKKEGIGVFSMRQIQNKITLSFADSRFKENIADKVTLFLQGVnsklnvdpkknllVTTTEKEISIVLSQNNIDQVISHAIEQSMEIIRQRIDQIGISESTIQRLGSHRiliqlpgeqdpsRLRQLLGTtakmsfhkvlpnnskkgfmFGVRflrdsdgnqylvedkveisgihlngatanfdpkthkpvvdisfdemgARRFFEVTrdnigkplaVVLDgrvltapvinqaipsgkaqisgnfTIETAGILAAMLRAgslpiklniveernvgadlgsdsiykGTCAIVAGLVLIVLFMIVLYGKWGLVADFSIFLNVILTLALLSLLGATLTLPSIAGIVLGIGLavdsnilvneRIREENRKNQSVFCSLDMGFSRAYSTIFDSNITALIATVVLFFFGGGAVRGFAITMGLSILISMFTAISIVRAMMIFIIRYKkmksidinplsrfflipdCIAIQFMRARFWGVGISILFSICSICLLFthglnygidfkggiqlgvlanrpvdLSVVRSNleslqigdisfqnfdgeKNFLVRLqyqpgdsvaQTRVLEMVKKKITEivplstiqnteivgpkISRELIRKGIVGVIISAIAMLIYIWIRFKWYFALGAITTLILDITKTLGFFALFGIEFNLTAVAAVLTLIGYSVNDKVVVYDRMRKNMKLYTTSISFRDLIDKSINETLGRSVYTSMAAFISVLPMavwggsvigsfaIPMAFGIVVAASSSIFIAAPILLFIYDWRAKNARI
MRNNPWLVILYSMICCIGLLIALPNFLPQSMLDRFPSAMPKNRISLGLDLRGGSHLVLEVDEDDFVNGFLQMYSDELRSFLKKEGIGVFSMRQIQNKITLSFADSRFKENIADKVTLFLqgvnsklnvdpkknlLVTTTEKEISIVLSQNNIDQVISHAIEQSMEIIRQRIDQIGISESTIQRLGSHRILiqlpgeqdpSRLRQLLGTTAKMsfhkvlpnnskkGFMFGVRFLRDSDGNQYLVEDKVEISGIHLngatanfdpkthkPVVDISFDEMGARRFFEVTRDNIGKPLAVVLDGRVLTAPVINqaipsgkaqisgNFTIETAGILAAMLRAGSLPIKLNIVEERNVGADLGSDSIYKGTCAIVAGLVLIVLFMIVLYGKWGLVADFSIFLNVILTLALLSLLGATLTLPSIAGIVLGIGLAVDSNILVNerireenrknqsvFCSLDMGFSRAYSTIFDSNITALIATVVLFFFGGGAVRGFAITMGLSILISMFTAISIVRAMMIFIIRYKKMKSIDINPLSRFFLIPDCIAIQFMRARFWGVGISILFSICSICLLFTHGLNYGIDFKGGIQLGVLANRPVDLSVVRSNLESLQIGDISFQNFDGEKNFLVRLQYQPGDSVAQTRVLEMVKKKIteivplstiqnteivgpkisRELIRKGIVGVIISAIAMLIYIWIRFKWYFALGAITTLILDITKTLGFFALFGIEFNLTAVAAVLTLIGYSVNDKVVVYDRMRKNMKLyttsisfrdliDKSINETLGRSVYTSMAAFISVLPMAVWGGSVIGSFAIPMAFGIVVAASSSIFIAAPILLFIYDWRAKNARI
MRNNPWLVILYSMICCIGLLIALPNFLPQSMLDRFPSAMPKNRISLGLDLRGGSHLVLEVDEDDFVNGFLQMYSDELRSFLKKEGIGVFSMRQIQNKITLSFADSRFKENIADKVTLFLQGVNSKLNVDPKKNLLVTTTEKEISIVLSQNNIDQVISHAIEQSMEIIRQRIDQIGISESTIQRLGSHRILIQLPGEQDPSRLRQLLGTTAKMSFHKVLPNNSKKGFMFGVRFLRDSDGNQYLVEDKVEISGIHLNGATANFDPKTHKPVVDISFDEMGARRFFEVTRDNIGKPLAVVLDGRVLTAPVINQAIPSGKAQISGNFTIETAGILAAMLRAGSLPIKLNIVEERNVGADLGSDSIYKGTCAIVAGLVLIVLFMIVLYGKWGLVADFSIFLNVIltlallsllgatltlPSIAGIVLGIGLAVDSNILVNERIREENRKNQSVFCSLDMGFSRAYSTIFDSNITALIatvvlfffgggavrgfaITMGLSILISMFTAISIVRAMMIFIIRYKKMKSIDINPLSRFFLIPDCIAIQFMRARFWGVGisilfsicsicllfTHGLNYGIDFKGGIQLGVLANRPVDLSVVRSNLESLQIGDISFQNFDGEKNFLVRLQYQPGDSVAQTRVLEMVKKKITEIVPLSTIQNTEIVGPKISRELIRKGIVGVIISAIAMLIYIWIRFKWYFALGAittlilditktlGFFALFGIEFNLTAVAAVLTLIGYSVNDKVVVYDRMRKNMKLYTTSISFRDLIDKSINETLGRSVYTSMAAFISVLPMAVWGGSVIGSFAIPMAFGivvaasssifiaapiLLFIYDWRAKNARI
***NPWLVILYSMICCIGLLIALPNFLPQSMLDRFPSAMPKNRISLGLDLRGGSHLVLEVDEDDFVNGFLQM*S*ELRSFLKKEGIGVFSMRQIQNKITLSFADSRFKENIADKVTLFLQGVNS**********LVTTTEKEISIVL***********AIEQSMEIIRQRIDQIGISESTIQRLGSHRILIQLPGEQDPSRLRQLLGTTAKMSFHKVLPNNSKKGFMFGVRFLRDSDGNQYLVEDKVEISGIHLNGATANFDPKTHKPVVDISFDEMGARRFFEVTRDNIGKPLAVVLDGRVLTAPVINQAIPSGKAQISGNFTIETAGILAAMLRAGSLPIKLNIVEERNVGADLGSDSIYKGTCAIVAGLVLIVLFMIVLYGKWGLVADFSIFLNVILTLALLSLLGATLTLPSIAGIVLGIGLAVDSNILVNERIREENRKNQSVFCSLDMGFSRAYSTIFDSNITALIATVVLFFFGGGAVRGFAITMGLSILISMFTAISIVRAMMIFIIRYKKMKSIDINPLSRFFLIPDCIAIQFMRARFWGVGISILFSICSICLLFTHGLNYGIDFKGGIQLGVLANRPVDLSVVRSNLESLQIGDIS************************TRVLEMVKKKITEIVPLSTI********KISRELIRKGIVGVIISAIAMLIYIWIRFKWYFALGAITTLILDITKTLGFFALFGIEFNLTAVAAVLTLIGYSVNDKVVVYDRMRKNMKL*TTSISFRDLIDKSINETLGRSVYTSMAAFISVLPMAVWGGSVIGSFAIPMAFGIVVAASSSIFIAAPILLFIYDWRA*****
MRNNPWLVILYSMICCIGLLIALPNFLPQSMLDRFPSAMPKNRISLGLDLRGGSHLVLEVDEDDFVNGFLQMYSDELRSFLKKEGIGVFSMRQIQNKITLSFADSRFKENIADKVTLFLQGVNSKLNVDPKKNLLVTTTEKEISIVLSQNNIDQVISHAIEQSMEIIRQRIDQIGISESTIQRLGSHRILIQLPGEQDPSRLRQLLGTTAKMSFHKVLPNNSKKGFMFGVRFLRDSDGNQYLVEDKVEISGIHLNGATANFDPKTHKPVVDISFDEMGARRFFEVTRDNIGKPLAVVLDGRVLTAPVINQAIPSGKAQISGNFTIETAGILAAMLRAGSLPIKLNIVEERNVGADLGSDSIYKGTCAIVAGLVLIVLFMIVLYGKWGLVADFSIFLNVILTLALLSLLGATLTLPSIAGIVLGIGLAVDSNILVNERIREENRKNQSVFCSLDMGFSRAYSTIFDSNITALIATVVLFFFGGGAVRGFAITMGLSILISMFTAISIVRAMMIFIIRYKKMKSIDINPLSRFFLIPDCIAIQFMRARFWGVGISILFSICSICLLFTHGLNYGIDFKGGIQLGVLANRPVDLSVVRSNLESLQIGDISFQNFDGEKNFLVRLQYQPGDSVAQTRVLEMVKKKITEIVPLSTIQNTEIVGPKISRELIRKGIVGVIISAIAMLIYIWIRFKWYFALGAITTLILDITKTLGFFALFGIEFNLTAVAAVLTLIGYSVNDKVVVYDRMRKNMKLYTTSISFRDLIDKSINETLGRSVYTSMAAFISVLPMAVWGGSVIGSFAIPMAFGIVVAASSSIFIAAPILLFIYDWRAKNARI
*RNNPWLVILYSMICCIGLLIALPNFLPQSMLDRFPSAMPKNRISLGLDLRGGSHLVLEVDEDDFVNGFLQMYSDELRSFLKKEGIGVFSMRQIQNKITLSFADSRFKENIADKVTLFLQGVNSKLNVDPKKNLLVTTTEKEISIVLSQNNIDQVISHAIEQSMEIIRQRIDQIGISESTIQRLGSHRILIQLPGEQDPSRLRQLLGTTAKMSFHKVLPNNSKKGFMFGVRFLRDSDGNQYLVEDKVEISGIHLNGATANFDPKTHKPVVDISFDEMGARRFFEVTRDNIGKPLAVVLDGRVLTAPVINQAIPSGKAQISGNFTIETAGILAAMLRAGSLPIKLNIVEERNVGADLGSDSIYKGTCAIVAGLVLIVLFMIVLYGKWGLVADFSIFLNVILTLALLSLLGATLTLPSIAGIVLGIGLAVDSNILVNERIREENRKNQSVFCSLDMGFSRAYSTIFDSNITALIATVVLFFFGGGAVRGFAITMGLSILISMFTAISIVRAMMIFIIRYKKMKSIDINPLSRFFLIPDCIAIQFMRARFWGVGISILFSICSICLLFTHGLNYGIDFKGGIQLGVLANRPVDLSVVRSNLESLQIGDISFQNFDGEKNFLVRLQYQPGDSVAQTRVLEMVKKKITEIVPLSTIQNTEIVGPKISRELIRKGIVGVIISAIAMLIYIWIRFKWYFALGAITTLILDITKTLGFFALFGIEFNLTAVAAVLTLIGYSVNDKVVVYDRMRKNMKLYTTSISFRDLIDKSINETLGRSVYTSMAAFISVLPMAVWGGSVIGSFAIPMAFGIVVAASSSIFIAAPILLFIYDWRA*****
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiii
xxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
iiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRNNPWLVILYSMICCIGLLIALPNFLPQSMLDRFPSAMPKNRISLGLDLRGGSHLVLEVDEDDFVNGFLQMYSDELRSFLKKEGIGVFSMRQIQNKITLSFADSRFKENIADKVTLFLQGVNSKLNVDPKKNLLVTTTEKEISIVLSQNNIDQVISHAIEQSMEIIRQRIDQIGISESTIQRLGSHRILIQLPGEQDPSRLRQLLGTTAKMSFHKVLPNNSKKGFMFGVRFLRDSDGNQYLVEDKVEISGIHLNGATANFDPKTHKPVVDISFDEMGARRFFEVTRDNIGKPLAVVLDGRVLTAPVINQAIPSGKAQISGNFTIETAGILAAMLRAGSLPIKLNIVEERNVGADLGSDSIYKGTCAIVAGLVLIVLFMIVLYGKWGLVADFSIFLNVILTLALLSLLGATLTLPSIAGIVLGIGLAVDSNILVNERIREENRKNQSVFCSLDMGFSRAYSTIFDSNITALIATVVLFFFGGGAVRGFAITMGLSILISMFTAISIVRAMMIFIIRYKKMKSIDINPLSRFFLIPDCIAIQFMRARFWGVGISILFSICSICLLFTHGLNYGIDFKGGIQLGVLANRPVDLSVVRSNLESLQIGDISFQNFDGEKNFLVRLQYQPGDSVAQTRVLEMVKKKITEIVPLSTIQNTEIVGPKISRELIRKGIVGVIISAIAMLIYIWIRFKWYFALGAITTLILDITKTLGFFALFGIEFNLTAVAAVLTLIGYSVNDKVVVYDRMRKNMKLYTTSISFRDLIDKSINETLGRSVYTSMAAFISVLPMAVWGGSVIGSFAIPMAFGIVVAASSSIFIAAPILLFIYDWRAKNARI
MRNNPWLVILYSMICCIGLLIALPNFLPQSMLDRFPSAMPKNRISLGLDLRGGSHLVLEVDEDDFVNGFLQMYSDELRSFLKKEGIGVFSMRQIQNKITLSFADSRFKENIADKVTLFLQGVNSKLNVDPKKNLLVTTTEKEISIVLSQNNIDQVISHAIEQSMEIIRQRIDQIGISESTIQRLGSHRILIQLPGEQDPSRLRQLLGTTAKMSFHKVLPNNSKKGFMFGVRFLRDSDGNQYLVEDKVEISGIHLNGATANFDPKTHKPVVDISFDEMGARRFFEVTRDNIGKPLAVVLDGRVLTAPVINQAIPSGKAQISGNFTIETAGILAAMLRAGSLPIKLNIVEERNVGADLGSDSIYKGTCAIVAGLVLIVLFMIVLYGKWGLVADFSIFLNVILTLALLSLLGATLTLPSIAGIVLGIGLAVDSNILVNERIREENRKNQSVFCSLDMGFSRAYSTIFDSNITALIATVVLFFFGGGAVRGFAITMGLSILISMFTAISIVRAMMIFIIRYKKMKSIDINPLSRFFLIPDCIAIQFMRARFWGVGISILFSICSICLLFTHGLNYGIDFKGGIQLGVLANRPVDLSVVRSNLESLQIGDISFQNFDGEKNFLVRLQYQPGDSVAQTRVLEMVKKKITEIVPLSTIQNTEIVGPKISRELIRKGIVGVIISAIAMLIYIWIRFKWYFALGAITTLILDITKTLGFFALFGIEFNLTAVAAVLTLIGYSVNDKVVVYDRMRKNMKLYTTSISFRDLIDKSINETLGRSVYTSMAAFISVLPMAVWGGSVIGSFAIPMAFGIVVAASSSIFIAAPILLFIYDWRAKNARI
MRNNPWLVILYSMICCIGLLIALPNFLPQSMLDRFPSAMPKNRISLGLDLRGGSHLVLEVDEDDFVNGFLQMYSDELRSFLKKEGIGVFSMRQIQNKITLSFADSRFKENIADKVTLFLQGVNSKLNVDPKKNLLVTTTEKEISIVLSQNNIDQVISHAIEQSMEIIRQRIDQIGISESTIQRLGSHRILIQLPGEQDPSRLRQLLGTTAKMSFHKVLPNNSKKGFMFGVRFLRDSDGNQYLVEDKVEISGIHLNGATANFDPKTHKPVVDISFDEMGARRFFEVTRDNIGKPLAVVLDGRVLTAPVINQAIPSGKAQISGNFTIETAGILAAMLRAGSLPIKLNIVEERNVGADLGSDSIYKGTCAIVAGLVLIVLFMIVLYGKWGLVADFSIFLNVILTLALLSLLGATLTLPSIAGIVLGIGLAVDSNILVNERIREENRKNQSVFCSLDMGFSRAYSTIFDSNITALIATVVLFFFGGGAVRGFAITMGLSILISMFTAISIVRAMMIFIIRYKKMKSIDINPLSRFFLIPDCIAIQFMRARFWGVGISILFSICSICLLFTHGLNYGIDFKGGIQLGVLANRPVDLSVVRSNLESLQIGDISFQNFDGEKNFLVRLQYQPGDSVAQTRVLEMVKKKITEIVPLSTIQNTEIVGPKISRELIRKGIVGVIISAIAMLIYIWIRFKWYFALGAITTLILDITKTLGFFALFGIEFNLTAVAAVLTLIGYSVNDKVVVYDRMRKNMKLYTTSISFRDLIDKSINETLGRSVYTSMAAFISVLPMAVWGGSVIGSFAIPMAFGIVVAASSSIFIAAPILLFIYDWRAKNARI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target833 bifunctional preprotein translocase subunit SecD/SecF [
315122649833 bifunctional preprotein translocase subunit SecD/SecF [ 1 0.0
86356282849 bifunctional preprotein translocase subunit SecD/SecF [ 1 0.0
190890332848 protein-export translocase [Rhizobium etli CIAT 652] Le 1 0.0
116250452853 bifunctional preprotein translocase subunit SecD/SecF [ 1 0.0
327191559848 protein-export translocase protein [Rhizobium etli CNPA 1 0.0
241203075848 bifunctional preprotein translocase subunit SecD/SecF [ 1 0.0
222106993839 protein-export membrane protein SECD [Agrobacterium vit 1 0.0
209547898849 bifunctional preprotein translocase subunit SecD/SecF [ 1 0.0
222084836852 protein-export membrane protein SecD [Agrobacterium rad 1 0.0
256061396845 bifunctional preprotein translocase subunit SecD/SecF [ 1 0.0
>gi|315122649|ref|YP_004063138.1| bifunctional preprotein translocase subunit SecD/SecF [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 833 Back     alignment and organism information
 Score = 1244 bits (3220), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 639/831 (76%), Positives = 743/831 (89%), Gaps = 2/831 (0%)

Query: 1   MRNNPWLVILYSMICCIGLLIALPNFLPQSMLDRFPSAMPKNRISLGLDLRGGSHLVLEV 60
           MRNNPWLV LY++ICCIG+L+ALPNFL QS LD FPS +PKNRI+LGLDLRGGSHLVLE 
Sbjct: 1   MRNNPWLVSLYAVICCIGMLVALPNFLSQSALDAFPSFVPKNRIALGLDLRGGSHLVLEA 60

Query: 61  DEDDFVNGFLQMYSDELRSFLKKEGIGVFSMRQIQNKITLSFADSRFKENIADKVTLFLQ 120
           DE+DF+ G LQM+  +L+SFLKKEG+ + S+RQ++NKI++SF+DS  K NI DKV  F +
Sbjct: 61  DEEDFIGGLLQMHLHDLQSFLKKEGVNILSLRQMKNKISISFSDSISKGNIVDKVRFFFR 120

Query: 121 GVNSKLNVDPKKNLLVT-TTEKEISIVLSQNNIDQVISHAIEQSMEIIRQRIDQIGISES 179
           G+  KLN+D K N L+T  ++++ISIVL    IDQ I+ AIEQSMEI+RQRIDQ+GISE 
Sbjct: 121 GIAFKLNLDQKNNFLITQNSDQDISIVLIPYKIDQAIARAIEQSMEIVRQRIDQMGISEP 180

Query: 180 TIQRLGSHRILIQLPGEQDPSRLRQLLGTTAKMSFHKVLPNNSKKGFMFGVRFLRDSDGN 239
           TIQRLGS+RILIQLPGEQ+PSRLRQLLGTTAKMSFH VL NN  KGF  G  FLRD++GN
Sbjct: 181 TIQRLGSNRILIQLPGEQNPSRLRQLLGTTAKMSFHNVLSNNRNKGFSLGASFLRDNNGN 240

Query: 240 QYLVEDKVEISGIHLNGATANFDPKTHKPVVDISFDEMGARRFFEVTRDNIGKPLAVVLD 299
           QYLVEDK++ISG HLNGA A FDPKT++ VVDISFD++GAR FFEVTR+NIG+ LAVVLD
Sbjct: 241 QYLVEDKIQISGTHLNGAVARFDPKTNQSVVDISFDDIGARLFFEVTRNNIGRSLAVVLD 300

Query: 300 GRVLTAPVINQAIPSGKAQISGNFTIETAGILAAMLRAGSLPIKLNIVEERNVGADLGSD 359
           G+VLTAPVINQAIP+GKAQISGNFTIETAG+LA MLRAG+LP+KLNIVEER+VGADLG D
Sbjct: 301 GKVLTAPVINQAIPNGKAQISGNFTIETAGVLAVMLRAGALPVKLNIVEERSVGADLGGD 360

Query: 360 SIYKGTCAIVAGLVLIVLFMIVLYGKWGLVADFSIFLNVILTLALLSLLGATLTLPSIAG 419
           SIYKGT AI+AGLVLI+LFMIVLYG+WGL+A+FSI LN+ILTLALLSLLGATLTLP IAG
Sbjct: 361 SIYKGTYAILAGLVLIILFMIVLYGRWGLLANFSILLNIILTLALLSLLGATLTLPGIAG 420

Query: 420 IVLGIGLAVDSNILVNERIREENRKNQSVFCSLDMGFSRAYSTIFDSNITALIATVVLFF 479
           IVLGIGLAVDSNILVNERIREE+RKN+SVF SLDMGFSRAYSTI DSN+TALI+TV+LFF
Sbjct: 421 IVLGIGLAVDSNILVNERIREESRKNKSVFYSLDMGFSRAYSTIVDSNLTALISTVILFF 480

Query: 480 FGGGAVRGFAITMGLSILISMFTAISIVRAMMIFIIRYKKMKSIDINPLSRFFLIPDCIA 539
            G G VRGFA+TMGLSI++SMFTAISIVRAMMIFI+RYKK+KSI+I  L  F LIPD   
Sbjct: 481 CGSGPVRGFAVTMGLSIVVSMFTAISIVRAMMIFIVRYKKIKSINIRSLLGFSLIPDHTT 540

Query: 540 IQFMRARFWGVGISILFSICSICLLFTHGLNYGIDFKGGIQLGVLANRPVDLSVVRSNLE 599
           I+FM+ARF G+G SI+ SI SI LLFTHGLNYGIDF GGIQ+GV A++PVDLS+VRSNLE
Sbjct: 541 IRFMKARFVGIGTSIILSIASISLLFTHGLNYGIDFDGGIQIGVYADKPVDLSIVRSNLE 600

Query: 600 SLQIGDISFQNFDGEKNFLVRLQYQPGDSVAQTRVLEMVKKKITEIVPLSTIQNTEIVGP 659
           SLQIGDISFQ+FDG+KNFLVRL+YQPG S AQ RVLE VKKKITEI+P + I +TEIVGP
Sbjct: 601 SLQIGDISFQSFDGDKNFLVRLKYQPGGSPAQARVLEEVKKKITEIIPFAKIPHTEIVGP 660

Query: 660 KISRELIRKGIVGVIISAIAMLIYIWIRFKWYFALGAITTLILDITKTLGFFALFGIEFN 719
           KISRELIRKG++GV++SA+AM IYIWIRF+W+FA+GAITTL+LDITKTLG F+LF +EFN
Sbjct: 661 KISRELIRKGVLGVVLSALAMFIYIWIRFEWHFAVGAITTLVLDITKTLGLFSLFDLEFN 720

Query: 720 LTAVAAVLTLIGYSVNDKVVVYDRMRKNMKLYTTSISFRDLIDKSINETLGRSVYTSMAA 779
           LTAVAA+LTLIGYSVNDK+VVYD MRKNM+L ++++SFR+LIDKSINETLGRSVYTSM+A
Sbjct: 721 LTAVAAILTLIGYSVNDKIVVYDCMRKNMRL-SSALSFRNLIDKSINETLGRSVYTSMSA 779

Query: 780 FISVLPMAVWGGSVIGSFAIPMAFGIVVAASSSIFIAAPILLFIYDWRAKN 830
           F+SVLPMA+WGGSV+ SFAIPMAFGI +AASSS+FIAAPILLFI DWR KN
Sbjct: 780 FLSVLPMAIWGGSVVSSFAIPMAFGIFIAASSSVFIAAPILLFIGDWRFKN 830


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86356282|ref|YP_468174.1| bifunctional preprotein translocase subunit SecD/SecF [Rhizobium etli CFN 42] Length = 849 Back     alignment and organism information
>gi|190890332|ref|YP_001976874.1| protein-export translocase [Rhizobium etli CIAT 652] Length = 848 Back     alignment and organism information
>gi|116250452|ref|YP_766290.1| bifunctional preprotein translocase subunit SecD/SecF [Rhizobium leguminosarum bv. viciae 3841] Length = 853 Back     alignment and organism information
>gi|327191559|gb|EGE58571.1| protein-export translocase protein [Rhizobium etli CNPAF512] Length = 848 Back     alignment and organism information
>gi|241203075|ref|YP_002974171.1| bifunctional preprotein translocase subunit SecD/SecF [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 848 Back     alignment and organism information
>gi|222106993|ref|YP_002547784.1| protein-export membrane protein SECD [Agrobacterium vitis S4] Length = 839 Back     alignment and organism information
>gi|209547898|ref|YP_002279815.1| bifunctional preprotein translocase subunit SecD/SecF [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 849 Back     alignment and organism information
>gi|222084836|ref|YP_002543365.1| protein-export membrane protein SecD [Agrobacterium radiobacter K84] Length = 852 Back     alignment and organism information
>gi|256061396|ref|ZP_05451540.1| bifunctional preprotein translocase subunit SecD/SecF [Brucella neotomae 5K33] Length = 845 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target833 bifunctional preprotein translocase subunit SecD/SecF [
PRK13024755 PRK13024, PRK13024, bifunctional preprotein translocase 0.0
PRK13023758 PRK13023, PRK13023, bifunctional preprotein translocase 1e-120
PRK14726855 PRK14726, PRK14726, bifunctional preprotein translocase 0.0
PRK05812498 PRK05812, secD, preprotein translocase subunit SecD; Re 1e-145
COG0342506 COG0342, SecD, Preprotein translocase subunit SecD [Int 1e-116
TIGR01129397 TIGR01129, secD, protein-export membrane protein SecD 1e-112
PRK12933604 PRK12933, secD, preprotein translocase subunit SecD; Re 9e-82
PRK13022289 PRK13022, secF, preprotein translocase subunit SecF; Re 2e-78
COG0341305 COG0341, SecF, Preprotein translocase subunit SecF [Int 6e-70
TIGR00966246 TIGR00966, 3a0501s07, protein-export membrane protein S 1e-59
PRK13021297 PRK13021, secF, preprotein translocase subunit SecF; Re 6e-37
PRK129111403 PRK12911, PRK12911, bifunctional preprotein translocase 4e-70
pfam02355189 pfam02355, SecD_SecF, Protein export membrane protein 1e-47
TIGR00916192 TIGR00916, 2A0604s01, protein-export membrane protein, 1e-35
COG0342506 COG0342, SecD, Preprotein translocase subunit SecD [Int 2e-12
TIGR01129397 TIGR01129, secD, protein-export membrane protein SecD 9e-10
TIGR00921 719 TIGR00921, 2A067, The (Largely Archaeal Putative) Hydro 4e-06
COG08411009 COG0841, AcrB, Cation/multidrug efflux pump [Defense me 7e-06
PRK05812498 PRK05812, secD, preprotein translocase subunit SecD; Re 8e-06
COG1033 727 COG1033, COG1033, Predicted exporters of the RND superf 5e-05
TIGR00915 1044 TIGR00915, 2A0602, The (Largely Gram-negative Bacterial 5e-05
pfam00873 1021 pfam00873, ACR_tran, AcrB/AcrD/AcrF family 2e-04
COG3696 1027 COG3696, COG3696, Putative silver efflux pump [Inorgani 0.001
TIGR00916192 TIGR00916, 2A0604s01, protein-export membrane protein, 2e-37
COG0341305 COG0341, SecF, Preprotein translocase subunit SecF [Int 2e-16
pfam02355189 pfam02355, SecD_SecF, Protein export membrane protein 9e-14
PRK13022289 PRK13022, secF, preprotein translocase subunit SecF; Re 1e-10
PRK13021297 PRK13021, secF, preprotein translocase subunit SecF; Re 7e-09
COG3696 1027 COG3696, COG3696, Putative silver efflux pump [Inorgani 2e-08
COG1033727 COG1033, COG1033, Predicted exporters of the RND superf 4e-08
TIGR00921719 TIGR00921, 2A067, The (Largely Archaeal Putative) Hydro 9e-08
pfam00873 1021 pfam00873, ACR_tran, AcrB/AcrD/AcrF family 2e-07
TIGR00921719 TIGR00921, 2A067, The (Largely Archaeal Putative) Hydro 3e-05
PRK09579 1017 PRK09579, PRK09579, multidrug efflux protein; Reviewed 7e-05
COG08411009 COG0841, AcrB, Cation/multidrug efflux pump [Defense me 8e-05
PRK129111403 PRK12911, PRK12911, bifunctional preprotein translocase 1e-04
PRK10614 1025 PRK10614, PRK10614, multidrug efflux system subunit Mdt 1e-04
PRK15127 1049 PRK15127, PRK15127, multidrug efflux system protein Acr 2e-04
TIGR00833 910 TIGR00833, actII, Transport protein 3e-04
TIGR00915 1044 TIGR00915, 2A0602, The (Largely Gram-negative Bacterial 6e-04
PRK10555 1037 PRK10555, PRK10555, aminoglycoside/multidrug efflux sys 0.001
PRK08343417 PRK08343, secD, preprotein translocase subunit SecD; Re 4e-29
PRK08578292 PRK08578, PRK08578, preprotein translocase subunit SecF 8e-15
TIGR00966246 TIGR00966, 3a0501s07, protein-export membrane protein S 8e-11
pfam03176332 pfam03176, MMPL, MMPL family 1e-05
COG0841 1009 COG0841, AcrB, Cation/multidrug efflux pump [Defense me 9e-11
TIGR03480 862 TIGR03480, HpnN, hopanoid biosynthesis associated RND t 6e-06
COG1033727 COG1033, COG1033, Predicted exporters of the RND superf 8e-10
COG2409 937 COG2409, COG2409, Predicted drug exporters of the RND s 2e-09
PRK13023758 PRK13023, PRK13023, bifunctional preprotein translocase 3e-07
PRK13024755 PRK13024, PRK13024, bifunctional preprotein translocase 1e-06
PRK08578292 PRK08578, PRK08578, preprotein translocase subunit SecF 5e-07
COG0841 1009 COG0841, AcrB, Cation/multidrug efflux pump [Defense me 9e-06
pfam008731021 pfam00873, ACR_tran, AcrB/AcrD/AcrF family 0.001
TIGR00917 1204 TIGR00917, 2A060601, Niemann-Pick C type protein family 0.001
PRK10555 1037 PRK10555, PRK10555, aminoglycoside/multidrug efflux sys 0.004
>gnl|CDD|183848 PRK13024, PRK13024, bifunctional preprotein translocase subunit SecD/SecF; Reviewed Back     alignment and domain information
>gnl|CDD|171842 PRK13023, PRK13023, bifunctional preprotein translocase subunit SecD/SecF; Reviewed Back     alignment and domain information
>gnl|CDD|173189 PRK14726, PRK14726, bifunctional preprotein translocase subunit SecD/SecF; Provisional Back     alignment and domain information
>gnl|CDD|180271 PRK05812, secD, preprotein translocase subunit SecD; Reviewed Back     alignment and domain information
>gnl|CDD|30690 COG0342, SecD, Preprotein translocase subunit SecD [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|162214 TIGR01129, secD, protein-export membrane protein SecD Back     alignment and domain information
>gnl|CDD|183831 PRK12933, secD, preprotein translocase subunit SecD; Reviewed Back     alignment and domain information
>gnl|CDD|183847 PRK13022, secF, preprotein translocase subunit SecF; Reviewed Back     alignment and domain information
>gnl|CDD|30689 COG0341, SecF, Preprotein translocase subunit SecF [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|162137 TIGR00966, 3a0501s07, protein-export membrane protein SecF Back     alignment and domain information
>gnl|CDD|171840 PRK13021, secF, preprotein translocase subunit SecF; Reviewed Back     alignment and domain information
>gnl|CDD|171815 PRK12911, PRK12911, bifunctional preprotein translocase subunit SecD/SecF; Reviewed Back     alignment and domain information
>gnl|CDD|111266 pfam02355, SecD_SecF, Protein export membrane protein Back     alignment and domain information
>gnl|CDD|162105 TIGR00916, 2A0604s01, protein-export membrane protein, SecD/SecF family Back     alignment and domain information
>gnl|CDD|30690 COG0342, SecD, Preprotein translocase subunit SecD [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|162214 TIGR01129, secD, protein-export membrane protein SecD Back     alignment and domain information
>gnl|CDD|162109 TIGR00921, 2A067, The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family Back     alignment and domain information
>gnl|CDD|31183 COG0841, AcrB, Cation/multidrug efflux pump [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|180271 PRK05812, secD, preprotein translocase subunit SecD; Reviewed Back     alignment and domain information
>gnl|CDD|31236 COG1033, COG1033, Predicted exporters of the RND superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|162104 TIGR00915, 2A0602, The (Largely Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family Back     alignment and domain information
>gnl|CDD|144459 pfam00873, ACR_tran, AcrB/AcrD/AcrF family Back     alignment and domain information
>gnl|CDD|33492 COG3696, COG3696, Putative silver efflux pump [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|162105 TIGR00916, 2A0604s01, protein-export membrane protein, SecD/SecF family Back     alignment and domain information
>gnl|CDD|30689 COG0341, SecF, Preprotein translocase subunit SecF [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|111266 pfam02355, SecD_SecF, Protein export membrane protein Back     alignment and domain information
>gnl|CDD|183847 PRK13022, secF, preprotein translocase subunit SecF; Reviewed Back     alignment and domain information
>gnl|CDD|171840 PRK13021, secF, preprotein translocase subunit SecF; Reviewed Back     alignment and domain information
>gnl|CDD|33492 COG3696, COG3696, Putative silver efflux pump [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|31236 COG1033, COG1033, Predicted exporters of the RND superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|162109 TIGR00921, 2A067, The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family Back     alignment and domain information
>gnl|CDD|144459 pfam00873, ACR_tran, AcrB/AcrD/AcrF family Back     alignment and domain information
>gnl|CDD|162109 TIGR00921, 2A067, The (Largely Archaeal Putative) Hydrophobe/Amphiphile Efflux-3 (HAE3) Family Back     alignment and domain information
>gnl|CDD|169983 PRK09579, PRK09579, multidrug efflux protein; Reviewed Back     alignment and domain information
>gnl|CDD|31183 COG0841, AcrB, Cation/multidrug efflux pump [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|171815 PRK12911, PRK12911, bifunctional preprotein translocase subunit SecD/SecF; Reviewed Back     alignment and domain information
>gnl|CDD|182589 PRK10614, PRK10614, multidrug efflux system subunit MdtC; Provisional Back     alignment and domain information
>gnl|CDD|185081 PRK15127, PRK15127, multidrug efflux system protein AcrB; Provisional Back     alignment and domain information
>gnl|CDD|129913 TIGR00833, actII, Transport protein Back     alignment and domain information
>gnl|CDD|162104 TIGR00915, 2A0602, The (Largely Gram-negative Bacterial) Hydrophobe/Amphiphile Efflux-1 (HAE1) Family Back     alignment and domain information
>gnl|CDD|182544 PRK10555, PRK10555, aminoglycoside/multidrug efflux system; Provisional Back     alignment and domain information
>gnl|CDD|181396 PRK08343, secD, preprotein translocase subunit SecD; Reviewed Back     alignment and domain information
>gnl|CDD|181485 PRK08578, PRK08578, preprotein translocase subunit SecF; Reviewed Back     alignment and domain information
>gnl|CDD|162137 TIGR00966, 3a0501s07, protein-export membrane protein SecF Back     alignment and domain information
>gnl|CDD|146013 pfam03176, MMPL, MMPL family Back     alignment and domain information
>gnl|CDD|31183 COG0841, AcrB, Cation/multidrug efflux pump [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|163284 TIGR03480, HpnN, hopanoid biosynthesis associated RND transporter like protein HpnN Back     alignment and domain information
>gnl|CDD|31236 COG1033, COG1033, Predicted exporters of the RND superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|32544 COG2409, COG2409, Predicted drug exporters of the RND superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|171842 PRK13023, PRK13023, bifunctional preprotein translocase subunit SecD/SecF; Reviewed Back     alignment and domain information
>gnl|CDD|183848 PRK13024, PRK13024, bifunctional preprotein translocase subunit SecD/SecF; Reviewed Back     alignment and domain information
>gnl|CDD|181485 PRK08578, PRK08578, preprotein translocase subunit SecF; Reviewed Back     alignment and domain information
>gnl|CDD|31183 COG0841, AcrB, Cation/multidrug efflux pump [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|144459 pfam00873, ACR_tran, AcrB/AcrD/AcrF family Back     alignment and domain information
>gnl|CDD|162106 TIGR00917, 2A060601, Niemann-Pick C type protein family Back     alignment and domain information
>gnl|CDD|182544 PRK10555, PRK10555, aminoglycoside/multidrug efflux system; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 833 bifunctional preprotein translocase subunit SecD/SecF [
PRK13023840 bifunctional preprotein translocase subunit SecD/SecF; 100.0
PRK13024741 bifunctional preprotein translocase subunit SecD/SecF; 100.0
PRK106141025 multidrug efflux system subunit MdtC; Provisional 100.0
COG08411009 AcrB Cation/multidrug efflux pump [Defense mechanisms] 100.0
PRK105031040 multidrug efflux system subunit MdtB; Provisional 100.0
pfam008731021 ACR_tran AcrB/AcrD/AcrF family. Members of this family 100.0
PRK095791017 multidrug efflux protein; Reviewed 100.0
PRK105551037 aminoglycoside/multidrug efflux system; Provisional 100.0
PRK095771032 multidrug efflux protein; Reviewed 100.0
TIGR009151058 2A0602 RND transporter, hydrophobe/amphiphile efflux-1 100.0
COG36961027 Putative silver efflux pump [Inorganic ion transport an 100.0
TIGR009141100 2A0601 heavy metal efflux pump, CzcA family; InterPro: 100.0
PRK129111405 bifunctional preprotein translocase subunit SecD/SecF; 100.0
PRK05812513 secD preprotein translocase subunit SecD; Reviewed 100.0
PRK12933604 secD preprotein translocase subunit SecD; Reviewed 100.0
COG0342506 SecD Preprotein translocase subunit SecD [Intracellular 100.0
PRK08343414 secD preprotein translocase subunit SecD; Reviewed 100.0
pfam008731021 ACR_tran AcrB/AcrD/AcrF family. Members of this family 100.0
COG08411009 AcrB Cation/multidrug efflux pump [Defense mechanisms] 99.97
TIGR009151058 2A0602 RND transporter, hydrophobe/amphiphile efflux-1 99.87
TIGR01129522 secD protein-export membrane protein SecD; InterPro: IP 100.0
COG36961027 Putative silver efflux pump [Inorganic ion transport an 99.9
PRK13022294 secF preprotein translocase subunit SecF; Reviewed 100.0
PRK13021297 secF preprotein translocase subunit SecF; Reviewed 100.0
COG0341305 SecF Preprotein translocase subunit SecF [Intracellular 100.0
PRK08578294 preprotein translocase subunit SecF; Reviewed 100.0
COG1033727 Predicted exporters of the RND superfamily [General fun 100.0
TIGR03480862 HpnN hopanoid biosynthesis associated RND transporter l 100.0
TIGR00833992 actII Transport protein; InterPro: IPR004707 Characteri 100.0
pfam02460801 Patched Patched family. The transmembrane protein Patch 100.0
KOG1934868 consensus 99.94
COG4258788 Predicted exporter [General function prediction only] 99.87
TIGR009181215 2A060602 transmembrane receptor Patched; InterPro: IPR0 99.71
TIGR00966307 3a0501s07 protein-export membrane protein SecF; InterPr 100.0
pfam02355189 SecD_SecF Protein export membrane protein. This family 100.0
TIGR00916247 2A0604s01 protein-export membrane protein, SecD/SecF fa 100.0
TIGR01129522 secD protein-export membrane protein SecD; InterPro: IP 100.0
PRK05812513 secD preprotein translocase subunit SecD; Reviewed 100.0
PRK12933604 secD preprotein translocase subunit SecD; Reviewed 100.0
COG0342506 SecD Preprotein translocase subunit SecD [Intracellular 100.0
PRK13024 741 bifunctional preprotein translocase subunit SecD/SecF; 100.0
PRK13023 840 bifunctional preprotein translocase subunit SecD/SecF; 99.97
PRK08343414 secD preprotein translocase subunit SecD; Reviewed 99.97
PRK12911 1405 bifunctional preprotein translocase subunit SecD/SecF; 99.96
pfam03176332 MMPL MMPL family. Members of this family are putative i 99.93
TIGR009171471 2A060601 Niemann-Pick C type protein family; InterPro: 98.67
KOG19331201 consensus 97.3
TIGR00916247 2A0604s01 protein-export membrane protein, SecD/SecF fa 100.0
PRK106141025 multidrug efflux system subunit MdtC; Provisional 100.0
PRK105031040 multidrug efflux system subunit MdtB; Provisional 100.0
PRK095771032 multidrug efflux protein; Reviewed 100.0
PRK105551037 aminoglycoside/multidrug efflux system; Provisional 100.0
PRK095791017 multidrug efflux protein; Reviewed 100.0
pfam02355189 SecD_SecF Protein export membrane protein. This family 100.0
PRK13022294 secF preprotein translocase subunit SecF; Reviewed 99.96
COG0341305 SecF Preprotein translocase subunit SecF [Intracellular 99.96
COG1033727 Predicted exporters of the RND superfamily [General fun 99.95
PRK13021297 secF preprotein translocase subunit SecF; Reviewed 99.94
PRK08578294 preprotein translocase subunit SecF; Reviewed 99.94
pfam03176332 MMPL MMPL family. Members of this family are putative i 99.94
TIGR03480862 HpnN hopanoid biosynthesis associated RND transporter l 99.94
COG2409 937 Predicted drug exporters of the RND superfamily [Genera 99.93
TIGR00966307 3a0501s07 protein-export membrane protein SecF; InterPr 99.86
TIGR00833992 actII Transport protein; InterPro: IPR004707 Characteri 99.83
pfam02460801 Patched Patched family. The transmembrane protein Patch 99.74
KOG1934868 consensus 99.59
pfam12349153 Sterol-sensing Sterol-sensing domain of SREBP cleavage- 99.59
COG4258788 Predicted exporter [General function prediction only] 99.18
KOG19351143 consensus 98.9
TIGR009141100 2A0601 heavy metal efflux pump, CzcA family; InterPro: 98.84
pfam12349153 Sterol-sensing Sterol-sensing domain of SREBP cleavage- 99.73
COG2409937 Predicted drug exporters of the RND superfamily [Genera 99.58
pfam03649250 UPF0014 Uncharacterized protein family (UPF0014). 95.87
KOG19351143 consensus 99.72
TIGR009181215 2A060602 transmembrane receptor Patched; InterPro: IPR0 99.19
TIGR00917 1471 2A060601 Niemann-Pick C type protein family; InterPro: 98.55
KOG1933 1201 consensus 97.55
pfam0754929 Sec_GG SecD/SecF GG Motif. This family consists of vari 95.73
>PRK13023 bifunctional preprotein translocase subunit SecD/SecF; Reviewed Back     alignment and domain information
>PRK13024 bifunctional preprotein translocase subunit SecD/SecF; Reviewed Back     alignment and domain information
>PRK10614 multidrug efflux system subunit MdtC; Provisional Back     alignment and domain information
>COG0841 AcrB Cation/multidrug efflux pump [Defense mechanisms] Back     alignment and domain information
>PRK10503 multidrug efflux system subunit MdtB; Provisional Back     alignment and domain information
>pfam00873 ACR_tran AcrB/AcrD/AcrF family Back     alignment and domain information
>PRK09579 multidrug efflux protein; Reviewed Back     alignment and domain information
>PRK10555 aminoglycoside/multidrug efflux system; Provisional Back     alignment and domain information
>PRK09577 multidrug efflux protein; Reviewed Back     alignment and domain information
>TIGR00915 2A0602 RND transporter, hydrophobe/amphiphile efflux-1 (HAE1) family; InterPro: IPR004764 Hydrophobe/amphiphile efflux-1 HAE1 is involved in toxin production and resistance processes Back     alignment and domain information
>COG3696 Putative silver efflux pump [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR00914 2A0601 heavy metal efflux pump, CzcA family; InterPro: IPR004763 This belongs to the family of H+/heavy metal cation antiporters Back     alignment and domain information
>PRK12911 bifunctional preprotein translocase subunit SecD/SecF; Reviewed Back     alignment and domain information
>PRK05812 secD preprotein translocase subunit SecD; Reviewed Back     alignment and domain information
>PRK12933 secD preprotein translocase subunit SecD; Reviewed Back     alignment and domain information
>COG0342 SecD Preprotein translocase subunit SecD [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK08343 secD preprotein translocase subunit SecD; Reviewed Back     alignment and domain information
>pfam00873 ACR_tran AcrB/AcrD/AcrF family Back     alignment and domain information
>COG0841 AcrB Cation/multidrug efflux pump [Defense mechanisms] Back     alignment and domain information
>TIGR00915 2A0602 RND transporter, hydrophobe/amphiphile efflux-1 (HAE1) family; InterPro: IPR004764 Hydrophobe/amphiphile efflux-1 HAE1 is involved in toxin production and resistance processes Back     alignment and domain information
>TIGR01129 secD protein-export membrane protein SecD; InterPro: IPR005791 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway Back     alignment and domain information
>COG3696 Putative silver efflux pump [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13022 secF preprotein translocase subunit SecF; Reviewed Back     alignment and domain information
>PRK13021 secF preprotein translocase subunit SecF; Reviewed Back     alignment and domain information
>COG0341 SecF Preprotein translocase subunit SecF [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK08578 preprotein translocase subunit SecF; Reviewed Back     alignment and domain information
>COG1033 Predicted exporters of the RND superfamily [General function prediction only] Back     alignment and domain information
>TIGR03480 HpnN hopanoid biosynthesis associated RND transporter like protein HpnN Back     alignment and domain information
>TIGR00833 actII Transport protein; InterPro: IPR004707 Characterised members of the Resistance-Nodulation-Cell Division (RND) superfamily all probably catalyze substrate efflux via an H+ antiport mechanism Back     alignment and domain information
>pfam02460 Patched Patched family Back     alignment and domain information
>KOG1934 consensus Back     alignment and domain information
>COG4258 Predicted exporter [General function prediction only] Back     alignment and domain information
>TIGR00918 2A060602 transmembrane receptor Patched; InterPro: IPR004766 Patched (Ptc) is a Drosophila melanogaster (Fruit fly) membrane protein that plays a critical role in patterning embryonic and imaginal tissues Back     alignment and domain information
>TIGR00966 3a0501s07 protein-export membrane protein SecF; InterPro: IPR005665 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway Back     alignment and domain information
>pfam02355 SecD_SecF Protein export membrane protein Back     alignment and domain information
>TIGR00916 2A0604s01 protein-export membrane protein, SecD/SecF family; InterPro: IPR003335 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway Back     alignment and domain information
>TIGR01129 secD protein-export membrane protein SecD; InterPro: IPR005791 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway Back     alignment and domain information
>PRK05812 secD preprotein translocase subunit SecD; Reviewed Back     alignment and domain information
>PRK12933 secD preprotein translocase subunit SecD; Reviewed Back     alignment and domain information
>COG0342 SecD Preprotein translocase subunit SecD [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13024 bifunctional preprotein translocase subunit SecD/SecF; Reviewed Back     alignment and domain information
>PRK13023 bifunctional preprotein translocase subunit SecD/SecF; Reviewed Back     alignment and domain information
>PRK08343 secD preprotein translocase subunit SecD; Reviewed Back     alignment and domain information
>PRK12911 bifunctional preprotein translocase subunit SecD/SecF; Reviewed Back     alignment and domain information
>pfam03176 MMPL MMPL family Back     alignment and domain information
>TIGR00917 2A060601 Niemann-Pick C type protein family; InterPro: IPR004765 The Niemann-Pick C type protein is an integral membrane protein, which indicates that it is most likely involved in cholesterol transport or acts as some component of cholesterol homeostasis Back     alignment and domain information
>KOG1933 consensus Back     alignment and domain information
>TIGR00916 2A0604s01 protein-export membrane protein, SecD/SecF family; InterPro: IPR003335 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway Back     alignment and domain information
>PRK10614 multidrug efflux system subunit MdtC; Provisional Back     alignment and domain information
>PRK10503 multidrug efflux system subunit MdtB; Provisional Back     alignment and domain information
>PRK09577 multidrug efflux protein; Reviewed Back     alignment and domain information
>PRK10555 aminoglycoside/multidrug efflux system; Provisional Back     alignment and domain information
>PRK09579 multidrug efflux protein; Reviewed Back     alignment and domain information
>pfam02355 SecD_SecF Protein export membrane protein Back     alignment and domain information
>PRK13022 secF preprotein translocase subunit SecF; Reviewed Back     alignment and domain information
>COG0341 SecF Preprotein translocase subunit SecF [Intracellular trafficking and secretion] Back     alignment and domain information
>COG1033 Predicted exporters of the RND superfamily [General function prediction only] Back     alignment and domain information
>PRK13021 secF preprotein translocase subunit SecF; Reviewed Back     alignment and domain information
>PRK08578 preprotein translocase subunit SecF; Reviewed Back     alignment and domain information
>pfam03176 MMPL MMPL family Back     alignment and domain information
>TIGR03480 HpnN hopanoid biosynthesis associated RND transporter like protein HpnN Back     alignment and domain information
>COG2409 Predicted drug exporters of the RND superfamily [General function prediction only] Back     alignment and domain information
>TIGR00966 3a0501s07 protein-export membrane protein SecF; InterPro: IPR005665 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway Back     alignment and domain information
>TIGR00833 actII Transport protein; InterPro: IPR004707 Characterised members of the Resistance-Nodulation-Cell Division (RND) superfamily all probably catalyze substrate efflux via an H+ antiport mechanism Back     alignment and domain information
>pfam02460 Patched Patched family Back     alignment and domain information
>KOG1934 consensus Back     alignment and domain information
>pfam12349 Sterol-sensing Sterol-sensing domain of SREBP cleavage-activation Back     alignment and domain information
>COG4258 Predicted exporter [General function prediction only] Back     alignment and domain information
>KOG1935 consensus Back     alignment and domain information
>TIGR00914 2A0601 heavy metal efflux pump, CzcA family; InterPro: IPR004763 This belongs to the family of H+/heavy metal cation antiporters Back     alignment and domain information
>pfam12349 Sterol-sensing Sterol-sensing domain of SREBP cleavage-activation Back     alignment and domain information
>COG2409 Predicted drug exporters of the RND superfamily [General function prediction only] Back     alignment and domain information
>pfam03649 UPF0014 Uncharacterized protein family (UPF0014) Back     alignment and domain information
>KOG1935 consensus Back     alignment and domain information
>TIGR00918 2A060602 transmembrane receptor Patched; InterPro: IPR004766 Patched (Ptc) is a Drosophila melanogaster (Fruit fly) membrane protein that plays a critical role in patterning embryonic and imaginal tissues Back     alignment and domain information
>TIGR00917 2A060601 Niemann-Pick C type protein family; InterPro: IPR004765 The Niemann-Pick C type protein is an integral membrane protein, which indicates that it is most likely involved in cholesterol transport or acts as some component of cholesterol homeostasis Back     alignment and domain information
>KOG1933 consensus Back     alignment and domain information
>pfam07549 Sec_GG SecD/SecF GG Motif Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target833 bifunctional preprotein translocase subunit SecD/SecF [
2v50_A 1052 The Missing Part Of The Bacterial Mexab-Oprm System 4e-52
1oy6_A 1049 Structural Basis Of The Multiple Binding Capacity O 4e-49
2j8s_A 1055 Drug Export Pathway Of Multidrug Exporter Acrb Reve 7e-49
2gif_A 1057 Asymmetric Structure Of Trimeric Acrb From Escheric 7e-49
1t9t_A 1049 Structural Basis Of Multidrug Transport By The Acrb 1e-48
2hqg_A 1053 Conformation Of The Acrb Multidrug Efflux Pump In M 1e-48
1iwg_A 1053 Crystal Structure Of Bacterial Multidrug Efflux Tra 1e-48
2hqf_A 1053 Conformation Of The Acrb Multidrug Efflux Pump In M 1e-48
2hqd_A 1053 Conformation Of The Acrb Multidrug Efflux Pump In M 2e-48
2hqc_A 1053 Conformation Of The Acrb Multidrug Efflux Pump In M 5e-48
2v50_A 1052 The Missing Part Of The Bacterial Mexab-Oprm System 3e-12
2v50_A1052 The Missing Part Of The Bacterial Mexab-Oprm System 2e-08
1oy6_A 1049 Structural Basis Of The Multiple Binding Capacity O 4e-11
1oy6_A1049 Structural Basis Of The Multiple Binding Capacity O 2e-06
2j8s_A 1055 Drug Export Pathway Of Multidrug Exporter Acrb Reve 5e-11
2j8s_A1055 Drug Export Pathway Of Multidrug Exporter Acrb Reve 2e-06
2gif_A 1057 Asymmetric Structure Of Trimeric Acrb From Escheric 5e-11
2gif_A1057 Asymmetric Structure Of Trimeric Acrb From Escheric 2e-06
1t9t_A 1049 Structural Basis Of Multidrug Transport By The Acrb 4e-11
1t9t_A1049 Structural Basis Of Multidrug Transport By The Acrb 2e-06
2hqg_A 1053 Conformation Of The Acrb Multidrug Efflux Pump In M 5e-11
2hqg_A1053 Conformation Of The Acrb Multidrug Efflux Pump In M 7e-06
1iwg_A 1053 Crystal Structure Of Bacterial Multidrug Efflux Tra 5e-11
1iwg_A1053 Crystal Structure Of Bacterial Multidrug Efflux Tra 2e-06
2hqf_A 1053 Conformation Of The Acrb Multidrug Efflux Pump In M 6e-11
2hqf_A1053 Conformation Of The Acrb Multidrug Efflux Pump In M 2e-06
2hqd_A 1053 Conformation Of The Acrb Multidrug Efflux Pump In M 2e-10
2hqd_A1053 Conformation Of The Acrb Multidrug Efflux Pump In M 2e-06
2hqc_A 1053 Conformation Of The Acrb Multidrug Efflux Pump In M 7e-10
2hqc_A1053 Conformation Of The Acrb Multidrug Efflux Pump In M 2e-06
3ne5_A 1054 Crystal Structure Of The Cusba Heavy-Metal Efflux C 5e-27
3k07_A 1055 Crystal Structure Of Cusa Length = 1055 6e-27
3ne5_A1054 Crystal Structure Of The Cusba Heavy-Metal Efflux C 1e-04
3k07_A1055 Crystal Structure Of Cusa Length = 1055 1e-04
>gi|237823426|pdb|2V50|A Chain A, The Missing Part Of The Bacterial Mexab-Oprm System: Structural Determination Of The Multidrug Exporter Mexb Length = 1052 Back     alignment and structure
 Score =  211 bits (536), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 73/686 (10%), Positives = 184/686 (26%), Gaps = 44/686 (6%)

Query: 3   NNPWLVILYSMICCIGLLIALPNFLPQSMLDRFPSAMPKNRISLGLDLRGGSHLVLEVDE 62
              +  ++  +I   G L  L        ++++P+  P               +      
Sbjct: 8   RPIFAWVIALVIMLAGGLSIL-----SLPVNQYPAIAPPAI---------AVQVSYPGAS 53

Query: 63  DDFVNGFLQMYSDELRSFLKKEGIGVFSMRQIQN-KITLSFADSRFKENIADKVTLFLQG 121
            + V   +    ++  + +              +  IT++F      +    +V   LQ 
Sbjct: 54  AETVQDTVVQVIEQQMNGIDNLRYISSESNSDGSMTITVTFEQGTDPDIAQVQVQNKLQL 113

Query: 122 VNSKLNVDPKKNLLVTTTEKEISIVLSQNNIDQVISHAIEQSMEIIRQRIDQIGISESTI 181
               L  + ++  +  T   +  +++             + S  I+    D +  ++   
Sbjct: 114 ATPLLPQEVQRQGIRVTKAVKNFLMVVGVVSTDGSMTKEDLSNYIVSNIQDPLSRTKGVG 173

Query: 182 QRLGSHRILIQLPGEQDPSRLRQLLGTTAKMSFHKVLPNNSKKGFMFGVRFLRDSDGNQY 241
                           DP++L     T   +S      N        G            
Sbjct: 174 DFQVFGSQYSM-RIWLDPAKLNSYQLTPGDVSSAIQAQNVQISSGQLGGLPAVKGQQLNA 232

Query: 242 LVEDKVEISGIHLNGATANFDPKTHKPVVDISFDEMGARRFFEVTRDNIGKPLAVVLDGR 301
            +  K  +                 +    +        +       ++G          
Sbjct: 233 TIIGKTRL-------------QTAEQFENILLKVNPDGSQVRLKDVADVGLGGQDYSINA 279

Query: 302 VLTAPVINQAIPSGKAQISGNFTIETAGILAAMLRAGSLPIKLNIVEERNVGADLGSDSI 361
                  +          +   T +      A L          +           S   
Sbjct: 280 QFNGSPASGIAIKLATGANALDTAKAIRQTIANLEPFMPQGMKVVYPYDTTPVVSASIHE 339

Query: 362 YKGTCAIVAGLVLIVLFMIVLYGKWGLVADFSIFLNVILTLALLSLLGATLTLPSIAGIV 421
              T      LV +V+++ +   +  L+   ++ + ++ T  +L+  G ++   ++ G+V
Sbjct: 340 VVKTLGEAILLVFLVMYLFLQNFRATLIPTIAVPVVLLGTFGVLAAFGFSINTLTMFGMV 399

Query: 422 LGIGLAVDSNILVNERIREEN-RKNQSVFCSLDMGFSRAYSTIFDSNITALIATVVLFFF 480
           L IGL VD  I+V E +      +  S   +      +    +    +      + + FF
Sbjct: 400 LAIGLLVDDAIVVVENVERVMAEEGLSPREAARKSMGQIQGALVGIAMVLSAVFLPMAFF 459

Query: 481 GGG---AVRGFAITMGLSILISMFTAISIVRAMMIFI-----------IRYKKMKSIDIN 526
           GG      R F+IT+  ++ +S+  A+ +  A+   +            +       +  
Sbjct: 460 GGSTGVIYRQFSITIVSAMALSVIVALILTPALCATMLKPIEKGDHGEHKGGFFGWFNRM 519

Query: 527 PLSRFFLIPDCIAIQFMRARFWGVGISILFSICSICLLFTHGLNYGIDFKGGIQLGVLAN 586
            LS        +A        + +   ++ +                + +G +   V   
Sbjct: 520 FLSTTHGYERGVASILKHRAPYLLIYVVIVAGMIWMFTRIPTAFLPDEDQGVLFAQVQTP 579

Query: 587 RPVDLSVVRSNLESLQIGDISFQNFDGEKNFLVRLQYQPGDSVAQTRVLEMVKKKITEIV 646
                   +  ++S++   +  ++      F V      G   +      M+K       
Sbjct: 580 PGSSAERTQVVVDSMREYLLEKESSSVSSVFTVTGFNFAGRGQSSGMAFIMLKPWEERPG 639

Query: 647 PLSTIQNTEIVGPKISRELIRKGIVG 672
             +++                  +  
Sbjct: 640 GENSVFELAKRAQMHFFSFKDAMVFA 665


gi|31615949|pdb|1OY6|A Chain A, Structural Basis Of The Multiple Binding Capacity Of The Acrb Multidrug Efflux Pump Length = 1049 Back     alignment and structure
>gi|126031026|pdb|2J8S|A Chain A, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 1055 Back     alignment and structure
>gi|116667260|pdb|2GIF|A Chain A, Asymmetric Structure Of Trimeric Acrb From Escherichia Coli Length = 1057 Back