254780941

254780941

GTP-binding protein Era

GeneID in NCBI database:8209963Locus tag:CLIBASIA_04200
Protein GI in NCBI database:254780941Protein Accession:YP_003065354.1
Gene range:+(930563, 931498)Protein Length:311aa
Gene description:GTP-binding protein Era
COG prediction:[R] GTPase
KEGG prediction:era; GTP-binding protein Era; K03595 GTP-binding protein Era
SEED prediction:GTP-binding protein Era
Pathway involved in KEGG:not defined
Subsystem involved in SEED:tRNA modification Archaea;
Bacterial Cell Division;
Universal GTPases
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-
MEMGEITFFNEHKDFVQDNSRSGCVALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEKESQIVFLDTPGIFNAKDSYHKLMIRLSWSTIKHADIVCLVVDSHRELKVNIHDLLKEIAKRSSRLILILNKIDCVKPERLLEQAEIANKLVFIEKTFMVSATKGHGCDDVLNYLCSTLPLAPWVYSADQISDLPMFHFTAEITREKLFLHLHKEIPYSSCVVTEKWEEKKDGSILIRQVIYVERPSQKKIMLGKNGQNIKTISLEAKKEIAEILEQPVHLILFVKVQKDWGHDPKCCPQREIF
ccHHHHHHcccHHHHHHHcccccEEEEEccccccHHHHHHHHHccccEEEEccccEEEEEEEEEEEEccEEEEEEEcccHHHccHHHHHHHHHHHHHHHHcccEEEEEEEccccccHHHHHHHHHHHHHcccEEEEEEccccccHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEcccccEEEEEEEEEEccccEEEEEcccHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEcccccccHHHHHHcccc
ccccccccccccccccccccEEEEEEEEccccccHHHHHHHHHcccEEEcccccccccccEEEEEEEccEEEEEEccccccccHHHHHHHHHHHHHHHHccccEEEEEEEccccccccHHHHHHHHHHccccEEEEEEEcccccHHHHHHHHHHHHHHcccccEEEccccccccHHHHHHHHHccccEccccccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEccccccEEEEEEEEEccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccccHHHHcccccccc
memgeitffnehkdfvqdnsrSGCVALVGatnagkstLVNRFVGAKVSIVTHKVQTTRSIVRGIVsekesqivfldtpgifnakdSYHKLMIRLSWSTIKHADIVCLVVDSHRELKVNIHDLLKEIAKRSSRLILILNkidcvkpeRLLEQAEIANKLVFIEKTFMVsatkghgcddVLNYLCstlplapwvysadqisdlpmfhfTAEITREKLFLHLhkeipysscvvtekweekkdgsiLIRQVIYverpsqkkimlgkngqniKTISLEAKKEIAEILEQPVHLILFVKVQkdwghdpkccpqreif
MEMGEITFFNEHKDFVQDNSRSGCVALVGAtnagkstlvnrFVGAkvsivthkvqttrsivrgivsekesqivfldtpgifnakDSYHKLMIRLSWSTIKHADIVCLVVDSHRELKVNIHDLLKEIAKRSSRLILILNKIDCVKPERLLEQAEIANKLVFIEKTFMVSATKGHGCDDVLNYLCSTLPLAPWVYSADQISDLPMFHFTAEITREKLFLHLHKEipysscvvtekweekkdgsilirqviyverpsqkkimlgkngqniKTISLEAKKEIAEILEQPVHLILFVKVQKDWGHDPKCCPQREIF
MEMGEITFFNEHKDFVQDNSRSGCVALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEKESQIVFLDTPGIFNAKDSYHKLMIRLSWSTIKHADIVCLVVDSHRELKVNIHDLLKEIAKRSSRLILILNKIDCVKPERLLEQAEIANKLVFIEKTFMVSATKGHGCDDVLNYLCSTLPLAPWVYSADQISDLPMFHFTAEITREKLFLHLHKEIPYSSCVVTEKWEEKKDGSILIRQVIYVERPSQKKIMLGKNGQNIKTISLEAKKEIAEILEQPVHLILFVKVQKDWGHDPKCCPQREIF
**********************GCVALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEKESQIVFLDTPGIFNAKDSYHKLMIRLSWSTIKHADIVCLVVDSHRELKVNIHDLLKEIAKRSSRLILILNKIDCVKPERLLEQAEIANKLVFIEKTFMVSATKGHGCDDVLNYLCSTLPLAPWVYSADQISDLPMFHFTAEITREKLFLHLHKEIPYSSCVVTEKWEEKKDGSILIRQVIYVERPSQKKIMLGKNGQNIKTISLEAKKEIAEILEQPVHLILFVKVQKDWGHDPKCC*QR***
MEMGEITFFNEHKDFVQDNSRSGCVALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEKESQIVFLDTPGIFNAKDSYHKLMIRLSWSTIKHADIVCLVVDSHRELKVNIHDLLKEIAKRSSRLILILNKIDCVKPERLLEQAEIANKLVFIEKTFMVSATKGHGCDDVLNYLCSTLPLAPWVYSADQISDLPMFHFTAEITREKLFLHLHKEIPYSSCVVTEKWEEKKDGSILIRQVIYVERPSQKKIMLGKNGQNIKTISLEAKKEIAEILEQPVHLILFVKVQKDWGHDPKCCPQREIF
****************QDNSRSGCVALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEKESQIVFLDTPGIFNAKDSYHKLMIRLSWSTIKHADIVCLVVDSHRELKVNIHDLLKEIAKRSSRLILILNKIDCVKPERLLEQAEIANKLVFIEKTFMVSATKGHGCDDVLNYLCSTLPLAPWVYSADQISDLPMFHFTAEITREKLFLHLHKEIPYSSCVVTEKWEEKKDGSILIRQVIYVERPSQKKIMLGKNGQNIKTISLEAKKEIAEILEQPVHLILFVKVQKDWGHDPKCCPQR***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEMGEITFFNEHKDFVQDNSRSGCVALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEKESQIVFLDTPGIFNAKDSYHKLMIRLSWSTIKHADIVCLVVDSHRELKVNIHDLLKEIAKRSSRLILILNKIDCVKPERLLEQAEIANKLVFIEKTFMVSATKGHGCDDVLNYLCSTLPLAPWVYSADQISDLPMFHFTAEITREKLFLHLHKEIPYSSCVVTEKWEEKKDGSILIRQVIYVERPSQKKIMLGKNGQNIKTISLEAKKEIAEILEQPVHLILFVKVQKDWGHDPKCCPQREIF
MEMGEITFFNEHKDFVQDNSRSGCVALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEKESQIVFLDTPGIFNAKDSYHKLMIRLSWSTIKHADIVCLVVDSHRELKVNIHDLLKEIAKRSSRLILILNKIDCVKPERLLEQAEIANKLVFIEKTFMVSATKGHGCDDVLNYLCSTLPLAPWVYSADQISDLPMFHFTAEITREKLFLHLHKEIPYSSCVVTEKWEEKKDGSILIRQVIYVERPSQKKIMLGKNGQNIKTISLEAKKEIAEILEQPVHLILFVKVQKDWGHDPKCCPQREIF
MEMGEITFFNEHKDFVQDNSRSGCVALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEKESQIVFLDTPGIFNAKDSYHKLMIRLSWSTIKHADIVCLVVDSHRELKVNIHDLLKEIAKRSSRLILILNKIDCVKPERLLEQAEIANKLVFIEKTFMVSATKGHGCDDVLNYLCSTLPLAPWVYSADQISDLPMFHFTAEITREKLFLHLHKEIPYSSCVVTEKWEEKKDGSILIRQVIYVERPSQKKIMLGKNGQNIKTISLEAKKEIAEILEQPVHLILFVKVQKDWGHDPKCCPQREIF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

IdentityAlignment graphLength Definition E-value
Target311 GTP-binding protein Era [Candidatus Liberibacter asiati
255764471 470 GTP-binding protein EngA [Candidatus Liberibacter 2e-08
255764471470 GTP-binding protein EngA [Candidatus Liberibacter 5e-06
254780809440 tRNA modification GTPase TrmE [Candidatus Liberiba 6e-06
254780648335 GTPase ObgE [Candidatus Liberibacter asiaticus str 5e-05
254780484212 GTPase EngB [Candidatus Liberibacter asiaticus str 0.002
254780321 606 GTP-binding protein LepA [Candidatus Liberibacter 0.007
>gi|255764471|ref|YP_003064835.2| GTP-binding protein EngA [Candidatus Liberibacter asiaticus str. psy62] Length = 470 Back     alignment 
 Score = 51.6 bits (122), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 66/131 (50%), Gaps = 13/131 (9%)

Query: 24  CVALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTR------SIVRGIVSEKESQIVFLDT 77
            +A+VGA N GKSTL NR V  K+++V +    TR      +I+ G++         +DT
Sbjct: 4   TIAIVGAPNVGKSTLFNRLVKKKMAVVGNHPGITRDRLYGQAIINGVIFN------IVDT 57

Query: 78  PGIFNAKD-SYHKLMIRLSWSTIKHADIVCLVVDSHRELKVNIHDLLKEIAKRSSRLILI 136
            GI + K+ S  K M   +   I  A ++  ++DS   +    H +   + K++  +I++
Sbjct: 58  AGIADGKNCSIAKQMNDQTELAINEAHLILFLIDSKAGITPYDHAITSFLRKKNIPIIIV 117

Query: 137 LNKIDCVKPER 147
            NK+D    +R
Sbjct: 118 SNKMDTRIAQR 128
>gi|255764471|ref|YP_003064835.2| GTP-binding protein EngA [Candidatus Liberibacter asiaticus str. psy62] Length = 470 Back     alignment 
 Score = 43.1 bits (100), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 42/177 (23%), Positives = 78/177 (44%), Gaps = 8/177 (4%)

Query: 11  EHKDFVQDNSRSGCVALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEKES 70
           E K  V++ S+   +A+VG  N GKSTL+NR +G    +   +   TR  V    + K  
Sbjct: 192 EGKSSVKNISKPLRIAVVGRPNVGKSTLINRLLGYNRLLTGSQSGITRDSVSISWNWKNH 251

Query: 71  QIVFLDTPGIFNAK---DSYHKLMIRLSWSTIKHADIVCLVVDSHRELKVNIHDLLKEIA 127
            I   DT G+       +S  +  ++ S  +++  +   +++D+    +     ++  + 
Sbjct: 252 PIEIFDTAGMRKPSRITESLEQKTVKKSMQSVRTCETTIVLLDATIPFEKQDLRIVDSVF 311

Query: 128 KRSSRLILILNKIDCVKPERLLEQ---AEIANKLVFIEKTFM--VSATKGHGCDDVL 179
                ++L LNK D V  +  L Q    +    L  I   ++  +S   G G DD++
Sbjct: 312 NTGHAVVLALNKWDMVSDKLNLLQDLRTKAIKNLPQIGDIYINTISGRTGEGLDDLM 368
>gi|254780809|ref|YP_003065222.1| tRNA modification GTPase TrmE [Candidatus Liberibacter asiaticus str. psy62] Length = 440 Back     alignment 
 Score = 43.1 bits (100), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 51/93 (54%), Gaps = 2/93 (2%)

Query: 25  VALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEKESQIVFLDTPGIFNAK 84
           + ++G +NAGKS+L N      V+IVT    TTR ++   +  +   +   DT GI    
Sbjct: 222 IVILGHSNAGKSSLFNALAKKDVAIVTDIPGTTRDVLTIDLDLEGYLVKISDTAGIRETD 281

Query: 85  DSYHKLMIRLSWSTIKHADIVCLV--VDSHREL 115
           D   K  I+ ++  +++AD++ L+  ++S +E+
Sbjct: 282 DIVEKEGIKRTFLEVENADLILLLKEINSKKEI 314
>gi|254780648|ref|YP_003065061.1| GTPase ObgE [Candidatus Liberibacter asiaticus str. psy62] Length = 335 Back     alignment 
 Score = 40.0 bits (92), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 71/164 (43%), Gaps = 9/164 (5%)

Query: 25  VALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVRGIVSEKESQIVFLDTPGIFNAK 84
           + ++G  NAGKST +     AK  I  +   TT     GIV E   + +  D PGI    
Sbjct: 162 IGIIGLPNAGKSTFLASVTRAKPKIADYPF-TTLYPNLGIVKEGYKEFILADIPGIIKNA 220

Query: 85  DSYHKLMIRLSWSTIKHADIVCLVVDSHRELKVNIHDLLKEIAKRSSRL-----ILILNK 139
                +  R    T +   ++ +V      ++     +L E++  +S L     I+ L++
Sbjct: 221 HQGAGIGDRFLKHTERTHVLLHIVSALEENVQAAYQCILDELSAYNSELRKKIEIVGLSQ 280

Query: 140 IDCVKPERLL-EQAEIANKLVFIEKTFMVSATKGHGCDDVLNYL 182
           ID V  + L  ++ E+A +   +   F  S+  GHG   +L  L
Sbjct: 281 IDTVDSDTLARKKNELATQCGQV--PFEFSSITGHGIPQILECL 322
>gi|254780484|ref|YP_003064897.1| GTPase EngB [Candidatus Liberibacter asiaticus str. psy62] Length = 212 Back     alignment 
 Score = 34.7 bits (78), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 65/150 (43%), Gaps = 18/150 (12%)

Query: 25  VALVGATNAGKSTLVNRFVG----AKVSIVTHKVQTTRSIVRGIVSEKESQI---VFLDT 77
           +A  G +N GKS+L+N  V     A+ S    + Q     V    S  ++ +     +D 
Sbjct: 32  IAFSGRSNVGKSSLINILVNRKNLARTSNAPGRTQHLNFFVPKDFSNLKNNLPAMALVDM 91

Query: 78  PGIFNAK------DSYHKLMIRL--SWSTIKHADIVCLVVDSHRELKVNIHDLLKEIAKR 129
           PG   A+      DS+  L++R     ST++    V L++D    +K    D+   + K+
Sbjct: 92  PGYGYARAPKKNVDSWGGLIVRYLSERSTLR---CVYLLIDCRHGVKQIDQDVFSFLDKK 148

Query: 130 SSRLILILNKIDCVKPERLLEQAEIANKLV 159
           +    ++L KID + P    E  E    L+
Sbjct: 149 AVSYQIVLTKIDKLSPTTAQETLEKTKYLI 178
>gi|254780321|ref|YP_003064734.1| GTP-binding protein LepA [Candidatus Liberibacter asiaticus str. psy62] Length = 606 Back     alignment 
 Score = 32.7 bits (73), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 78/190 (41%), Gaps = 32/190 (16%)

Query: 20  SRSGCVALVGATNAGKSTLVNRFVG--------------------AKVSIVTHKVQTTRS 59
           SR    ++V   + GKSTL +RF+                      +   +T K QT R 
Sbjct: 9   SRIRNFSIVAHIDHGKSTLADRFIQHCRGLTEREMSSQVLDNMDIERERGITIKAQTVR- 67

Query: 60  IVRGIVSEKESQIVFLDTPGIFNAKDSYHKLMIRLSWSTIKHADIVCLVVDSHRELKVNI 119
           +       K+ Q+  +DTPG  +   +Y    +  S S  + +    LVVD+ + ++   
Sbjct: 68  LNYTSTDAKDYQLNLIDTPG--HVDFTYE---VSRSLSACEGS---LLVVDATQGVEAQT 119

Query: 120 HDLLKEIAKRSSRLILILNKID--CVKPERLLEQAEIANKLVFIEKTFMVSATKGHGCDD 177
              + +    +  +I +LNK D     P+R+ +Q E     +  E   +VSA  G G   
Sbjct: 120 LANVYQAIDNNHEIITVLNKADLPSADPDRVKKQIE-ETIGISTEDALLVSAKTGEGIPL 178

Query: 178 VLNYLCSTLP 187
           +L  +   LP
Sbjct: 179 LLERIVQQLP 188

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target311 GTP-binding protein Era [Candidatus Liberibacter asiati
315122354310 GTP-binding protein Era [Candidatus Liberibacter solana 1 1e-143
307300896309 GTP-binding protein Era [Sinorhizobium meliloti BL225C] 1 4e-96
15964826313 GTP-binding protein Era [Sinorhizobium meliloti 1021] L 1 4e-96
25008423317 RecName: Full=GTPase Era Length = 317 1 1e-95
227821404309 GTP-binding protein Era [Sinorhizobium fredii NGR234] L 1 2e-95
159184589313 GTP-binding protein Era [Agrobacterium tumefaciens str. 1 2e-95
150395907310 GTP-binding protein Era [Sinorhizobium medicae WSM419] 1 2e-95
325292415316 GTP-binding protein Era [Agrobacterium sp. H13-3] Lengt 1 3e-95
86357029313 GTP-binding protein Era [Rhizobium etli CFN 42] Length 1 1e-94
222148082327 GTP-binding protein Era [Agrobacterium vitis S4] Length 1 4e-94
>gi|315122354|ref|YP_004062843.1| GTP-binding protein Era [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 310 Back     alignment and organism information
 Score =  511 bits (1317), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 244/305 (80%), Positives = 274/305 (89%)

Query: 3   MGEITFFNEHKDFVQDNSRSGCVALVGATNAGKSTLVNRFVGAKVSIVTHKVQTTRSIVR 62
           M EI F NEH   V+  +RSGCVALVGATNAGKSTLVN+FVGAKVSIVTHKVQTTRSIVR
Sbjct: 1   MSEIVFSNEHNGLVEYKTRSGCVALVGATNAGKSTLVNKFVGAKVSIVTHKVQTTRSIVR 60

Query: 63  GIVSEKESQIVFLDTPGIFNAKDSYHKLMIRLSWSTIKHADIVCLVVDSHRELKVNIHDL 122
           GIVSEK+ Q+VFLDTPGIF AKDSYHK+MIRLSWST+KHADIV LV+DS+R L+ ++HD+
Sbjct: 61  GIVSEKDVQVVFLDTPGIFKAKDSYHKMMIRLSWSTVKHADIVFLVIDSNRGLQPDVHDI 120

Query: 123 LKEIAKRSSRLILILNKIDCVKPERLLEQAEIANKLVFIEKTFMVSATKGHGCDDVLNYL 182
           LKEI KRS RL+LILNKIDCVKPERLLEQAEI NKLV +EKTFMVSA KGHGC DVLNYL
Sbjct: 121 LKEIGKRSGRLVLILNKIDCVKPERLLEQAEIINKLVCVEKTFMVSALKGHGCQDVLNYL 180

Query: 183 CSTLPLAPWVYSADQISDLPMFHFTAEITREKLFLHLHKEIPYSSCVVTEKWEEKKDGSI 242
            STLP+ PW+YS DQ+SDLPMFHF AEITREKLFLHLH+EIPYSS V TEKWEE+KDGS+
Sbjct: 181 YSTLPVGPWIYSPDQVSDLPMFHFAAEITREKLFLHLHQEIPYSSHVKTEKWEERKDGSL 240

Query: 243 LIRQVIYVERPSQKKIMLGKNGQNIKTISLEAKKEIAEILEQPVHLILFVKVQKDWGHDP 302
           LIRQVIY+ER +QKKI+LGKNGQNIK ISLEA++EIAEILEQ VHL++FVKVQK+WG+DP
Sbjct: 241 LIRQVIYIERSNQKKIILGKNGQNIKIISLEARREIAEILEQVVHLVIFVKVQKNWGNDP 300

Query: 303 KCCPQ 307
           K   Q
Sbjct: 301 KYLSQ 305



Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|307300896|ref|ZP_07580665.1| GTP-binding protein Era [Sinorhizobium meliloti BL225C] Length = 309 Back     alignment and organism information
>gi|15964826|ref|NP_385179.1| GTP-binding protein Era [Sinorhizobium meliloti 1021] Length = 313 Back     alignment and organism information
>gi|25008423|sp|Q8UGK1|ERA_AGRT5 RecName: Full=GTPase Era Length = 317 Back     alignment and organism information
>gi|227821404|ref|YP_002825374.1| GTP-binding protein Era [Sinorhizobium fredii NGR234] Length = 309 Back     alignment and organism information
>gi|159184589|ref|NP_354059.2| GTP-binding protein Era [Agrobacterium tumefaciens str. C58] Length = 313 Back     alignment and organism information
>gi|150395907|ref|YP_001326374.1| GTP-binding protein Era [Sinorhizobium medicae WSM419] Length = 310 Back     alignment and organism information
>gi|325292415|ref|YP_004278279.1| GTP-binding protein Era [Agrobacterium sp. H13-3] Length = 316 Back     alignment and organism information
>gi|86357029|ref|YP_468921.1| GTP-binding protein Era [Rhizobium etli CFN 42] Length = 313 Back     alignment and organism information
>gi|222148082|ref|YP_002549039.1| GTP-binding protein Era [Agrobacterium vitis S4] Length = 327 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target311 GTP-binding protein Era [Candidatus Liberibacter asiati
PRK00089292 PRK00089, era, GTPase Era; Reviewed 1e-101
PRK15494339 PRK15494, era, GTPase Era; Provisional 4e-63
KOG1423379 KOG1423, KOG1423, KOG1423, Ras-like GTPase ERA [Cell cy 1e-53
TIGR00436270 TIGR00436, era, GTP-binding protein Era 7e-50
COG1159298 COG1159, Era, GTPase [General function prediction only] 1e-84
cd04163168 cd04163, Era, Era subfamily 6e-50
cd00880163 cd00880, Era_like, Era (E 1e-21
cd04164157 cd04164, trmE, TrmE (MnmE, ThdF, MSS1) is a 3-domain pr 5e-21
PRK05291449 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed 6e-21
COG0486454 COG0486, ThdF, Predicted GTPase [General function predi 3e-20
TIGR03594 429 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA 1e-19
COG1160 444 COG1160, COG1160, Predicted GTPases [General function p 7e-18
TIGR03594429 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA 4e-17
PRK00093 435 PRK00093, PRK00093, GTP-binding protein Der; Reviewed 1e-16
cd01894157 cd01894, EngA1, EngA1 subfamily 2e-16
cd01878204 cd01878, HflX, HflX subfamily 2e-14
KOG1191531 KOG1191, KOG1191, KOG1191, Mitochondrial GTPase [Transl 2e-14
TIGR00450442 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase Trm 2e-14
cd01895174 cd01895, EngA2, EngA2 subfamily 3e-14
COG2262411 COG2262, HflX, GTPases [General function prediction onl 4e-14
cd00882157 cd00882, Ras_like_GTPase, Ras-like GTPase superfamily 2e-13
PRK00093435 PRK00093, PRK00093, GTP-binding protein Der; Reviewed 2e-13
COG1160444 COG1160, COG1160, Predicted GTPases [General function p 3e-13
cd01881176 cd01881, Obg_like, The Obg-like subfamily consists of f 1e-12
TIGR03156351 TIGR03156, GTP_HflX, GTP-binding protein HflX 3e-11
cd01897168 cd01897, NOG, NOG1 is a nucleolar GTP-binding protein p 5e-11
COG0536369 COG0536, Obg, Predicted GTPase [General function predic 5e-11
TIGR00231161 TIGR00231, small_GTP, small GTP-binding protein domain 1e-10
COG1084346 COG1084, COG1084, Predicted GTPase [General function pr 2e-10
cd01898170 cd01898, Obg, Obg subfamily 4e-10
PRK09518 712 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPa 1e-09
PRK03003 472 PRK03003, PRK03003, GTP-binding protein Der; Reviewed 2e-09
cd01876170 cd01876, YihA_EngB, The YihA (EngB) subfamily 2e-08
KOG1489366 KOG1489, KOG1489, KOG1489, Predicted GTP-binding protei 4e-08
PRK00454196 PRK00454, engB, GTP-binding protein YsxC; Reviewed 5e-08
COG0370 653 COG0370, FeoB, Fe2+ transport system protein B [Inorgan 9e-08
PRK09518712 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPa 1e-07
PRK12299335 PRK12299, obgE, GTPase CgtA; Reviewed 2e-07
TIGR02729329 TIGR02729, Obg_CgtA, Obg family GTPase CgtA 5e-07
PRK03003472 PRK03003, PRK03003, GTP-binding protein Der; Reviewed 1e-06
COG3596296 COG3596, COG3596, Predicted GTPase [General function pr 2e-06
TIGR03598179 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-binding 4e-06
KOG0410410 KOG0410, KOG0410, KOG0410, Predicted GTP binding protei 5e-06
pfam00009185 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding d 7e-06
COG0218200 COG0218, COG0218, Predicted GTPase [General function pr 8e-06
PRK12298390 PRK12298, obgE, GTPase CgtA; Reviewed 1e-05
cd00154159 cd00154, Rab, Rab family 6e-05
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G prote 9e-05
KOG1145 683 KOG1145, KOG1145, KOG1145, Mitochondrial translation in 1e-04
pfam10662143 pfam10662, PduV-EutP, Ethanolamine utilisation - propan 1e-04
KOG0468 971 KOG0468, KOG0468, KOG0468, U5 snRNP-specific protein [T 2e-04
cd04155173 cd04155, Arl3, Arl3 subfamily 2e-04
cd00881189 cd00881, GTP_translation_factor, GTP translation factor 3e-04
pfam00025174 pfam00025, Arf, ADP-ribosylation factor family 5e-04
TIGR02528142 TIGR02528, EutP, ethanolamine utilization protein, EutP 7e-04
cd01879158 cd01879, FeoB, Ferrous iron transport protein B (FeoB) 0.002
pfam02421188 pfam02421, FeoB_N, Ferrous iron transport protein B 0.002
cd00878158 cd00878, Arf_Arl, Arf (ADP-ribosylation factor)/Arl (Ar 0.002
COG0532 509 COG0532, InfB, Translation initiation factor 2 (IF-2; G 0.003
KOG0395196 KOG0395, KOG0395, KOG0395, Ras-related GTPase [General 0.003
TIGR00437 591 TIGR00437, feoB, ferrous iron transporter FeoB 0.004
pfam01926106 pfam01926, MMR_HSR1, GTPase of unknown function 2e-20
COG1163365 COG1163, DRG, Predicted GTPase [General function predic 9e-09
cd01896233 cd01896, DRG, The developmentally regulated GTP-binding 1e-07
PRK11058426 PRK11058, PRK11058, GTPase HflX; Provisional 3e-06
pfam00350168 pfam00350, Dynamin_N, Dynamin family 1e-05
KOG1486364 KOG1486, KOG1486, KOG1486, GTP-binding protein DRG2 (OD 2e-04
cd04167213 cd04167, Snu114p, Snu114p subfamily 8e-04
cd01856171 cd01856, YlqF, YlqF 4e-06
COG1161322 COG1161, COG1161, Predicted GTPases [General function p 8e-06
TIGR03596276 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding 4e-05
PRK09563287 PRK09563, rbgA, GTPase YlqF; Reviewed 3e-04
cd01855190 cd01855, YqeH, YqeH 0.001
pfam04548200 pfam04548, AIG1, AIG1 family 0.002
PRK01889356 PRK01889, PRK01889, GTPase RsgA; Reviewed 0.003
pfam0765055 pfam07650, KH_2, KH domain 1e-04
cd04171164 cd04171, SelB, SelB subfamily 2e-04
PRK13657588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transpor 0.001
KOG1954 532 KOG1954, KOG1954, KOG1954, Endocytosis/signaling protei 0.003
>gnl|CDD|178854 PRK00089, era, GTPase Era; Reviewed Back     alignment and domain information
>gnl|CDD|185391 PRK15494, era, GTPase Era; Provisional Back     alignment and domain information
>gnl|CDD|36637 KOG1423, KOG1423, KOG1423, Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning, Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|129528 TIGR00436, era, GTP-binding protein Era Back     alignment and domain information
>gnl|CDD|31353 COG1159, Era, GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|133363 cd04163, Era, Era subfamily Back     alignment and domain information
>gnl|CDD|133256 cd00880, Era_like, Era (E Back     alignment and domain information
>gnl|CDD|133364 cd04164, trmE, TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>gnl|CDD|179996 PRK05291, trmE, tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>gnl|CDD|30833 COG0486, ThdF, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|163343 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|31354 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|163343 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|178858 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|133294 cd01894, EngA1, EngA1 subfamily Back     alignment and domain information
>gnl|CDD|133279 cd01878, HflX, HflX subfamily Back     alignment and domain information
>gnl|CDD|36405 KOG1191, KOG1191, KOG1191, Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161885 TIGR00450, mnmE_trmE_thdF, tRNA modification GTPase TrmE Back     alignment and domain information
>gnl|CDD|133295 cd01895, EngA2, EngA2 subfamily Back     alignment and domain information
>gnl|CDD|32443 COG2262, HflX, GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|133258 cd00882, Ras_like_GTPase, Ras-like GTPase superfamily Back     alignment and domain information
>gnl|CDD|178858 PRK00093, PRK00093, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|31354 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|133281 cd01881, Obg_like, The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>gnl|CDD|163162 TIGR03156, GTP_HflX, GTP-binding protein HflX Back     alignment and domain information
>gnl|CDD|133297 cd01897, NOG, NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>gnl|CDD|30882 COG0536, Obg, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|161778 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|31281 COG1084, COG1084, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|133298 cd01898, Obg, Obg subfamily Back     alignment and domain information
>gnl|CDD|181925 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>gnl|CDD|179525 PRK03003, PRK03003, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|133278 cd01876, YihA_EngB, The YihA (EngB) subfamily Back     alignment and domain information
>gnl|CDD|36702 KOG1489, KOG1489, KOG1489, Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|179035 PRK00454, engB, GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>gnl|CDD|30719 COG0370, FeoB, Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|181925 PRK09518, PRK09518, bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>gnl|CDD|183417 PRK12299, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|162989 TIGR02729, Obg_CgtA, Obg family GTPase CgtA Back     alignment and domain information
>gnl|CDD|179525 PRK03003, PRK03003, GTP-binding protein Der; Reviewed Back     alignment and domain information
>gnl|CDD|33396 COG3596, COG3596, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|163346 TIGR03598, GTPase_YsxC, ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>gnl|CDD|35631 KOG0410, KOG0410, KOG0410, Predicted GTP binding protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|143801 pfam00009, GTP_EFTU, Elongation factor Tu GTP binding domain Back     alignment and domain information
>gnl|CDD|30567 COG0218, COG0218, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|183416 PRK12298, obgE, GTPase CgtA; Reviewed Back     alignment and domain information
>gnl|CDD|133250 cd00154, Rab, Rab family Back     alignment and domain information
>gnl|CDD|31297 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|36360 KOG1145, KOG1145, KOG1145, Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|151168 pfam10662, PduV-EutP, Ethanolamine utilisation - propanediol utilisation Back     alignment and domain information
>gnl|CDD|35689 KOG0468, KOG0468, KOG0468, U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|133355 cd04155, Arl3, Arl3 subfamily Back     alignment and domain information
>gnl|CDD|133257 cd00881, GTP_translation_factor, GTP translation factor family Back     alignment and domain information
>gnl|CDD|143815 pfam00025, Arf, ADP-ribosylation factor family Back     alignment and domain information
>gnl|CDD|131580 TIGR02528, EutP, ethanolamine utilization protein, EutP Back     alignment and domain information
>gnl|CDD|133280 cd01879, FeoB, Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>gnl|CDD|145523 pfam02421, FeoB_N, Ferrous iron transport protein B Back     alignment and domain information
>gnl|CDD|133254 cd00878, Arf_Arl, Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>gnl|CDD|30878 COG0532, InfB, Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35616 KOG0395, KOG0395, KOG0395, Ras-related GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|161878 TIGR00437, feoB, ferrous iron transporter FeoB Back     alignment and domain information
>gnl|CDD|145217 pfam01926, MMR_HSR1, GTPase of unknown function Back     alignment and domain information
>gnl|CDD|31357 COG1163, DRG, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|133296 cd01896, DRG, The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>gnl|CDD|182934 PRK11058, PRK11058, GTPase HflX; Provisional Back     alignment and domain information
>gnl|CDD|144080 pfam00350, Dynamin_N, Dynamin family Back     alignment and domain information
>gnl|CDD|36699 KOG1486, KOG1486, KOG1486, GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|133367 cd04167, Snu114p, Snu114p subfamily Back     alignment and domain information
>gnl|CDD|57927 cd01856, YlqF, YlqF Back     alignment and domain information
>gnl|CDD|31355 COG1161, COG1161, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|163345 TIGR03596, GTPase_YlqF, ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>gnl|CDD|181957 PRK09563, rbgA, GTPase YlqF; Reviewed Back     alignment and domain information
>gnl|CDD|57926 cd01855, YqeH, YqeH Back     alignment and domain information
>gnl|CDD|146942 pfam04548, AIG1, AIG1 family Back     alignment and domain information
>gnl|CDD|179346 PRK01889, PRK01889, GTPase RsgA; Reviewed Back     alignment and domain information
>gnl|CDD|116265 pfam07650, KH_2, KH domain Back     alignment and domain information
>gnl|CDD|133371 cd04171, SelB, SelB subfamily Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|37165 KOG1954, KOG1954, KOG1954, Endocytosis/signaling protein EHD1 [Signal transduction mechanisms, Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 311 GTP-binding protein Era [Candidatus Liberibacter asiati
COG1159298 Era GTPase [General function prediction only] 100.0
PRK00089296 era GTP-binding protein Era; Reviewed 100.0
KOG1423379 consensus 100.0
TIGR00436278 era GTP-binding protein Era; InterPro: IPR005662 Era is 100.0
PRK09518714 bifunctional cytidylate kinase/GTP-binding protein; Rev 100.0
PRK03003474 engA GTP-binding protein EngA; Reviewed 100.0
TIGR00484 705 EF-G translation elongation factor G; InterPro: IPR0045 98.47
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) is a 100.0
cd01894157 EngA1 EngA1 subfamily. This CD represents the first GTP 100.0
PRK03003 474 engA GTP-binding protein EngA; Reviewed 100.0
PRK00093 438 engA GTP-binding protein EngA; Reviewed 100.0
pfam02421188 FeoB_N Ferrous iron transport protein B. Escherichia co 100.0
PRK09518 714 bifunctional cytidylate kinase/GTP-binding protein; Rev 100.0
cd01895174 EngA2 EngA2 subfamily. This CD represents the second GT 100.0
COG1160 444 Predicted GTPases [General function prediction only] 100.0
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein foun 100.0
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 100.0
PRK00454196 engB GTPase EngB; Reviewed 100.0
PRK00093438 engA GTP-binding protein EngA; Reviewed 100.0
cd01898170 Obg Obg subfamily. The Obg nucleotide binding protein s 100.0
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This fami 100.0
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein present in 100.0
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfamily. 100.0
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamily of 100.0
PRK04213195 GTP-binding protein; Provisional 100.0
PRK05291445 trmE tRNA modification GTPase TrmE; Reviewed 100.0
pfam10662143 PduV-EutP Ethanolamine utilisation - propanediol utilis 100.0
COG0486454 ThdF Predicted GTPase [General function prediction only 100.0
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protein Ysx 100.0
cd01881176 Obg_like The Obg-like subfamily consists of five well-d 100.0
cd01878204 HflX HflX subfamily. A distinct conserved domain with a 100.0
COG1160444 Predicted GTPases [General function prediction only] 99.98
cd01896233 DRG The developmentally regulated GTP-binding protein ( 99.97
pfam00009185 GTP_EFTU Elongation factor Tu GTP binding domain. This 99.97
TIGR00450473 thdF tRNA modification GTPase TrmE; InterPro: IPR004520 99.96
cd04171164 SelB SelB subfamily. SelB is an elongation factor neede 99.96
cd00881189 GTP_translation_factor GTP translation factor family. T 99.96
PRK12299334 obgE GTPase ObgE; Reviewed 99.95
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic i 99.95
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein family 99.95
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.93
PRK12296495 obgE GTPase ObgE; Reviewed 99.93
PRK12297429 obgE GTPase ObgE; Reviewed 99.93
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic ion tra 99.93
COG0218200 Predicted GTPase [General function prediction only] 99.93
KOG1489366 consensus 99.91
COG2262411 HflX GTPases [General function prediction only] 99.91
COG1163365 DRG Predicted GTPase [General function prediction only] 99.91
COG0536369 Obg Predicted GTPase [General function prediction only] 99.9
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase family 99.89
PRK12312 610 infB translation initiation factor IF-2; Provisional 99.87
COG1084346 Predicted GTPase [General function prediction only] 99.86
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are memb 99.86
cd01889192 SelB_euk SelB subfamily. SelB is an elongation factor n 99.85
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 99.85
pfam00025174 Arf ADP-ribosylation factor family. Pfam combines a num 99.85
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA 99.84
CHL00189 770 infB translation initiation factor 2; Provisional 99.84
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation fact 99.82
PRK05306 839 infB translation initiation factor IF-2; Validated 99.82
TIGR01393 598 lepA GTP-binding protein LepA; InterPro: IPR006297 LepA 99.81
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) sm 99.81
PRK04004 592 translation initiation factor IF-2; Validated 99.8
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related protein 1) 99.79
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was identif 99.79
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) and Ar 99.78
PRK05433 601 GTP-binding protein LepA; Provisional 99.77
pfam00071162 Ras Ras family. Includes sub-families Ras, Rab, Rac, Ra 99.77
TIGR00475 627 selB selenocysteine-specific translation elongation fac 99.77
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ortholog 99.76
PTZ00133182 ADP-ribosylation factor; Provisional 99.76
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation facto 99.76
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a subfamil 99.75
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase) [Tr 99.75
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 6) p 99.75
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes to the 99.75
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor suppres 99.75
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential component of 99.75
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) is hig 99.74
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor doma 99.74
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily co 99.73
PRK04000410 translation initiation factor IF-2 subunit gamma; Valid 99.73
KOG0462 650 consensus 99.72
PRK10512 615 selenocysteinyl-tRNA-specific translation factor; Provi 99.72
KOG1145 683 consensus 99.72
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding protein 99.71
cd00154159 Rab Rab family. Rab GTPases form the largest family wit 99.71
cd00876160 Ras Ras family. The Ras family of the Ras superfamily i 99.71
PRK10218 607 GTP-binding protein; Provisional 99.71
PRK12317426 elongation factor 1-alpha; Reviewed 99.7
PRK12736394 elongation factor Tu; Reviewed 99.7
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translocatio 99.7
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 (RF3) 99.7
TIGR01394 609 TypA_BipA GTP-binding protein TypA; InterPro: IPR006298 99.69
cd04112191 Rab26 Rab26 subfamily. First identified in rat pancreat 99.69
PTZ00327460 eukaryotic translation initiation factor 2 gamma subuni 99.69
smart00178184 SAR Sar1p-like members of the Ras-family of small GTPas 99.69
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha su 99.69
PRK12735396 elongation factor Tu; Reviewed 99.68
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-li 99.68
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase that co 99.68
PRK00049397 elongation factor Tu; Reviewed 99.68
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associated wi 99.67
cd01860163 Rab5_related Rab5-related subfamily. This subfamily inc 99.67
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the Rap s 99.67
cd04123162 Rab21 Rab21 subfamily. The localization and function of 99.67
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily. Rab 99.67
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) protein 99.67
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) subfa 99.66
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicated in 99.66
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Ypt2 ar 99.66
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associated w 99.66
TIGR02528144 EutP ethanolamine utilization protein, EutP; InterPro: 99.66
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with prot 99.66
CHL00071409 tufA elongation factor Tu 99.66
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases are imp 99.66
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 (Arl2- 99.66
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in numero 99.66
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found primari 99.65
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in fold 99.65
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosomes, t 99.65
PTZ00132209 GTP-binding nuclear protein; Provisional 99.65
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subfamily 99.65
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase that re 99.65
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation requir 99.65
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified in ca 99.65
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the trans 99.65
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, N-Ra 99.65
cd04125188 RabA_like RabA-like subfamily. RabA was first identifie 99.65
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamily. Rh 99.65
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 are 99.65
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was first i 99.65
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily o 99.65
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in many p 99.64
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily o 99.64
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) protein 99.64
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in every e 99.64
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are novel pro 99.64
PTZ00141443 elongation factor 1 alpha; Provisional 99.64
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small GTPa 99.64
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab40a, 99.64
PTZ00336449 elongation factor 1-alpha; Provisional 99.64
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 are cl 99.64
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from other Rab 99.64
cd00157171 Rho Rho (Ras homology) family. Members of the Rho famil 99.63
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized to b 99.63
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab prot 99.63
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains Rab3A, 99.63
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-ventra 99.63
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubule-de 99.63
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golgi mem 99.63
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily consists 99.62
KOG0410410 consensus 99.62
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of several pr 99.62
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily consi 99.62
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog member I) 99.62
PRK05124 475 cysN sulfate adenylyltransferase subunit 1; Provisional 99.61
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of the Ra 99.61
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of the Ra 99.6
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member of th 99.6
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesis, ou 99.6
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related protein fr 99.6
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exclusiv 99.6
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab prot 99.6
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like protei 99.59
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily consists 99.59
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho family 99.59
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfamily 99.59
KOG1490 620 consensus 99.59
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive Cdc42 99.58
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPase tha 99.58
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG (Ras- 99.58
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase famil 99.58
cd04143247 Rhes_like Rhes_like subfamily. This subfamily includes 99.58
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein on ch 99.57
COG3276 447 SelB Selenocysteine-specific translation elongation fac 99.57
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein that 99.57
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high sequenc 99.57
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that plays 99.57
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 is ma 99.57
TIGR00231186 small_GTP small GTP-binding protein domain; InterPro: I 99.56
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is ubiqui 99.56
PRK05506 613 bifunctional sulfate adenylyltransferase subunit 1/aden 99.55
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Kir) su 99.55
TIGR00491 1145 aIF-2 translation initiation factor aIF-2; InterPro: IP 99.54
cd04109215 Rab28 Rab28 subfamily. First identified in maize, Rab28 99.54
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1/Rho6 99.54
COG5256428 TEF1 Translation elongation factor EF-1alpha (GTPase) [ 99.54
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 (Arf- 99.53
COG4108 528 PrfC Peptide chain release factor RF-3 [Translation, ri 99.52
TIGR02034411 CysN sulfate adenylyltransferase, large subunit; InterP 99.47
COG1217 603 TypA Predicted membrane GTPase involved in stress respo 99.46
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a member of 99.44
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (alpha, 99.44
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE/Rho8 99.43
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a member of 99.43
KOG1487358 consensus 99.42
COG5257415 GCD11 Translation initiation factor 2, gamma subunit (e 99.42
KOG0092200 consensus 99.41
COG2229187 Predicted GTPase [General function prediction only] 99.4
KOG2486320 consensus 99.39
KOG0073185 consensus 99.38
pfam05049375 IIGP Interferon-inducible GTPase (IIGP). Interferon-ind 99.36
pfam04548200 AIG1 AIG1 family. Arabidopsis protein AIG1 appears to b 99.33
TIGR00503 530 prfC peptide chain release factor 3; InterPro: IPR00454 99.32
KOG0448 749 consensus 99.31
COG1100219 GTPase SAR1 and related small G proteins [General funct 99.3
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB subfamil 99.29
KOG0461 522 consensus 99.28
PRK13768253 GTPase; Provisional 99.28
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 99.26
TIGR00487 594 IF-2 translation initiation factor IF-2; InterPro: IPR0 99.26
COG4917148 EutP Ethanolamine utilization protein [Amino acid trans 99.25
KOG0094221 consensus 99.23
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are novel pro 99.2
TIGR00483 445 EF-1_alpha translation elongation factor EF-1, subunit 99.19
COG2895 431 CysN GTPases - Sulfate adenylate transferase subunit 1 99.18
KOG0078207 consensus 99.17
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represents Ara 99.17
KOG0075186 consensus 99.17
KOG0084205 consensus 99.14
COG5258527 GTPBP1 GTPase [General function prediction only] 99.12
KOG0395196 consensus 99.06
KOG0076197 consensus 99.05
COG0050394 TufB GTPases - translation elongation factors [Translat 99.03
KOG0394210 consensus 99.02
KOG0070181 consensus 99.01
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 98.97
KOG0466466 consensus 98.94
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome biog 98.93
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 98.92
KOG0087222 consensus 98.87
KOG0098216 consensus 98.87
PRK10463290 hydrogenase nickel incorporation protein HypB; Provisio 98.78
KOG0080209 consensus 98.78
KOG0095213 consensus 98.77
KOG1707 625 consensus 98.74
KOG0074185 consensus 98.73
KOG0463 641 consensus 98.62
KOG0077193 consensus 98.6
KOG0093193 consensus 98.58
KOG4252246 consensus 98.57
KOG0460449 consensus 98.55
KOG0079198 consensus 98.5
KOG0088218 consensus 98.5
KOG3883198 consensus 98.48
COG0523323 Putative GTPases (G3E family) [General function predict 98.45
KOG0071180 consensus 98.41
KOG0091213 consensus 98.37
KOG0086214 consensus 98.34
KOG0072182 consensus 98.22
pfam02492174 cobW CobW/HypB/UreG, nucleotide-binding domain. This do 98.14
PRK11537317 putative GTP-binding protein YjiA; Provisional 98.11
TIGR02836 492 spore_IV_A stage IV sporulation protein A; InterPro: IP 98.09
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 98.07
KOG0097215 consensus 97.99
KOG1707625 consensus 97.9
TIGR00485394 EF-Tu translation elongation factor Tu; InterPro: IPR00 97.85
TIGR01425453 SRP54_euk signal recognition particle protein SRP54; In 97.78
KOG0459501 consensus 97.77
KOG0083192 consensus 97.76
TIGR00490 724 aEF-2 translation elongation factor aEF-2; InterPro: IP 97.75
KOG0081219 consensus 97.68
KOG0393198 consensus 97.67
TIGR00101199 ureG urease accessory protein UreG; InterPro: IPR004400 97.61
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 97.58
COG3523 1188 IcmF Type VI protein secretion system component VasK [I 97.45
KOG1673205 consensus 97.43
TIGR02475349 CobW cobalamin biosynthesis protein CobW; InterPro: IPR 97.25
pfam03266168 DUF265 Protein of unknown function, DUF265. 97.12
PRK13695174 putative NTPase; Provisional 97.06
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 96.97
KOG0096216 consensus 96.87
PRK10416499 cell division protein FtsY; Provisional 96.71
TIGR02769267 nickel_nikE nickel import ATP-binding protein NikE; Int 96.59
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK 100.0
PRK12298380 obgE GTPase ObgE; Reviewed 99.95
TIGR00437 733 feoB ferrous iron transport protein B; InterPro: IPR003 99.95
KOG1191531 consensus 99.94
PRK11058426 putative GTPase HflX; Provisional 99.94
COG3596296 Predicted GTPase [General function prediction only] 99.73
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Translo 99.69
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 99.38
PRK09435325 arginine/ornithine transport system ATPase; Provisional 99.33
KOG0458603 consensus 99.28
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 99.12
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 99.09
KOG1532366 consensus 98.99
KOG1143591 consensus 98.89
KOG1547336 consensus 98.73
pfam09547 492 Spore_IV_A Stage IV sporulation protein A (spore_IV_A). 97.92
CHL00195491 ycf46 Ycf46; Provisional 96.89
PHA02518211 ParA-like protein; Provisional 96.65
TIGR02729296 Obg_CgtA GTP-binding protein Obg/CgtA; InterPro: IPR014 99.9
pfam01926106 MMR_HSR1 GTPase of unknown function. 99.87
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), Tet(W) 99.74
PRK00741 526 prfC peptide chain release factor 3; Provisional 99.71
PRK12739 693 elongation factor G; Reviewed 99.66
PRK13351 687 elongation factor G; Reviewed 99.62
PRK00007 693 elongation factor G; Reviewed 99.61
PRK12740 670 elongation factor G; Reviewed 99.58
pfam00350168 Dynamin_N Dynamin family. 99.54
PRK07560 730 elongation factor EF-2; Reviewed 99.35
cd04105203 SR_beta Signal recognition particle receptor, beta subu 99.29
COG0480 697 FusA Translation elongation factors (GTPases) [Translat 99.25
pfam08477118 Miro Miro-like protein. Mitochondrial Rho proteins (Mir 99.17
pfam09439181 SRPRB Signal recognition particle receptor beta subunit 99.07
KOG0468 971 consensus 99.0
KOG1954 532 consensus 98.98
KOG0467 887 consensus 98.81
KOG0090238 consensus 98.77
KOG0465 721 consensus 98.76
COG5019373 CDC3 Septin family protein [Cell division and chromosom 98.7
pfam04670230 Gtr1_RagA Gtr1/RagA G protein conserved region. GTR1 wa 98.69
KOG2655366 consensus 98.61
KOG0447 980 consensus 98.59
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate vesicl 98.49
TIGR00991328 3a0901s02IAP34 GTP-binding protein; InterPro: IPR005688 98.45
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 98.34
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 98.24
cd03114148 ArgK-like The function of this protein family is unkown 98.18
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of this 98.11
cd03115173 SRP The signal recognition particle (SRP) mediates the 98.05
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 98.04
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 98.0
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 97.97
KOG0469 842 consensus 97.96
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 97.79
KOG0464 753 consensus 97.76
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 97.74
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 97.68
cd03112158 CobW_like The function of this protein family is unkown 97.5
cd03110179 Fer4_NifH_child This protein family's function is unkow 97.41
KOG0780483 consensus 97.35
KOG3886295 consensus 97.33
PRK00771433 signal recognition particle protein Srp54; Provisional 97.23
KOG2743391 consensus 97.17
KOG0446 657 consensus 97.07
cd02036179 MinD Bacterial cell division requires the formation of 97.03
KOG1533290 consensus 96.92
KOG3859406 consensus 96.83
TIGR00956 1466 3a01205 Pleiotropic Drug Resistance (PDR) Family protei 96.72
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 96.44
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg-like 99.74
PRK09601364 translation-associated GTPase; Reviewed 99.73
PRK09602396 translation-associated GTPase; Reviewed 99.71
PTZ00258392 GTP-binding protein; Provisional 99.69
COG0012372 Predicted GTPase, probable translation factor [Translat 99.69
cd01900274 YchF YchF subfamily. YchF is a member of the Obg family 99.61
KOG1486364 consensus 99.6
KOG1491391 consensus 99.46
TIGR00092390 TIGR00092 GTP-binding protein YchF; InterPro: IPR004396 99.4
KOG1424562 consensus 99.19
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-envelope 99.19
KOG2485335 consensus 98.98
TIGR00993 772 3a0901s04IAP86 chloroplast protein import component Toc 98.63
KOG2203 772 consensus 97.57
pfam05879 741 RHD3 Root hair defective 3 GTP-binding protein (RHD3). 97.35
TIGR01978248 sufC FeS assembly ATPase SufC; InterPro: IPR010230 Iron 97.3
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protein gen 99.68
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These protein 99.64
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to the hu 99.62
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protein Ylq 99.58
PRK09563282 rbgA ribosomal biogenesis GTPase; Reviewed 99.57
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin (NS) 99.55
COG1161322 Predicted GTPases [General function prediction only] 99.5
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This famil 99.24
PRK13796367 GTP-binding protein YqeH; Provisional 99.24
cd01859156 MJ1464 MJ1464. This family represents archaeal GTPase t 99.19
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all sequ 99.09
KOG2484435 consensus 98.99
TIGR00650123 MG442 GTP-binding conserved hypothetical protein; Inter 98.92
COG1162301 Predicted GTPases [General function prediction only] 98.87
pfam03193161 DUF258 Protein of unknown function, DUF258. 98.85
KOG2423572 consensus 98.65
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protein. De 98.49
PRK12289351 ribosome-associated GTPase; Reviewed 98.2
PRK00098298 ribosome-associated GTPase; Reviewed 97.97
PRK12288344 ribosome-associated GTPase; Reviewed 97.95
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtilis) r 97.91
PRK01889353 ribosome-associated GTPase; Reviewed 97.75
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal domain. 97.69
TIGR03263180 guanyl_kin guanylate kinase. Members of this family are 97.57
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein; Int 97.47
PRK00300208 gmk guanylate kinase; Provisional 97.31
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), 97.3
COG0194191 Gmk Guanylate kinase [Nucleotide transport and metaboli 97.09
KOG0054 1381 consensus 97.08
TIGR01184230 ntrCD nitrate ABC transporter, ATP-binding proteins C a 97.05
smart00072184 GuKc Guanylate kinase homologues. Active enzymes cataly 96.9
pfam02263264 GBP Guanylate-binding protein, N-terminal domain. Trans 96.9
pfam00625182 Guanylate_kin Guanylate kinase. 96.88
PTZ00243 1560 ABC transporter; Provisional 96.69
KOG1191 531 consensus 96.66
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; 96.52
PRK10078184 ribose 1,5-bisphosphokinase; Provisional 96.48
cd01859156 MJ1464 MJ1464. This family represents archaeal GTPase t 99.65
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all sequ 99.64
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protein. De 99.32
PTZ00099176 rab6; Provisional 98.97
PRK12289351 ribosome-associated GTPase; Reviewed 98.91
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtilis) r 98.88
PRK01889353 ribosome-associated GTPase; Reviewed 98.87
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These protein 98.81
PRK00098298 ribosome-associated GTPase; Reviewed 98.8
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protein Ylq 98.77
PRK09866 742 hypothetical protein; Provisional 98.75
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protein gen 98.75
PRK12288344 ribosome-associated GTPase; Reviewed 98.72
PRK09563282 rbgA ribosomal biogenesis GTPase; Reviewed 98.7
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to the hu 98.46
PRK13796367 GTP-binding protein YqeH; Provisional 98.36
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This famil 98.34
KOG2484435 consensus 97.79
COG1161322 Predicted GTPases [General function prediction only] 97.64
KOG2423 572 consensus 97.33
COG1162301 Predicted GTPases [General function prediction only] 97.02
KOG1424 562 consensus 97.02
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein YhjQ. 96.8
KOG1144 1064 consensus 99.5
pfam00735280 Septin Septin. Members of this family include CDC3, CDC 99.16
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved family o 99.12
TIGR00073225 hypB hydrogenase accessory protein HypB; InterPro: IPR0 98.61
pfam05783490 DLIC Dynein light intermediate chain (DLIC). This famil 97.81
KOG3905473 consensus 97.36
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin (NS) 97.68
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.63
KOG1249572 consensus 97.61
TIGR02315253 ABC_phnC phosphonate ABC transporter, ATP-binding prote 97.25
TIGR00955 671 3a01204 Pigment precourser permease; InterPro: IPR00528 97.17
TIGR02857570 CydD ABC transporter, CydDC cysteine exporter (CydDC-E) 97.15
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 97.1
TIGR01192592 chvA glucan exporter ATP-binding protein; InterPro: IPR 96.97
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 96.92
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 96.89
KOG00541381 consensus 96.85
cd03234226 ABCG_White The White subfamily represents ABC transport 96.83
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 96.83
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 96.8
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 96.79
cd03240