254780942

254780942

UDP-N-acetylglucosamine pyrophosphorylase protein

GeneID in NCBI database:8209964Locus tag:CLIBASIA_04205
Protein GI in NCBI database:254780942Protein Accession:YP_003065355.1
Gene range:+(931604, 932932)Protein Length:442aa
Gene description:UDP-N-acetylglucosamine pyrophosphorylase protein
COG prediction:[M] N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains)
KEGG prediction:glmU; UDP-N-acetylglucosamine pyrophosphorylase protein; K04042 bifunctional UDP-N-acetylglucosamine pyrophosphorylase / Glucosamine-1-phosphate N-acetyltransferase [EC:2.7.7.23 2.3.1.157]
SEED prediction:N-acetylglucosamine-1-phosphate uridyltransferase (EC 2.7.7.23) / Glucosamine-1-phosphate N-acetyltransferase (EC 2.3.1.157)
Pathway involved in KEGG:Amino sugar and nucleotide sugar metabolism [PATH:las00520]
Subsystem involved in SEED:UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis;
Peptidoglycan Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440--
MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK
ccccEEEEEEcccccccccccccccEEEEccEEHHHHHHHHHHHccccEEEEEccccHHHHHHHccccccEEEEEEccccccHHHHHHHHHHHHHcccccEEEEEcccEEEcHHHHHHHHHHHHHcccEEEEEEEcccccccEEEEEccccEEEEEEcccccccccccccccccccEEcHHHHHHHHHcccccccccccccccHHHHHHHcccEEEEEcccccEEcccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEcccEEcccccEEccEEEEccccEEccccccccEEcccccEEcccccccccEEEccccEEEEEEEEcccccccEEEEcccccccccEEccccEEccccccccccEEEccEEEEccccEEcccEEEccccEEccccEEccccccccEEEEcccEEEccccHHHHHHcc
cccHHHEEEEcccccHHHcccccHHHcEEccEEHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHccccccHHHHHHHHHcccHHHHHHHHHHHccccccEEEEEcccccccHHHHHHHHHHccccccEEEEEEEccccccccEEEEEccEEEEEEccccccccHHHccEEEEEEEEEEHHHHHHHHcccccccccccccHHHHHHHHHcccccEEEEEccccHcccccHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccEccccEEEcccEEEEccEEEcccEEEcccEEEccccEEEccEEccccEEccccEEccccEEccccEEEEEEEEEccEEccccEEEEEEEEEcEEEccccEEccccEEEcEccccEccEEEccccEEccccEEEccEEEccccEEccccEEcccEccccEEcccccccccccHHccccccc
MKRKRLAIVLAAGrghrmksssSKVLQKIAGKPMISHVMETIAAAGIENVALVLGygaeeitrinfpptlsVEYYIQDCQQGTAHAVLTAqdaikpgyddviimygdvplvssHTLKKAMDKIAQGYSIAVVGfnadnpkgygrlliKNNEIIAireendatdeerkihYCNSGLMAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKarldgksiasidvkeqevcgcnnryELSLIENIWQSRYRRQMMISGVtmiapetvflshdtiiqpdtviephvffgcgvsieNYVQIRAFSYlegvhigkktiigpfarirQETTIEKNVRIGNFCEVKKATikegskinhlsyvgdsvvgknvnigagtitcnydgthkykthinenafigsnssliapitigqgtyvasgsiitqdtpenslVFARSRQIVKedgalsmrkkk
MKRKRLAIVlaagrghrmksssskvLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIreendatdeerKIHYCNSGLMAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSiasidvkeqevcgcnnryeLSLIENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGKktiigpfarirqettieknvrignfCEVKKatikegskinhlSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIitqdtpenslvfarsrqivkedgalsmrkkk
MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK
***KRLA*VLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSRQIVKEDG*LSM****
MKRKRLAIVLAAG**************KIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSRQIVKED*********
*KRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSRQI*************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK
MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK
MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEEITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDGLYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENIWQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYLEGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKNVNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLVFARSRQIVKEDGALSMRKKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target442 UDP-N-acetylglucosamine pyrophosphorylase protein [Cand
254780771347 UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltra 1e-05
254780922292 glucose-1-phosphate thymidylyltransferase [Candida 1e-04
255764481271 UDP-N-acetylglucosamine acyltransferase [Candidatu 0.008
255764481 271 UDP-N-acetylglucosamine acyltransferase [Candidatu 0.030
>gi|254780771|ref|YP_003065184.1| UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 347 Back     alignment
 Score = 42.7 bits (99), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 81/224 (36%), Gaps = 66/224 (29%)

Query: 259 PETVFLSHDTIIQPDTV----------IEPHVFFGCGVSIENYVQIRAFSYL-EGVHIGK 307
           PE  F    +I+ P  +          I P  F G  V IE+ V I   + +  GV IG+
Sbjct: 92  PEVSFAIAGSILYPQAMHMEASSFEGGISPQAFLGEDVKIEDGVVIAPMAVVYPGVEIGR 151

Query: 308 KTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEG--------------------SKIN 347
           KT +GP + I     I +N  IG    +  + I                       S I+
Sbjct: 152 KTYVGPGSVIGAGVRIGRNCSIGAGSSIYSSLIGNSVILHSGVRIGNDGFGYARGVSDIH 211

Query: 348 HLSYVG----------------------DSVVGKN------------VNIGAGTITCNYD 373
            + ++G                      D+++G+N            V+IG G I  +  
Sbjct: 212 KIVHIGRVIIQDKVEIGANSAIDRGTIDDTIIGENTKIDNQVQIGHNVHIGCGCIIVSQV 271

Query: 374 GTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTP 417
           G     T+I +N  IG    +   + IG    +AS S + +D P
Sbjct: 272 GIAG-STYIGDNVLIGGQCGIAGYLKIGDNVQIASKSGVLKDIP 314

>gi|254780922|ref|YP_003065335.1| glucose-1-phosphate thymidylyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 292 Back     alignment
 Score = 39.3 bits (90), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 79/199 (39%), Gaps = 44/199 (22%)

Query: 7   AIVLAAGRGHRMKSSS---SKVLQKIAGKPMISHVMETIAAAGIENVALV---------- 53
            IVLA G G R++  +   SK +  I  KPMI + + T+  AGI  + ++          
Sbjct: 3   GIVLAGGSGTRLRPLTDLLSKQMLPIYNKPMIYYPVSTLMDAGIREILIISTPRDLPVLK 62

Query: 54  --LGYGAEEITRINF-----PPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYG 106
             LG G +   + ++     P  L+  Y +     G + +VL   D +  G D       
Sbjct: 63  EFLGSGEKWGVQFSYIEQLVPAGLAQSYILGAEFIGDSSSVLILGDNVFYGSD------- 115

Query: 107 DVPLVSSHTLKKAMDKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEER 166
                 S    KA    A+  S  VVG +  NP+ YG        ++ +   N A   E 
Sbjct: 116 -----ISDIFHKAR---ARRNSATVVGCHVQNPQRYG--------VVEVDSSNQAISIEE 159

Query: 167 KIHYCNSGLMAIDGLYIMD 185
           K +   S   A+ G+Y  D
Sbjct: 160 KPNNPKSSF-AVTGIYFYD 177

>gi|255764481|ref|YP_003065182.2| UDP-N-acetylglucosamine acyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 271 Back     alignment
 Score = 33.1 bits (74), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 64/136 (47%), Gaps = 23/136 (16%)

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNV------------RIGNFCEVKKATIKEG-SKIN 347
           EG  IG  ++IGPF  +  E  I   V            +IG+F +V    +  G ++  
Sbjct: 18  EGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGDFTKVFPMAVLGGDTQSK 77

Query: 348 HLSYVG-DSVVGKNVNIGAGTITCNYDGTHKY--KTHINENAFIGSNSSLIAPITIGQGT 404
           + ++VG + +VGK   I  G +T N  GT +Y  KT + +N F  +NS +     +G G 
Sbjct: 78  YHNFVGTELLVGKKCVIREG-VTIN-RGTVEYGGKTIVGDNNFFLANSHVAHDCKLGNGI 135

Query: 405 YVA-----SGSIITQD 415
            ++     +G +I  D
Sbjct: 136 VLSNNVMIAGHVIVDD 151

>gi|255764481|ref|YP_003065182.2| UDP-N-acetylglucosamine acyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 271 Back     alignment
 Score = 31.6 bits (70), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 48/124 (38%), Gaps = 6/124 (4%)

Query: 305 IGKKTIIGPFARIRQETTIEKNVRIGNFCEV-KKATIKEGSK-INHLSYVGDSVVGKNVN 362
           +G   II P A + +   I  N  IG FC V  +  I  G + I+H    G + +G    
Sbjct: 4   MGNNPIIHPLALVEEGAVIGPNSLIGPFCCVGSEVEIGAGVELISHCVVAGKTKIGDFTK 63

Query: 363 IGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENSLV 422
           +    +    D   KY   +     +G    +   +TI +GT    G  I  D   N+  
Sbjct: 64  VFPMAVLGG-DTQSKYHNFVGTELLVGKKCVIREGVTINRGTVEYGGKTIVGD---NNFF 119

Query: 423 FARS 426
            A S
Sbjct: 120 LANS 123

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target442 UDP-N-acetylglucosamine pyrophosphorylase protein [Cand
315122355442 UDP-N-acetylglucosamine pyrophosphorylase protein [Cand 1 0.0
218516173449 UDP-N-acetylglucosamine pyrophosphorylase protein [Rhiz 1 1e-142
190891734453 UDP-N-acetylglucosamine pyrophosphorylase [Rhizobium et 1 1e-142
327188307453 UDP-N-acetylglucosamine pyrophosphorylase protein [Rhiz 1 1e-141
86357709453 UDP-N-acetylglucosamine pyrophosphorylase protein [Rhiz 1 1e-139
218681827428 putative bifunctional GlmU protein [Rhizobium etli CIAT 1 1e-139
218673900453 UDP-N-acetylglucosamine pyrophosphorylase protein [Rhiz 1 1e-139
209549321453 bifunctional N-acetylglucosamine-1-phosphate uridyltran 1 1e-139
241204634453 bifunctional N-acetylglucosamine-1-phosphate uridyltran 1 1e-139
116252133453 bifunctional N-acetylglucosamine-1-phosphate uridyltran 1 1e-138
>gi|315122355|ref|YP_004062844.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 442 Back     alignment and organism information
 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/442 (75%), Positives = 385/442 (87%)

Query: 1   MKRKRLAIVLAAGRGHRMKSSSSKVLQKIAGKPMISHVMETIAAAGIENVALVLGYGAEE 60
           MKRK LAIVLAAG G RMKSS  KVLQKIAGKPMI HVMETI+AAGI +VALVLG+GAE 
Sbjct: 1   MKRKCLAIVLAAGSGQRMKSSFPKVLQKIAGKPMICHVMETISAAGIRDVALVLGHGAEA 60

Query: 61  ITRINFPPTLSVEYYIQDCQQGTAHAVLTAQDAIKPGYDDVIIMYGDVPLVSSHTLKKAM 120
           +++I+FP  LSVEY+IQD QQGTAHAVL+AQDAIK GYDD+IIMYGDVPLV +HTLK+AM
Sbjct: 61  VSKIDFPAELSVEYFIQDSQQGTAHAVLSAQDAIKRGYDDIIIMYGDVPLVPAHTLKEAM 120

Query: 121 DKIAQGYSIAVVGFNADNPKGYGRLLIKNNEIIAIREENDATDEERKIHYCNSGLMAIDG 180
           DKI QGYSIAV+GFN DNP+GYGRLLI NNE++AIREE DA+D E+KI YCNSGLMAIDG
Sbjct: 121 DKIVQGYSIAVIGFNTDNPEGYGRLLINNNELVAIREEKDASDAEKKIKYCNSGLMAIDG 180

Query: 181 LYIMDWLLQIKKNKVSQEYYLTDIIEKARLDGKSIASIDVKEQEVCGCNNRYELSLIENI 240
           ++I+DWLL+I K   SQEYYLTDI+  A+  GK+IAS+D  EQEV GCNNR+ELS++E+I
Sbjct: 181 VHILDWLLKINKENKSQEYYLTDIVAIAQFAGKTIASVDAMEQEVYGCNNRHELSIVESI 240

Query: 241 WQSRYRRQMMISGVTMIAPETVFLSHDTIIQPDTVIEPHVFFGCGVSIENYVQIRAFSYL 300
           WQ   RR+MM+SGV MI+PETVFLSHDTII PDTVIEPHVFFG GV +E+   IRAFSYL
Sbjct: 241 WQVNRRRRMMMSGVAMISPETVFLSHDTIIDPDTVIEPHVFFGYGVVVESAAHIRAFSYL 300

Query: 301 EGVHIGKKTIIGPFARIRQETTIEKNVRIGNFCEVKKATIKEGSKINHLSYVGDSVVGKN 360
           EGVH+GK  +IGPFAR+R  TTIE+NVRIGNFCE+K   I EGSKINHLSYVGDS VG++
Sbjct: 301 EGVHVGKNAVIGPFARLRPGTTIEQNVRIGNFCEIKNTVIGEGSKINHLSYVGDSFVGES 360

Query: 361 VNIGAGTITCNYDGTHKYKTHINENAFIGSNSSLIAPITIGQGTYVASGSIITQDTPENS 420
           VNIGAG +TCNYDG +K++THI +NAFIGSNSSLIAP+TIG G+YVASGS+ITQDTPENS
Sbjct: 361 VNIGAGVVTCNYDGINKHETHICDNAFIGSNSSLIAPVTIGSGSYVASGSVITQDTPENS 420

Query: 421 LVFARSRQIVKEDGALSMRKKK 442
           LV ARSRQIVKE  AL +RK+K
Sbjct: 421 LVLARSRQIVKEKKALLIRKRK 442


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218516173|ref|ZP_03513013.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Rhizobium etli 8C-3] Length = 449 Back     alignment and organism information
>gi|190891734|ref|YP_001978276.1| UDP-N-acetylglucosamine pyrophosphorylase [Rhizobium etli CIAT 652] Length = 453 Back     alignment and organism information
>gi|327188307|gb|EGE55526.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Rhizobium etli CNPAF512] Length = 453 Back     alignment and organism information
>gi|86357709|ref|YP_469601.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Rhizobium etli CFN 42] Length = 453 Back     alignment and organism information
>gi|218681827|ref|ZP_03529564.1| putative bifunctional GlmU protein [Rhizobium etli CIAT 894] Length = 428 Back     alignment and organism information
>gi|218673900|ref|ZP_03523569.1| UDP-N-acetylglucosamine pyrophosphorylase protein [Rhizobium etli GR56] Length = 453 Back     alignment and organism information
>gi|209549321|ref|YP_002281238.1| bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 453 Back     alignment and organism information
>gi|241204634|ref|YP_002975730.1| bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 453 Back     alignment and organism information
>gi|116252133|ref|YP_767971.1| bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase [Rhizobium leguminosarum bv. viciae 3841] Length = 453 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target442 UDP-N-acetylglucosamine pyrophosphorylase protein [Cand
PRK14353446 PRK14353, glmU, bifunctional N-acetylglucosamine-1-phos 0.0
TIGR01173451 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylas 1e-132
PRK14354458 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phos 1e-123
PRK14357448 PRK14357, glmU, bifunctional N-acetylglucosamine-1-phos 1e-105
PRK14355459 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phos 1e-101
PRK09451456 PRK09451, glmU, bifunctional N-acetylglucosamine-1-phos 1e-100
PRK14359430 PRK14359, glmU, bifunctional N-acetylglucosamine-1-phos 4e-98
PRK14360450 PRK14360, glmU, bifunctional N-acetylglucosamine-1-phos 4e-95
PRK14356456 PRK14356, glmU, bifunctional N-acetylglucosamine-1-phos 8e-93
PRK14352482 PRK14352, glmU, bifunctional N-acetylglucosamine-1-phos 2e-89
PRK14358481 PRK14358, glmU, bifunctional N-acetylglucosamine-1-phos 1e-77
COG1208358 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophospho 9e-29
KOG1322371 KOG1322, KOG1322, KOG1322, GDP-mannose pyrophosphorylas 9e-08
KOG1462433 KOG1462, KOG1462, KOG1462, Translation initiation facto 6e-06
COG1207460 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltr 1e-145
cd03353193 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate u 2e-72
TIGR01853324 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] g 1e-10
COG1044338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 3e-10
cd03352205 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltrans 1e-09
COG1044338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 3e-09
PRK00892343 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamin 2e-07
cd03351254 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamine O-a 4e-06
COG1043260 COG1043, LpxA, Acyl-[acyl carrier protein] 3e-05
PRK05289262 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransfe 6e-05
COG1043260 COG1043, LpxA, Acyl-[acyl carrier protein] 7e-05
COG0663176 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, 0.001
cd02540229 cd02540, GT2_GlmU_N_bac, N-terminal domain of bacterial 3e-70
cd04181217 cd04181, NTP_transferase, NTP_transferases catalyze the 1e-25
COG1209286 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cell env 1e-16
cd06915223 cd06915, NTP_transferase_WcbM_like, WcbM_like is a subf 2e-11
COG1210291 COG1210, GalU, UDP-glucose pyrophosphorylase [Cell enve 9e-09
PRK15480292 PRK15480, PRK15480, glucose-1-phosphate thymidylyltrans 1e-08
pfam00483247 pfam00483, NTP_transferase, Nucleotidyl transferase 2e-08
cd02541267 cd02541, UGPase_prokaryotic, Prokaryotic UGPase catalys 8e-08
cd06426220 cd06426, NTP_transferase_like_2, NTP_trnasferase_like_2 9e-07
cd04183231 cd04183, GT2_BcE_like, GT2_BcbE_like is likely involved 2e-05
cd05636163 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-phosphat 1e-25
cd03358119 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parall 1e-13
cd03360197 cd03360, LbH_AT_putative, Putative Acyltransferase (AT) 2e-13
TIGR03570201 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic a 1e-12
PRK12461255 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltransfe 3e-08
KOG4750269 KOG4750, KOG4750, KOG4750, Serine O-acetyltransferase [ 7e-08
COG0110190 COG0110, WbbJ, Acetyltransferase (isoleucine patch supe 8e-07
COG0663176 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, 2e-06
TIGR01852254 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protein]--U 9e-06
TIGR02287192 TIGR02287, PaaY, phenylacetic acid degradation protein 2e-05
cd04645153 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-li 3e-05
cd00710167 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases (CA): 5e-05
PRK10502182 PRK10502, PRK10502, putative acyl transferase; Provisio 3e-04
cd04745155 cd04745, LbH_paaY_like, paaY-like: This group is compos 0.001
COG1044 338 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] 0.002
cd04189236 cd04189, G1P_TT_long, G1P_TT_long represents the long f 3e-17
cd04182186 cd04182, GT_2_like_f, GT_2_like_f is a subfamily of the 5e-17
cd02503181 cd02503, MobA, MobA catalyzes the formation of molybdop 2e-06
COG1211230 COG1211, IspD, 4-diphosphocytidyl-2-methyl-D-erithritol 2e-06
COG1213239 COG1213, COG1213, Predicted sugar nucleotidyltransferas 4e-06
COG1083228 COG1083, NeuA, CMP-N-acetylneuraminic acid synthetase [ 2e-05
cd02538240 cd02538, G1P_TT_short, G1P_TT_short is the short form o 6e-05
PRK13368238 PRK13368, PRK13368, 3-deoxy-manno-octulosonate cytidyly 7e-05
TIGR01207286 TIGR01207, rmlA, glucose-1-phosphate thymidylyltransfer 1e-04
TIGR01099260 TIGR01099, galU, UTP-glucose-1-phosphate uridylyltransf 1e-04
pfam01128221 pfam01128, IspD, Uncharacterized protein family UPF0007 5e-04
COG0746192 COG0746, MobA, Molybdopterin-guanine dinucleotide biosy 0.001
COG2068199 COG2068, COG2068, Uncharacterized MobA-related protein 1e-14
cd02523229 cd02523, PC_cytidylyltransferase, Phosphocholine cytidy 1e-12
cd06428257 cd06428, M1P_guanylylT_A_like_N, N-terminal domain of M 3e-07
PRK05450245 PRK05450, PRK05450, 3-deoxy-manno-octulosonate cytidyly 7e-07
cd02507216 cd02507, eIF-2B_gamma_N_like, The N-terminal of eIF-2B_ 3e-06
TIGR00453217 TIGR00453, ispD, 2-C-methyl-D-erythritol 4-phosphate cy 8e-06
cd06425233 cd06425, M1P_guanylylT_B_like_N, N-terminal domain of t 3e-05
COG1212247 COG1212, KdsB, CMP-2-keto-3-deoxyoctulosonic acid synth 5e-05
cd02517239 cd02517, CMP-KDO-Synthetase, CMP-KDO synthetase catalyz 9e-05
cd04198214 cd04198, eIF-2B_gamma_N, The N-terminal domain of gamma 4e-04
pfam02348197 pfam02348, CTP_transf_3, Cytidylyltransferase 0.002
TIGR01208353 TIGR01208, rmlA_long, glucose-1-phosphate thymidylylran 8e-12
KOG1461 673 KOG1461, KOG1461, KOG1461, Translation initiation facto 3e-06
COG0448393 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydr 1e-04
TIGR03532231 TIGR03532, DapD_Ac, 2,3,4,5-tetrahydropyridine-2,6-dica 9e-11
cd04647109 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)- 1e-09
cd0020878 cd00208, LbetaH, Left-handed parallel beta-Helix (Lbeta 2e-09
COG2171271 COG2171, DapD, Tetrahydrodipicolinate N-succinyltransfe 3e-09
cd03354101 cd03354, LbH_SAT, Serine acetyltransferase (SAT): SAT c 1e-08
COG1045194 COG1045, CysE, Serine acetyltransferase [Amino acid tra 2e-07
cd03350139 cd03350, LbH_THP_succinylT, 2,3,4,5-tetrahydropyridine- 3e-06
PLN02739355 PLN02739, PLN02739, serine acetyltransferase 1e-04
cd05825107 cd05825, LbH_wcaF_like, wcaF-like: This group is compos 5e-04
PRK05289 262 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransfe 0.001
TIGR03308204 TIGR03308, phn_thr-fam, phosphonate metabolim protein, 0.003
TIGR00965269 TIGR00965, dapD, 2,3,4,5-tetrahydropyridine-2,6-dicarbo 0.004
cd05635101 cd05635, LbH_unknown, Uncharacterized proteins, Left-ha 6e-08
cd02516218 cd02516, CDP-ME_synthetase, CDP-ME synthetase is involv 3e-07
cd06422221 cd06422, NTP_transferase_like_1, NTP_transferase_like_1 1e-06
PRK00155227 PRK00155, ispD, 2-C-methyl-D-erythritol 4-phosphate cyt 2e-06
cd02524253 cd02524, G1P_cytidylyltransferase, G1P_cytidylyltransfe 4e-05
COG4750231 COG4750, LicC, CTP:phosphocholine cytidylyltransferase 8e-05
PRK00317193 PRK00317, mobA, molybdopterin-guanine dinucleotide bios 8e-05
TIGR03310188 TIGR03310, matur_ygfJ, molybdenum hydroxylase accessory 0.001
TIGR02623254 TIGR02623, G1P_cyt_trans, glucose-1-phosphate cytidylyl 0.003
KOG1460407 KOG1460, KOG1460, KOG1460, GDP-mannose pyrophosphorylas 7e-06
cd03360197 cd03360, LbH_AT_putative, Putative Acyltransferase (AT) 2e-05
TIGR03570201 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic a 2e-05
cd0020878 cd00208, LbetaH, Left-handed parallel beta-Helix (Lbeta 0.003
TIGR01172162 TIGR01172, cysE, serine O-acetyltransferase 8e-05
cd03357169 cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) 5e-04
PRK11830272 PRK11830, dapD, 2,3,4,5-tetrahydropyridine-2,6-carboxyl 0.002
PRK10092183 PRK10092, PRK10092, maltose O-acetyltransferase; Provis 0.004
>gnl|CDD|184642 PRK14353, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|162235 TIGR01173, glmU, UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|184643 PRK14354, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184644 PRK14357, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|172831 PRK14355, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|181867 PRK09451, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184645 PRK14359, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184646 PRK14360, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|172832 PRK14356, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184641 PRK14352, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|172834 PRK14358, glmU, bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|31401 COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|36536 KOG1322, KOG1322, KOG1322, GDP-mannose pyrophosphorylase/mannose-1-phosphate guanylyltransferase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>gnl|CDD|36675 KOG1462, KOG1462, KOG1462, Translation initiation factor 2B, gamma subunit (eIF-2Bgamma/GCD1) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|31400 COG1207, GlmU, N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|100044 cd03353, LbH_GlmU_C, N-acetyl-glucosamine-1-phosphate uridyltransferase (GlmU), C-terminal left-handed beta-helix (LbH) acetyltransferase domain: GlmU is also known as UDP-N-acetylglucosamine pyrophosphorylase Back     alignment and domain information
>gnl|CDD|162561 TIGR01853, lipid_A_lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase Back     alignment and domain information
>gnl|CDD|31246 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|100043 cd03352, LbH_LpxD, UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2,3-diacyl-GlcNAc Back     alignment and domain information
>gnl|CDD|31246 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|179158 PRK00892, lpxD, UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|100042 cd03351, LbH_UDP-GlcNAc_AT, UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc Back     alignment and domain information
>gnl|CDD|31245 COG1043, LpxA, Acyl-[acyl carrier protein] Back     alignment and domain information
>gnl|CDD|179994 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|31245 COG1043, LpxA, Acyl-[acyl carrier protein] Back     alignment and domain information
>gnl|CDD|31007 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|133020 cd02540, GT2_GlmU_N_bac, N-terminal domain of bacterial GlmU Back     alignment and domain information
>gnl|CDD|133024 cd04181, NTP_transferase, NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>gnl|CDD|31402 COG1209, RfbA, dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|133065 cd06915, NTP_transferase_WcbM_like, WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>gnl|CDD|31403 COG1210, GalU, UDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|185377 PRK15480, PRK15480, glucose-1-phosphate thymidylyltransferase RfbA; Provisional Back     alignment and domain information
>gnl|CDD|144176 pfam00483, NTP_transferase, Nucleotidyl transferase Back     alignment and domain information
>gnl|CDD|133021 cd02541, UGPase_prokaryotic, Prokaryotic UGPase catalyses the synthesis of UDP-glucose Back     alignment and domain information
>gnl|CDD|133048 cd06426, NTP_transferase_like_2, NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family Back     alignment and domain information
>gnl|CDD|133026 cd04183, GT2_BcE_like, GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule Back     alignment and domain information
>gnl|CDD|100060 cd05636, LbH_G1P_TT_C_like, Putative glucose-1-phosphate thymidylyltransferase, C-terminal Left-handed parallel beta-Helix (LbH) domain: Proteins in this family show simlarity to glucose-1-phosphate adenylyltransferases in that they contain N-terminal catalytic domains that resemble a dinucleotide-binding Rossmann fold and C-terminal LbH fold domains Back     alignment and domain information
>gnl|CDD|100048 cd03358, LbH_WxcM_N_like, WcxM-like, Left-handed parallel beta-Helix (LbH) N-terminal domain: This group is composed of Xanthomonas campestris WcxM and proteins with similarity to the WcxM N-terminal domain Back     alignment and domain information
>gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>gnl|CDD|163332 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>gnl|CDD|183539 PRK12461, PRK12461, UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|39947 KOG4750, KOG4750, KOG4750, Serine O-acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|30459 COG0110, WbbJ, Acetyltransferase (isoleucine patch superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|31007 COG0663, PaaY, Carbonic anhydrases/acetyltransferases, isoleucine patch superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|130911 TIGR01852, lipid_A_lpxA, acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase Back     alignment and domain information
>gnl|CDD|131340 TIGR02287, PaaY, phenylacetic acid degradation protein PaaY Back     alignment and domain information
>gnl|CDD|100051 cd04645, LbH_gamma_CA_like, Gamma carbonic anhydrase-like: This family is composed of gamma carbonic anhydrase (CA), Ferripyochelin Binding Protein (FBP), E Back     alignment and domain information
>gnl|CDD|100039 cd00710, LbH_gamma_CA, Gamma carbonic anhydrases (CA): Carbonic anhydrases are zinc-containing enzymes that catalyze the reversible hydration of carbon dioxide in a two-step mechanism, involving the nucleophilic attack of a zinc-bound hydroxide ion on carbon dioxide, followed by the regeneration of the active site by ionization of the zinc-bound water molecule and removal of a proton from the active site Back     alignment and domain information
>gnl|CDD|182500 PRK10502, PRK10502, putative acyl transferase; Provisional Back     alignment and domain information
>gnl|CDD|100058 cd04745, LbH_paaY_like, paaY-like: This group is composed by uncharacterized proteins with similarity to the protein product of the E Back     alignment and domain information
>gnl|CDD|31246 COG1044, LpxD, UDP-3-O-[3-hydroxymyristoyl] Back     alignment and domain information
>gnl|CDD|133032 cd04189, G1P_TT_long, G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>gnl|CDD|133025 cd04182, GT_2_like_f, GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function Back     alignment and domain information
>gnl|CDD|133000 cd02503, MobA, MobA catalyzes the formation of molybdopterin guanine dinucleotide Back     alignment and domain information
>gnl|CDD|31404 COG1211, IspD, 4-diphosphocytidyl-2-methyl-D-erithritol synthase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|31406 COG1213, COG1213, Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|31280 COG1083, NeuA, CMP-N-acetylneuraminic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|133019 cd02538, G1P_TT_short, G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>gnl|CDD|184007 PRK13368, PRK13368, 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|130274 TIGR01207, rmlA, glucose-1-phosphate thymidylyltransferase, short form Back     alignment and domain information
>gnl|CDD|162203 TIGR01099, galU, UTP-glucose-1-phosphate uridylyltransferase Back     alignment and domain information
>gnl|CDD|144646 pfam01128, IspD, Uncharacterized protein family UPF0007 Back     alignment and domain information
>gnl|CDD|31089 COG0746, MobA, Molybdopterin-guanine dinucleotide biosynthesis protein A [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|32251 COG2068, COG2068, Uncharacterized MobA-related protein [General function prediction only] Back     alignment and domain information
>gnl|CDD|133014 cd02523, PC_cytidylyltransferase, Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline Back     alignment and domain information
>gnl|CDD|133050 cd06428, M1P_guanylylT_A_like_N, N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
>gnl|CDD|180091 PRK05450, PRK05450, 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133001 cd02507, eIF-2B_gamma_N_like, The N-terminal of eIF-2B_gamma_like is predicted to have glycosyltransferase activity Back     alignment and domain information
>gnl|CDD|129545 TIGR00453, ispD, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information
>gnl|CDD|133047 cd06425, M1P_guanylylT_B_like_N, N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
>gnl|CDD|31405 COG1212, KdsB, CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|133010 cd02517, CMP-KDO-Synthetase, CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide Back     alignment and domain information
>gnl|CDD|133041 cd04198, eIF-2B_gamma_N, The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>gnl|CDD|145475 pfam02348, CTP_transf_3, Cytidylyltransferase Back     alignment and domain information
>gnl|CDD|162250 TIGR01208, rmlA_long, glucose-1-phosphate thymidylylransferase, long form Back     alignment and domain information
>gnl|CDD|36674 KOG1461, KOG1461, KOG1461, Translation initiation factor 2B, epsilon subunit (eIF-2Bepsilon/GCD6) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30797 COG0448, GlgC, ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|132571 TIGR03532, DapD_Ac, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase Back     alignment and domain information
>gnl|CDD|100053 cd04647, LbH_MAT_like, Maltose O-acyltransferase (MAT)-like: This family is composed of maltose O-acetyltransferase, galactoside O-acetyltransferase (GAT), xenobiotic acyltransferase (XAT) and similar proteins Back     alignment and domain information
>gnl|CDD|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>gnl|CDD|32354 COG2171, DapD, Tetrahydrodipicolinate N-succinyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|100045 cd03354, LbH_SAT, Serine acetyltransferase (SAT): SAT catalyzes the CoA-dependent acetylation of the side chain hydroxyl group of L-serine to form O-acetylserine, as the first step of a two-step biosynthetic pathway in bacteria and plants leading to the formation of L-cysteine Back     alignment and domain information
>gnl|CDD|31247 COG1045, CysE, Serine acetyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|100041 cd03350, LbH_THP_succinylT, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate (THDP) N-succinyltransferase (also called THP succinyltransferase): THDP N-succinyltransferase catalyzes the conversion of tetrahydrodipicolinate and succinyl-CoA to N-succinyltetrahydrodipicolinate and CoA Back     alignment and domain information
>gnl|CDD|178340 PLN02739, PLN02739, serine acetyltransferase Back     alignment and domain information
>gnl|CDD|100063 cd05825, LbH_wcaF_like, wcaF-like: This group is composed of the protein product of the E Back     alignment and domain information
>gnl|CDD|179994 PRK05289, PRK05289, UDP-N-acetylglucosamine acyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|132351 TIGR03308, phn_thr-fam, phosphonate metabolim protein, transferase hexapeptide repeat family Back     alignment and domain information
>gnl|CDD|130038 TIGR00965, dapD, 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase Back     alignment and domain information
>gnl|CDD|100059 cd05635, LbH_unknown, Uncharacterized proteins, Left-handed parallel beta-Helix (LbH) domain: Members in this group are uncharacterized bacterial proteins containing a LbH domain with multiple turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>gnl|CDD|133009 cd02516, CDP-ME_synthetase, CDP-ME synthetase is involved in mevalonate-independent isoprenoid production Back     alignment and domain information
>gnl|CDD|133044 cd06422, NTP_transferase_like_1, NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>gnl|CDD|178905 PRK00155, ispD, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|133015 cd02524, G1P_cytidylyltransferase, G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose Back     alignment and domain information
>gnl|CDD|34365 COG4750, LicC, CTP:phosphocholine cytidylyltransferase involved in choline phosphorylation for cell surface LPS epitopes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|178976 PRK00317, mobA, molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed Back     alignment and domain information
>gnl|CDD|163213 TIGR03310, matur_ygfJ, molybdenum hydroxylase accessory protein, YgfJ family Back     alignment and domain information
>gnl|CDD|131672 TIGR02623, G1P_cyt_trans, glucose-1-phosphate cytidylyltransferase Back     alignment and domain information
>gnl|CDD|36673 KOG1460, KOG1460, KOG1460, GDP-mannose pyrophosphorylase [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis, Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|100050 cd03360, LbH_AT_putative, Putative Acyltransferase (AT), Left-handed parallel beta-Helix (LbH) domain; This group is composed of mostly uncharacterized proteins containing an N-terminal helical subdomain followed by a LbH domain Back     alignment and domain information
>gnl|CDD|163332 TIGR03570, NeuD_NnaD, sugar O-acyltransferase, sialic acid O-acetyltransferase NeuD family Back     alignment and domain information
>gnl|CDD|100038 cd00208, LbetaH, Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X) Back     alignment and domain information
>gnl|CDD|130240 TIGR01172, cysE, serine O-acetyltransferase Back     alignment and domain information
>gnl|CDD|100047 cd03357, LbH_MAT_GAT, Maltose O-acetyltransferase (MAT) and Galactoside O-acetyltransferase (GAT): MAT and GAT catalyze the CoA-dependent acetylation of the 6-hydroxyl group of their respective sugar substrates Back     alignment and domain information
>gnl|CDD|183330 PRK11830, dapD, 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|182235 PRK10092, PRK10092, maltose O-acetyltransferase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 442 UDP-N-acetylglucosamine pyrophosphorylase protein [Cand
TIGR01173461 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPr 100.0
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate uridy 100.0
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransferase 100.0
PRK05293381 glgC glucose-1-phosphate adenylyltransferase; Provision 100.0
TIGR01208361 rmlA_long glucose-1-phosphate thymidylyltransferase; In 100.0
PRK00844409 glgC glucose-1-phosphate adenylyltransferase; Provision 100.0
PRK04928405 consensus 100.0
PRK03282406 consensus 100.0
PRK00725431 glgC glucose-1-phosphate adenylyltransferase; Provision 100.0
PRK01884435 consensus 100.0
KOG1461 673 consensus 100.0
KOG1462433 consensus 100.0
TIGR02092383 glgD glucose-1-phosphate adenylyltransferase, GlgD subu 99.9
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase inv 100.0
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Provision 100.0
TIGR02091421 glgC glucose-1-phosphate adenylyltransferase; InterPro: 100.0
PRK03701431 consensus 100.0
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transp 100.0
KOG1460407 consensus 100.0
cd02540229 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU. The 100.0
KOG1322371 consensus 100.0
COG1209286 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biog 100.0
cd02541267 UGPase_prokaryotic Prokaryotic UGPase catalyses the syn 100.0
cd02538240 G1P_TT_short G1P_TT_short is the short form of glucose- 100.0
PRK13389302 UTP--glucose-1-phosphate uridylyltransferase subunit Ga 100.0
PRK10122297 UTP--glucose-1-phosphate uridylyltransferase subunit Ga 100.0
cd06425233 M1P_guanylylT_B_like_N N-terminal domain of the M1P-gua 100.0
cd04189236 G1P_TT_long G1P_TT_long represents the long form of glu 100.0
cd06428257 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanyly 100.0
pfam00483247 NTP_transferase Nucleotidyl transferase. This family in 100.0
cd06915223 NTP_transferase_WcbM_like WcbM_like is a subfamily of n 100.0
cd02524253 G1P_cytidylyltransferase G1P_cytidylyltransferase catal 100.0
cd04181217 NTP_transferase NTP_transferases catalyze the transfer 100.0
cd06426220 NTP_transferase_like_2 NTP_trnasferase_like_2 is a memb 100.0
cd04183231 GT2_BcE_like GT2_BcbE_like is likely involved in the bi 100.0
cd06422221 NTP_transferase_like_1 NTP_transferase_like_1 is a memb 100.0
cd02523229 PC_cytidylyltransferase Phosphocholine cytidylyltransfe 100.0
TIGR01099270 galU UTP-glucose-1-phosphate uridylyltransferase; Inter 100.0
COG1210291 GalU UDP-glucose pyrophosphorylase [Cell envelope bioge 100.0
cd02508200 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involve 100.0
TIGR02623256 G1P_cyt_trans glucose-1-phosphate cytidylyltransferase; 100.0
TIGR01207286 rmlA glucose-1-phosphate thymidylyltransferase; InterPr 99.94
COG1213239 Predicted sugar nucleotidyltransferases [Cell envelope 99.94
PRK05450248 3-deoxy-manno-octulosonate cytidylyltransferase; Provis 99.87
pfam01128221 IspD Uncharacterized protein family UPF0007. 99.87
cd02517239 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the act 99.85
PRK13368238 3-deoxy-manno-octulosonate cytidylyltransferase; Provis 99.84
PRK00155228 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 99.84
TIGR00453226 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 99.83
TIGR01105297 galF regulatory protein GalF; InterPro: IPR005774 This 99.81
cd02516218 CDP-ME_synthetase CDP-ME synthetase is involved in meva 99.81
PRK13385238 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferas 99.79
COG1211230 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synthase 99.78
PRK02726200 molybdopterin-guanine dinucleotide biosynthesis protein 99.76
PRK00317193 mobA molybdopterin-guanine dinucleotide biosynthesis pr 99.75
COG2068199 Uncharacterized MobA-related protein [General function 99.74
COG1212247 KdsB CMP-2-keto-3-deoxyoctulosonic acid synthetase [Cel 99.74
PRK09382382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate 99.68
PRK00560196 molybdopterin-guanine dinucleotide biosynthesis protein 99.64
TIGR00466246 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase; 99.43
cd02513223 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acety 99.36
COG1083228 NeuA CMP-N-acetylneuraminic acid synthetase [Cell envel 99.24
TIGR03584222 PseF pseudaminic acid CMP-transferase. The sequences in 99.22
cd06442224 DPM1_like DPM1_like represents putative enzymes similar 96.7
cd04188211 DPG_synthase DPG_synthase is involved in protein N-link 96.62
COG1920210 Predicted nucleotidyltransferase, CobY/MobA/RfbA family 94.36
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltrans 100.0
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (Lp 100.0
PRK12461256 UDP-N-acetylglucosamine acyltransferase; Provisional 100.0
cd03351254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransfe 100.0
PRK05289261 UDP-N-acetylglucosamine acyltransferase; Provisional 100.0
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidyl 100.0
PRK00892343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltra 100.0
TIGR01852257 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylg 100.0
TIGR01853336 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N 100.0
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transferase 99.96
COG1043260 LpxA Acyl-[acyl carrier protein] 99.95
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.95
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- 99.93
TIGR01853336 lipid_A_lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N 99.9
PRK00892343 lpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltra 99.89
COG1044338 LpxD UDP-3-O-[3-hydroxymyristoyl] 99.88
cd03352205 LbH_LpxD UDP-3-O-acyl-glucosamine N-acyltransferase (Lp 99.87
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is 99.83
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is 99.82
cd03351254 LbH_UDP-GlcNAc_AT UDP-N-acetylglucosamine O-acyltransfe 99.82
PRK12461256 UDP-N-acetylglucosamine acyltransferase; Provisional 99.82
PRK05289261 UDP-N-acetylglucosamine acyltransferase; Provisional 99.82
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic a 99.79
cd03353193 LbH_GlmU_C N-acetyl-glucosamine-1-phosphate uridyltrans 99.79
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarb 99.73
cd00710167 LbH_gamma_CA Gamma carbonic anhydrases (CA): Carbonic a 99.72
PRK11830265 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succi 99.68
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an 99.67
cd04745155 LbH_paaY_like paaY-like: This group is composed by unch 99.67
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This f 99.65
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase [Amin 99.64
cd04646164 LbH_Dynactin_6 Dynactin 6 (or subunit p27): Dynactin is 99.64
PRK13627196 carnitine operon protein CaiE; Provisional 99.64
COG1043260 LpxA Acyl-[acyl carrier protein] 99.61
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isoleucine 99.49
cd03359161 LbH_Dynactin_5 Dynactin 5 (or subunit p25); Dynactin is 99.48
TIGR03308204 phn_thr-fam phosphonate metabolim protein, transferase 99.48
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-He 99.43
COG2171271 DapD Tetrahydrodipicolinate N-succinyltransferase [Amin 99.41
TIGR03532231 DapD_Ac 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N- 99.4
PRK10502179 putative colanic acid biosynthesis acetyltransferase Wc 99.13
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl trans 99.06
TIGR00965275 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-suc 99.05
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 99.05
KOG4042190 consensus 98.3
cd04197217 eIF-2B_epsilon_N The N-terminal domain of epsilon subun 100.0
cd04198214 eIF-2B_gamma_N The N-terminal domain of gamma subunit o 100.0
cd02507216 eIF-2B_gamma_N_like The N-terminal of eIF-2B_gamma_like 100.0
cd02509274 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase 99.94
COG0836333 {ManC} Mannose-1-phosphate guanylyltransferase [Cell en 99.87
COG4750231 LicC CTP:phosphocholine cytidylyltransferase involved i 99.83
pfam02348197 CTP_transf_3 Cytidylyltransferase. This family consists 99.63
PTZ00339499 UDP-N-acetylglucosamine pyrophosphorylase; Provisional 99.08
cd04193323 UDPGlcNAc_PPase UDPGlcNAc pyrophosphorylase catalayzes 99.07
COG4284472 UDP-glucose pyrophosphorylase [Carbohydrate transport a 98.89
TIGR01479478 GMP_PMI mannose-1-phosphate guanylyltransferase/mannose 98.58
cd04645153 LbH_gamma_CA_like Gamma carbonic anhydrase-like: This f 99.92
cd03350139 LbH_THP_succinylT 2,3,4,5-tetrahydropyridine-2,6-dicarb 99.92
cd04650154 LbH_FBP Ferripyochelin Binding Protein (FBP): FBP is an 99.91
cd04745155 LbH_paaY_like paaY-like: This group is composed by unch 99.91
PRK13627196 carnitine operon protein CaiE; Provisional 99.87
cd03358119 LbH_WxcM_N_like WcxM-like, Left-handed parallel beta-He 99.87
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyl 99.86
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Left-han 99.85
PRK09677192 putative lipopolysaccharide biosynthesis O-acetyl trans 99.84
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galac 99.83
PRK09527203 lacA galactoside O-acetyltransferase; Reviewed 99.83
PRK10502179 putative colanic acid biosynthesis acetyltransferase Wc 99.82
COG0663176 PaaY Carbonic anhydrases/acetyltransferases, isoleucine 99.82
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class 99.81
PRK10092183 maltose O-acetyltransferase; Provisional 99.79
TIGR01852257 lipid_A_lpxA acyl-[acyl-carrier-protein]--UDP-N-acetylg 99.77
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This 99.74
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes t 99.73
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfamily) [ 99.72
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of the 99.71
PRK10191146 putative colanic acid biosynthesis acetyltransferase Wc 99.71
TIGR01172163 cysE serine O-acetyltransferase; InterPro: IPR005881 Th 99.65
TIGR02287193 PaaY phenylacetic acid degradation protein PaaY; InterP 99.64
KOG4750269 consensus 99.63
COG1045194 CysE Serine acetyltransferase [Amino acid transport and 99.61
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) 99.55
PRK11132273 cysE serine acetyltransferase; Provisional 99.54
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydrop 99.04
TIGR02353719 NRPS_term_dom non-ribosomal peptide synthetase terminal 98.58
TIGR02353719 NRPS_term_dom non-ribosomal peptide synthetase terminal 98.47
KOG3121184 consensus 98.46
cd03349145 LbH_XAT Xenobiotic acyltransferase (XAT): The XAT class 98.4
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N 98.01
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylat 97.93
KOG3121184 consensus 97.84
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed paral 99.91
cd05636163 LbH_G1P_TT_C_like Putative glucose-1-phosphate thymidyl 99.83
PRK09451456 glmU bifunctional N-acetylglucosamine-1-phosphate uridy 99.8
TIGR01173461 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPr 99.79
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left 99.51
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) 99.42
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase inv 99.32
cd0335679 LbH_G1P_AT_C_like Left-handed parallel beta-Helix (LbH) 99.32
PRK04928405 consensus 99.24
PRK03282406 consensus 99.15
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C 99.08
PRK00725431 glgC glucose-1-phosphate adenylyltransferase; Provision 98.98
PRK03701431 consensus 98.93
COG1045194 CysE Serine acetyltransferase [Amino acid transport and 98.85
COG0448393 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transp 98.75
KOG1322371 consensus 98.59
TIGR01172163 cysE serine O-acetyltransferase; InterPro: IPR005881 Th 98.51
cd04182186 GT_2_like_f GT_2_like_f is a subfamily of the glycosylt 99.79
TIGR03310188 matur_ygfJ molybdenum hydroxylase accessory protein, Yg 99.78
TIGR03202190 pucB xanthine dehydrogenase accessory protein pucB. In 99.72
TIGR00454204 TIGR00454 conserved hypothetical protein TIGR00454; Int 99.72
COG2266177 GTP:adenosylcobinamide-phosphate guanylyltransferase [C 99.66
cd02503181 MobA MobA catalyzes the formation of molybdopterin guan 99.65
COG0746192 MobA Molybdopterin-guanine dinucleotide biosynthesis pr 99.61
TIGR02665202 molyb_mobA molybdopterin-guanine dinucleotide biosynthe 99.32
cd02518233 GT2_SpsF SpsF is a glycosyltrnasferase implicated in th 99.16
COG1861241 SpsF Spore coat polysaccharide biosynthesis protein F, 98.74
cd04180266 UGPase_euk_like Eukaryotic UGPase-like includes UDPase 98.63
PRK00576178 molybdopterin-guanine dinucleotide biosynthesis protein 98.21
TIGR03552195 F420_cofC 2-phospho-L-lactate guanylyltransferase CofC. 97.63
pfam01704416 UDPGP UTP--glucose-1-phosphate uridylyltransferase. Thi 97.55
cd00761156 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A 97.46
cd04184202 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like proteins 96.58
cd06434235 GT2_HAS Hyaluronan synthases catalyze polymerization of 95.9
cd06433202 GT_2_WfgS_like WfgS and WfeV are involved in O-antigen 95.9
cd06439251 CESA_like_1 CESA_like_1 is a member of the cellulose sy 95.81
cd04186166 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 95.8
PRK11204421 N-glycosyltransferase PgaC; Provisional 95.45
TIGR03111439 glyc2_xrt_Gpos1 putative glycosyltransferase TIGR03111. 95.41
cd06435236 CESA_NdvC_like NdvC_like proteins in this family are pu 95.32
pfam01983217 CofC Guanylyl transferase CofC like. Coenzyme F420 is a 95.01
cd06421234 CESA_CelA_like CESA_CelA_like are involved in the elong 94.96
COG1216305 Predicted glycosyltransferases [General function predic 94.71
cd06438183 EpsO_like EpsO protein participates in the methanolan s 94.46
pfam00535168 Glycos_transf_2 Glycosyl transferase family 2. Diverse 93.96
cd06437232 CESA_CaSu_A2 Cellulose synthase catalytic subunit A2 (C 93.89
cd06427241 CESA_like_2 CESA_like_2 is a member of the cellulose sy 93.08
cd04185202 GT_2_like_b Subfamily of Glycosyltransferase Family GT2 93.05
cd04192229 GT_2_like_e Subfamily of Glycosyltransferase Family GT2 92.41
cd06423180 CESA_like CESA_like is the cellulose synthase superfami 92.17
cd02525249 Succinoglycan_BP_ExoA ExoA is involved in the biosynthe 90.87
cd04196214 GT_2_like_d Subfamily of Glycosyltransferase Family GT2 90.71
COG1207460 GlmU N-acetylglucosamine-1-phosphate uridyltransferase 99.63
KOG1461 673 consensus 99.53
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left- 99.4
cd0465281 LbH_eIF2B_gamma_C eIF-2B gamma subunit, C-terminal Left 99.35
cd03354101 LbH_SAT Serine acetyltransferase (SAT): SAT catalyzes t 99.06
cd03357169 LbH_MAT_GAT Maltose O-acetyltransferase (MAT) and Galac 98.98
PRK10092183 maltose O-acetyltransferase; Provisional 98.97
TIGR02287193 PaaY phenylacetic acid degradation protein PaaY; InterP 98.91
cd04649147 LbH_THP_succinylT_putative Putative 2,3,4,5-tetrahydrop 98.68
COG0110190 WbbJ Acetyltransferase (isoleucine patch superfamily) [ 98.22
COG4801 277 Predicted acyltransferase [General function prediction 97.24
TIGR03570201 NeuD_NnaD sugar O-acyltransferase, sialic acid O-acetyl 99.6
cd03360197 LbH_AT_putative Putative Acyltransferase (AT), Left-han 99.58
cd05635101 LbH_unknown Uncharacterized proteins, Left-handed paral 98.81
PRK05293381 glgC glucose-1-phosphate adenylyltransferase; Provision 99.42
cd0578779 LbH_eIF2B_epsilon eIF-2B epsilon subunit, central Left- 99.42
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransfe 99.38
PRK02862429 glgC glucose-1-phosphate adenylyltransferase; Provision 99.3
cd04651104 LbH_G1P_AT_C Glucose-1-phosphate adenylyltransferase, C 99.11
TIGR02091421 glgC glucose-1-phosphate adenylyltransferase; InterPro: 98.97
KOG1460407 consensus 98.79
TIGR00965275 dapD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-suc 98.77
cd0582480 LbH_M1P_guanylylT_C Mannose-1-phosphate guanylyltransfe 99.34
PRK01884435 consensus 99.04
PRK00844409 glgC glucose-1-phosphate adenylyltransferase; Provision 99.18
PRK11830265 dapD 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succi 98.77
cd0020878 LbetaH Left-handed parallel beta-Helix (LbetaH or LbH) 99.09
cd04647109 LbH_MAT_like Maltose O-acyltransferase (MAT)-like: This 98.85
PRK10191146 putative colanic acid biosynthesis acetyltransferase Wc 98.82
cd05825107 LbH_wcaF_like wcaF-like: This group is composed of the 98.54
PRK11132273 cysE serine acetyltransferase; Provisional 98.22
KOG4750269 consensus 98.13
TIGR03536341 DapD_gpp 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N 97.65
TIGR03535319 DapD_actino 2,3,4,5-tetrahydropyridine-2,6-dicarboxylat 97.48
KOG1462433 consensus 99.07
cd00897300 UGPase_euk Eukaryotic UGPase catalyses the synthesis of 98.68
cd06424315 UGGPase UGGPase catalyzes the synthesis of UDP-Glucose/ 98.45
KOG2388477 consensus 97.35
KOG2638498 consensus 96.67
TIGR02092383 glgD glucose-1-phosphate adenylyltransferase, GlgD subu 98.39
TIGR01208361 rmlA_long glucose-1-phosphate thymidylyltransferase; In 98.23
PRK13412 974 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransf 97.61
pfam07959414 Fucokinase L-fucokinase. In the salvage pathway of GDP- 96.82
KOG4042190 consensus 96.87
cd02526237 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl transfe 95.69
>TIGR01173 glmU UDP-N-acetylglucosamine pyrophosphorylase; InterPro: IPR005882 N-Acetylglucosamine-1-PO(4) uridyltransferase (GlmU, 2 Back     alignment and domain information
>PRK09451 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>COG1207 GlmU N-acetylglucosamine-1-phosphate uridyltransferase (contains nucleotidyltransferase and I-patch acetyltransferase domains) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05293 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>TIGR01208 rmlA_long glucose-1-phosphate thymidylyltransferase; InterPro: IPR005908 Synonym: dTDP-D-glucose synthase This group of proteins comprises a tightly conserved but broadly distributed subfamily of known and putative bacterial glucose-1-phosphate thymidylyltransferases (2 Back     alignment and domain information
>PRK00844 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK04928 consensus Back     alignment and domain information
>PRK03282 consensus Back     alignment and domain information
>PRK00725 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>PRK01884 consensus Back     alignment and domain information
>KOG1461 consensus Back     alignment and domain information
>KOG1462 consensus Back     alignment and domain information
>TIGR02092 glgD glucose-1-phosphate adenylyltransferase, GlgD subunit; InterPro: IPR011832 This family is GlgD, an apparent regulatory protein that appears in an alpha2/beta2 heterotetramer with GlgC (glucose-1-phosphate adenylyltransferase, IPR011831 from INTERPRO) in a subset of bacteria that use GlgC for glycogen biosynthesis Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK02862 glgC glucose-1-phosphate adenylyltransferase; Provisional Back     alignment and domain information
>TIGR02091 glgC glucose-1-phosphate adenylyltransferase; InterPro: IPR011831 This enzyme, glucose-1-phosphate adenylyltransferase, is also called ADP-glucose pyrophosphorylase Back     alignment and domain information
>PRK03701 consensus Back     alignment and domain information
>COG0448 GlgC ADP-glucose pyrophosphorylase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1460 consensus Back     alignment and domain information
>cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU Back     alignment and domain information
>KOG1322 consensus Back     alignment and domain information
>COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose Back     alignment and domain information
>cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>PRK13389 UTP--glucose-1-phosphate uridylyltransferase subunit GalU; Provisional Back     alignment and domain information
>PRK10122 UTP--glucose-1-phosphate uridylyltransferase subunit GalF; Provisional Back     alignment and domain information
>cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
>cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
>pfam00483 NTP_transferase Nucleotidyl transferase Back     alignment and domain information
>cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>cd02524 G1P_cytidylyltransferase G1P_cytidylyltransferase catalyzes the production of CDP-D-Glucose Back     alignment and domain information
>cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family Back     alignment and domain information
>cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule Back     alignment and domain information