254780926

254780926

hypothetical protein CLIBASIA_04125

GeneID in NCBI database:8209947Locus tag:CLIBASIA_04125
Protein GI in NCBI database:254780926Protein Accession:YP_003065339.1
Gene range:+(911560, 911709)Protein Length:49aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------5
MKIGSNQDDNDDFACGRKKIDAQEERKIRLASMLRKNLHRRKGQARLKN
ccccccccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccccccccccccccccccEccHHHHHHHHHHHHHHHHHHHHcccHHccc
mkigsnqddnddfacgrkkiDAQEERKIRLASMLRKNLHRRKGQARLKN
mkigsnqddnddfacgrkkidaqeeRKIRLAsmlrknlhrrkgqarlkn
MKIGSNQDDNDDFACGRKKIDAQEERKIRLASMLRKNLHRRKGQARLKN
*************************RKIRLASML***************
********DNDDFACGRKKIDAQEERKIRLASMLRKNL***********
**********DDFACGRKKIDAQEERKIRLASMLRKNLHRRK*******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooo
ooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIGSNQDDNDDFACGRKKIDAQEERKIRLASMLRKNLHRRKGQARLKN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target49 hypothetical protein CLIBASIA_04125 [Candidatus Liberib
31512264850 hypothetical protein CKC_04500 [Candidatus Liberibacter 1 1e-05
>gi|315122648|ref|YP_004063137.1| hypothetical protein CKC_04500 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 50 Back     alignment and organism information
 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%)

Query: 14 ACGRKKIDAQEERKIRLASMLRKNLHRRKGQARLKN 49
          +  RKK+D QEERKIRLA MLRKNL RRK QARLK+
Sbjct: 15 SAKRKKVDVQEERKIRLAYMLRKNLRRRKDQARLKD 50


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00