254780943

254780943

glucosamine--fructose-6-phosphate aminotransferase

GeneID in NCBI database:8209965Locus tag:CLIBASIA_04210
Protein GI in NCBI database:254780943Protein Accession:YP_003065356.1
Gene range:+(933040, 934866)Protein Length:608aa
Gene description:glucosamine--fructose-6-phosphate aminotransferase
COG prediction:[M] Glucosamine 6-phosphate synthetase, contains amidotransferase and phosphosugar isomerase domains
KEGG prediction:glmS; glucosamine--fructose-6-phosphate aminotransferase (EC:2.6.1.16); K00820 glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
SEED prediction:Glucosamine--fructose-6-phosphate aminotransferase [isomerizing] (EC 2.6.1.16)
Pathway involved in KEGG:Amino sugar and nucleotide sugar metabolism [PATH:las00520]
Alanine, aspartate and glutamate metabolism [PATH:las00250]
Subsystem involved in SEED:UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis;
Formaldehyde assimilation: Ribulose monophosphate pathway
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOP3 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------61
MCGIVGIVGRESVGERLFKALKRLEYRGYDSSGMATICDGKIQCVRAQGKLSELEKELNKKPLKGNIGIAHTRWATHGLPNKENSHPHCIEGIAVTHNGIIENFSRLKKEHFSSQQVFLTETDTEVIACLLEKFIKNGSSKKETMQKLMQCLTGSYSIAVIFEDDPHSIIVARKGPPLIIGHGEGEMFVGSDVTALTLLTDKVTYMEDGDWAIIRNSGLTIYDSQGYEIERPIQIVQIAPFLIGKGNYRHFMEKEIYEQPEAISRVLSHYINLSDHTIIPNIFNYDFANISGLLVSSCGTSYLAGLVGKFWFERLARLKVEIDVSSEFRYRDFVYSSKWASLFISQSGETADTLASLRYMRTQGLTIGSLVNVLESTIARESDFIFPIKAGPEIGVASTKAFTCQLLVLVIMAIYAGKVRGYINEEQERELIRSLVEIPRKMFDVLQNIYSQIEKLCCGLAKCQTLLYVGRGSSYPLALEGALKIKEISYLHAEGYAAGELKHGPIALITEGTFVIAIAPYDRFFQKTLSNIQEIVTRGGRVIFITDEEGLKRQDFPSIETIVLPSMGEIVSPIVFSLPIQMIAYCTAVLIGTDVDQPRNLAKSVTVE
ccEEEEEEccccHHHHHHHHHHHHHHccccccEEEEEEccEEEEEEccccHHHHHHHHccccccccEEEEEEEcccccccccccccccEEccEEEEEccEEccHHHHHHHHHHcccEEccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccEEEEEEEcccccEEEEccccccEEEEEEccEEEEEEEcccccccccEEEEEccccEEEEEcccEEEEccccccccccccccccHHHHHccccccHHccccccHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEccccHHHHHHHHHHHHHHccccEEEEccccccccccccccccEEEEEccccccHHHHHHHHHHHHcccEEEEEEcccccHHHHHccEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHHHHcccccEEEcccccccccHHHccccccEEEEcccccHHHHHHHHHHHHHHccccEEEEEcccccccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc
ccEEEEEEcccccHHHHHHHHHccccccccEEEEEEEccccEEEEEEEccHHHHHHHHHcccccccEEEEEEEccccccccccccccEEEccEEEEEEEEEccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHccEEEEEEEEEccccccEEEEEEEcccEEEEccccEEEEccHHHccccccEEEEcccccEEEEccccEEEEcccccEEccEEEEEcccHHHHHccccccHHHHHHHcHHHHHHHHHcccEEccccEEccccHHHHHHHccEEEEEEcHHHHHHHHHHHHHHHHHccccEEEEEHHHHHcccccccccEEEEEEEcccccHHHHHHHHHHHccccEEEEEEcccccHHHHcccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccccccEEEEEEcHHHHHHHHHHHHHHHHHHccEEEEEEHHHccccHHHHccccccEEEEcccHHHHHHHHHHHHHcHHHcccEEEEEEHHcccccccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccc
MCGIVGIVGRESVGERLFKALKRLeyrgydssgmaticdgkiqCVRAQGKLSELEKElnkkplkgnigiahtrwathglpnkenshphciEGIAVTHNGIIENFSRLKKEHFSSQQVFLTETDTEVIACLLEKFIKNGSSKKETMQKLMQCLTGSYsiavifeddphsiivarkgppliighgegemfvgsdVTALTLLTDkvtymedgdwaiirnsgltiydsqgyeierpiqivqiapfligkgnyrhFMEKEIYEQPEAISRVLSHYinlsdhtiipnifnydfANISGLLVSSCGTSYLAGLVGKFWFERLARLKVEidvssefryrdfvyssKWASLFISQSGETADTLASLRYMRTQGLTIGSLVNVLESTiaresdfifpikagpeigvaSTKAFTCQLLVLVIMAIYAGKVRGYINEEQERELIRSLVEIPRKMFDVLQNIYSQIEKLCCGLakcqtllyvgrgssyplaLEGALKIKEISYLHAEgyaagelkhgpialitegtfviaiapydRFFQKTLSNIQEIVTRGGrvifitdeeglkrqdfpsietivlpsmgeivspivFSLPIQMIAYCTAVLigtdvdqprnlaksvtve
mcgivgivgresvgeRLFKALKRLEYRGYDSSGMATICDGKIQCVRAQGKLSELEKelnkkplkgniGIAHTRWATHGLPNKENSHPHCIEGIAVTHNGIIENFSRLKKEHFSSQQVFLTETDTEVIACLLEKFikngsskkETMQKLMQCLTGSYSIAVIFEDDPHSIIVARKGPPLIIGHGEGEMFVGSDVTALTLLTDKVTYMEDGDWAIIRNSGLTIYDSQGYEIERPIQIVQIAPFLIGKGNYRHFMEKEIYEQPEAISRVLSHYINLSDHTIIPNIFNYDFANISGLLVSSCGTSYLAGLVGKFWFERLARLKVeidvssefryrDFVYSSKWASLFISQSGETADTLASLRYMRTQGLTIGSLVNVLESTIARESDFIFPIKAGPEIGVASTKAFTCQLLVLVIMAIYAGKVRGYINEEQERELIRSLVEIPRKMFDVLQNIYSQIEKLCCGLAKCQTLLYVGRGSSYPLALEGALKIKEISYLHAEGYAAGELKHGPIALITEGTFVIAIAPYDRFFQKTLSNIQEIVTRGGRVIFItdeeglkrqdfpSIETIVLPSMGEIVSPIVFSLPIQMIAYCTAVLIgtdvdqprnlaksvtve
MCGIVGIVGRESVGERLFKALKRLEYRGYDSSGMATICDGKIQCVRAQGklselekelnkkplkGNIGIAHTRWATHGLPNKENSHPHCIEGIAVTHNGIIENFSRLKKEHFSSQQVFLTETDTEVIACLLEKFIKNGSSKKETMQKLMQCLTGSYSIAVIFEDDPHSIIVARKGPPLIIGHGEGEMFVGSDVTALTLLTDKVTYMEDGDWAIIRNSGLTIYDSQGYEIERPIQIVQIAPFLIGKGNYRHFMEKEIYEQPEAISRVLSHYINLSDHTIIPNIFNYDFANISGLLVSSCGTSYLAGLVGKFWFERLARLKVEIDVSSEFRYRDFVYSSKWASLFISQSGETADTLASLRYMRTQGLTIGSLVNVLESTIARESDFIFPIKAGPEIGVASTKAFTCQLLVLVIMAIYAGKVRGYINEEQERELIRSLVEIPRKMFDVLQNIYSQIEKLCCGLAKCQTLLYVGRGSSYPLALEGALKIKEISYLHAEGYAAGELKHGPIALITEGTFVIAIAPYDRFFQKTLSNIQEIVTRGGRVIFITDEEGLKRQDFPSIETIVLPSMGEIVSPIVFSLPIQMIAYCTAVLIGTDVDQPRNLAKSVTVE
MCGIVGIVGRESVGERLFKALKRLEYRGYDSSGMATICDGKIQCVRAQGKLSELEKELNKKPLKGNIGIAHTRWATHGLPNKENSHPHCIEGIAVTHNGIIENFSRLKKEHFSSQQVFLTETDTEVIACLLEKFIKNGSSKKETMQKLMQCLTGSYSIAVIFEDDPHSIIVARKGPPLIIGHGEGEMFVGSDVTALTLLTDKVTYMEDGDWAIIRNSGLTIYDSQGYEIERPIQIVQIAPFLIGKGNYRHFMEKEIYEQPEAISRVLSHYINLSDHTIIPNIFNYDFANISGLLVSSCGTSYLAGLVGKFWFERLARLKVEIDVSSEFRYRDFVYSSKWASLFISQSGETADTLASLRYMRTQGLTIGSLVNVLESTIARESDFIFPIKAGPEIGVASTKAFTCQLLVLVIMAIYAGKVRGYINEEQERELIRSLVEIPRKMFDVLQNIYSQIEKLCCGLAKCQTLLYVGRGSSYPLALEGALKIKEISYLHAEGYAAGELKHGPIALITEGTFVIAIAPYDRFFQKTLSNIQEIVTRGGRVIFITDEEGLKRQDFPSIETIVLPSMGEIVSPIVFSLPIQMIAYCTAVLIGTDVDQPRNLAKSVTVE
MCGIVGIVGRESVGERLFKALKRLEYRGYDSSGMATICDGKIQCVRAQGKLSELEKELNKKPLKGNIGIAHTRWATHGLPNKENSHPHCIEGIAVTHNGIIENFSRLKKEHFSSQQVFLTETDTEVIACLLEKFIKNGSSKKETMQKLMQCLTGSYSIAVIFEDDPHSIIVARKGPPLIIGHGEGEMFVGSDVTALTLLTDKVTYMEDGDWAIIRNSGLTIYDSQGYEIERPIQIVQIAPFLIGKGNYRHFMEKEIYEQPEAISRVLSHYINLSDHTIIPNIFNYDFANISGLLVSSCGTSYLAGLVGKFWFERLARLKVEIDVSSEFRYRDFVYSSKWASLFISQSGETADTLASLRYMRTQGLTIGSLVNVLESTIARESDFIFPIKAGPEIGVASTKAFTCQLLVLVIMAIYAGKVRGYINEEQERELIRSLVEIPRKMFDVLQNIYSQIEKLCCGLAKCQTLLYVGRGSSYPLALEGALKIKEISYLHAEGYAAGELKHGPIALITEGTFVIAIAPYDRFFQKTLSNIQEIVTRGGRVIFITDEEGLKRQDFPSIETIVLPSMGEIVSPIVFSLPIQMIAYCTAVLIGTDVDQPRNLAKSVTVE
MCGIVGIVGRESVGERLFKALKRLEYRGYDSSGMATICDGKIQCVRAQGKLSELEKELNKKPLKGNIGIAHTRWATHGLPNKENSHPHCIEGIAVTHNGIIENFSRLKKEHFSSQQVFLTETDTEVIACLLEKFIKNGSSKKETMQKLMQCLTGSYSIAVIFEDDPHSIIVARKGPPLIIGHGEGEMFVGSDVTALTLLTDKVTYMEDGDWAIIRNSGLTIYDSQGYEIERPIQIVQIAPFLIGKGNYRHFMEKEIYEQPEAISRVLSHYINLSDHTIIPNIFNYDFANISGLLVSSCGTSYLAGLVGKFWFERLARLKVEIDVSSEFRYRDFVYSSKWASLFISQSGETADTLASLRYMRTQGLTIGSLVNVLESTIARESDFIFPIKAGPEIGVASTKAFTCQLLVLVIMAIYAGKVRGYINEEQERELIRSLVEIPRKMFDVLQNIYSQIEKLCCGLAKCQTLLYVGRGSSYPLALEGALKIKEISYLHAEGYAAGELKHGPIALITEGTFVIAIAPYDRFFQKTLSNIQEIVTRGGRVIFITDEEGLKRQDFPSIETIVLPSMGEIVSPIVFSLPIQMIAYCTAVLIGTDVDQPRNLAK*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCGIVGIVGRESVGERLFKALKRLEYRGYDSSGMATICDGKIQCVRAQGKLSELEKELNKKPLKGNIGIAHTRWATHGLPNKENSHPHCIEGIAVTHNGIIENFSRLKKEHFSSQQVFLTETDTEVIACLLEKFIKNGSSKKETMQKLMQCLTGSYSIAVIFEDDPHSIIVARKGPPLIIGHGEGEMFVGSDVTALTLLTDKVTYMEDGDWAIIRNSGLTIYDSQGYEIERPIQIVQIAPFLIGKGNYRHFMEKEIYEQPEAISRVLSHYINLSDHTIIPNIFNYDFANISGLLVSSCGTSYLAGLVGKFWFERLARLKVEIDVSSEFRYRDFVYSSKWASLFISQSGETADTLASLRYMRTQGLTIGSLVNVLESTIARESDFIFPIKAGPEIGVASTKAFTCQLLVLVIMAIYAGKVRGYINEEQERELIRSLVEIPRKMFDVLQNIYSQIEKLCCGLAKCQTLLYVGRGSSYPLALEGALKIKEISYLHAEGYAAGELKHGPIALITEGTFVIAIAPYDRFFQKTLSNIQEIVTRGGRVIFITDEEGLKRQDFPSIETIVLPSMGEIVSPIVFSLPIQMIAYCTAVLIGTDVDQPRNLAKSVTVE
MCGIVGIVGRESVGERLFKALKRLEYRGYDSSGMATICDGKIQCVRAQGKLSELEKELNKKPLKGNIGIAHTRWATHGLPNKENSHPHCIEGIAVTHNGIIENFSRLKKEHFSSQQVFLTETDTEVIACLLEKFIKNGSSKKETMQKLMQCLTGSYSIAVIFEDDPHSIIVARKGPPLIIGHGEGEMFVGSDVTALTLLTDKVTYMEDGDWAIIRNSGLTIYDSQGYEIERPIQIVQIAPFLIGKGNYRHFMEKEIYEQPEAISRVLSHYINLSDHTIIPNIFNYDFANISGLLVSSCGTSYLAGLVGKFWFERLARLKVEIDVSSEFRYRDFVYSSKWASLFISQSGETADTLASLRYMRTQGLTIGSLVNVLESTIARESDFIFPIKAGPEIGVASTKAFTCQLLVLVIMAIYAGKVRGYINEEQERELIRSLVEIPRKMFDVLQNIYSQIEKLCCGLAKCQTLLYVGRGSSYPLALEGALKIKEISYLHAEGYAAGELKHGPIALITEGTFVIAIAPYDRFFQKTLSNIQEIVTRGGRVIFITDEEGLKRQDFPSIETIVLPSMGEIVSPIVFSLPIQMIAYCTAVLIGTDVDQPRNLAKSVTVE
MCGIVGIVGRESVGERLFKALKRLEYRGYDSSGMATICDGKIQCVRAQGKLSELEKELNKKPLKGNIGIAHTRWATHGLPNKENSHPHCIEGIAVTHNGIIENFSRLKKEHFSSQQVFLTETDTEVIACLLEKFIKNGSSKKETMQKLMQCLTGSYSIAVIFEDDPHSIIVARKGPPLIIGHGEGEMFVGSDVTALTLLTDKVTYMEDGDWAIIRNSGLTIYDSQGYEIERPIQIVQIAPFLIGKGNYRHFMEKEIYEQPEAISRVLSHYINLSDHTIIPNIFNYDFANISGLLVSSCGTSYLAGLVGKFWFERLARLKVEIDVSSEFRYRDFVYSSKWASLFISQSGETADTLASLRYMRTQGLTIGSLVNVLESTIARESDFIFPIKAGPEIGVASTKAFTCQLLVLVIMAIYAGKVRGYINEEQERELIRSLVEIPRKMFDVLQNIYSQIEKLCCGLAKCQTLLYVGRGSSYPLALEGALKIKEISYLHAEGYAAGELKHGPIALITEGTFVIAIAPYDRFFQKTLSNIQEIVTRGGRVIFITDEEGLKRQDFPSIETIVLPSMGEIVSPIVFSLPIQMIAYCTAVLIGTDVDQPRNLAKSVTVE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target608 glucosamine--fructose-6-phosphate aminotransferase [Can
254780336488 amidophosphoribosyltransferase [Candidatus Liberib 2e-15
>gi|254780336|ref|YP_003064749.1| amidophosphoribosyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 488 Back     alignment
 Score = 75.5 bits (184), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 101/216 (46%), Gaps = 17/216 (7%)

Query: 2   CGIVGIVGRESVGERLFKALKRLEYRGYDSSGMATICDGKIQCVRAQGKLSE-LEKELNK 60
           CG+ GI+G           L  L++RG +++G+ +    K    R  G + +   K    
Sbjct: 15  CGVFGILGHPDAATLTAIGLHALQHRGQEATGIISFNGNKFHSERHLGLVGDHFTKPETL 74

Query: 61  KPLKGNIGIAHTRWATHGLPNKENSHPHCIE----GIAVTHNGIIENFSRLKKEHFSSQQ 116
             L GN+ I H R++T G     N  P   +    GIA+ HNG   N   L+K+  SS  
Sbjct: 75  SLLPGNMAIGHVRYSTTGDQIIRNVQPLFADLQVGGIAIAHNGNFTNGLTLRKKLISSGA 134

Query: 117 VFLTETDTEVIACLLEKFIKNGSSKKETMQKLMQCLTGSYSIAVIFEDDPHSIIVARKGP 176
           +F + +DTEVI  L+ +  KNGS  +      ++ + G+Y++  +      + ++A + P
Sbjct: 135 IFQSTSDTEVILHLIARSQKNGSCDR--FIDSLRHVQGAYAMLALTR----TKLIATRDP 188

Query: 177 ----PLIIGHGEGEMFVGSDVTALTLLTDKVTYMED 208
               PLI+G   G+    S+  AL +   K  Y+ D
Sbjct: 189 IGIRPLIMGELHGKPIFCSETCALEITGAK--YIRD 222

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target608 glucosamine--fructose-6-phosphate aminotransferase [Can
315122356608 glucosamine--fructose-6-phosphate aminotransferase [Can 1 0.0
86357710608 D-fructose-6-phosphate amidotransferase [Rhizobium etli 1 0.0
327188306608 glucosamine--fructose-6-phosphate aminotransferase prot 1 0.0
227822019608 glucosamine--fructose-6-phosphate aminotransferase [Sin 1 0.0
190891735608 glucosamine--fructose-6-phosphate aminotransferase [Rhi 1 0.0
241204635608 glucosamine--fructose-6-phosphate aminotransferase [Rhi 1 0.0
209549322608 glucosamine--fructose-6-phosphate aminotransferase [Rhi 1 0.0
222085967608 glucosamine--fructose-6-phosphate aminotransferase, iso 1 0.0
116252134608 glucosamine--fructose-6-phosphate aminotransferase [Rhi 1 0.0
150396618608 glucosamine--fructose-6-phosphate aminotransferase [Sin 1 0.0
>gi|315122356|ref|YP_004062845.1| glucosamine--fructose-6-phosphate aminotransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 608 Back     alignment and organism information
 Score = 1061 bits (2744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/608 (82%), Positives = 560/608 (92%)

Query: 1   MCGIVGIVGRESVGERLFKALKRLEYRGYDSSGMATICDGKIQCVRAQGKLSELEKELNK 60
           MCGIVGIVG++ V +RLF+ALKRLEYRGYDSSGMATI DGKIQC+RAQGKLS L++EL K
Sbjct: 1   MCGIVGIVGKKKVEKRLFEALKRLEYRGYDSSGMATIYDGKIQCIRAQGKLSALDQELKK 60

Query: 61  KPLKGNIGIAHTRWATHGLPNKENSHPHCIEGIAVTHNGIIENFSRLKKEHFSSQQVFLT 120
            PLKGNIGIAHTRWATHG+P+KEN+HPHCI+GIAV HNGIIENFS LKKE  S + VF T
Sbjct: 61  NPLKGNIGIAHTRWATHGMPSKENAHPHCIDGIAVIHNGIIENFSCLKKELVSFRSVFQT 120

Query: 121 ETDTEVIACLLEKFIKNGSSKKETMQKLMQCLTGSYSIAVIFEDDPHSIIVARKGPPLII 180
           ETDTEVIACLL KFI++G SKKE MQK+M CL GSY+IAVIFEDDP++IIVARKG PLII
Sbjct: 121 ETDTEVIACLLAKFIRDGLSKKECMQKIMHCLIGSYAIAVIFEDDPNTIIVARKGAPLII 180

Query: 181 GHGEGEMFVGSDVTALTLLTDKVTYMEDGDWAIIRNSGLTIYDSQGYEIERPIQIVQIAP 240
           GHGEGEMF+GSDVTAL LLTDKVTY+EDGDWA++ +SGLTIYDS+  E+ER  QIVQ+AP
Sbjct: 181 GHGEGEMFIGSDVTALALLTDKVTYIEDGDWAVVHSSGLTIYDSKNNEVERASQIVQVAP 240

Query: 241 FLIGKGNYRHFMEKEIYEQPEAISRVLSHYINLSDHTIIPNIFNYDFANISGLLVSSCGT 300
           FL+GKG YRHFMEKEIYEQPEAISRVLSHY++LSDHTI+P IFNYDFA ISGLLVSSCGT
Sbjct: 241 FLVGKGQYRHFMEKEIYEQPEAISRVLSHYLHLSDHTIVPTIFNYDFAKISGLLVSSCGT 300

Query: 301 SYLAGLVGKFWFERLARLKVEIDVSSEFRYRDFVYSSKWASLFISQSGETADTLASLRYM 360
           SYLAGL+GKFWFERLA LKVEIDVSSEFRYRDFVYSS+WASLFISQSGETADTLASLRYM
Sbjct: 301 SYLAGLIGKFWFERLAGLKVEIDVSSEFRYRDFVYSSEWASLFISQSGETADTLASLRYM 360

Query: 361 RTQGLTIGSLVNVLESTIARESDFIFPIKAGPEIGVASTKAFTCQLLVLVIMAIYAGKVR 420
           R+ GL IGSLVNVLES+IARESD +FPIKAGPEIGVASTKAF+CQL VL+IMAIYAGK+R
Sbjct: 361 RSNGLMIGSLVNVLESSIARESDLVFPIKAGPEIGVASTKAFSCQLSVLLIMAIYAGKIR 420

Query: 421 GYINEEQERELIRSLVEIPRKMFDVLQNIYSQIEKLCCGLAKCQTLLYVGRGSSYPLALE 480
           G+I+ +QE+ELI SL+E+PRKMF++LQNIYSQ+EKLCC L+KC  +LY+GRGSSYPLALE
Sbjct: 421 GHIHADQEKELIESLIEVPRKMFNILQNIYSQVEKLCCLLSKCHNILYIGRGSSYPLALE 480

Query: 481 GALKIKEISYLHAEGYAAGELKHGPIALITEGTFVIAIAPYDRFFQKTLSNIQEIVTRGG 540
           GALKIKEISY+HAEGYAAGELKHGPIALI++ T VI IAPYDRFF K LSN+QEIV RGG
Sbjct: 481 GALKIKEISYIHAEGYAAGELKHGPIALISQDTPVIVIAPYDRFFSKNLSNVQEIVARGG 540

Query: 541 RVIFITDEEGLKRQDFPSIETIVLPSMGEIVSPIVFSLPIQMIAYCTAVLIGTDVDQPRN 600
           R++FITDEEG KRQDFPS+ETIVLP+  EI+SPI+FSLPIQMIAYCTAV +GTDVDQPRN
Sbjct: 541 RIVFITDEEGAKRQDFPSLETIVLPNTNEIISPIIFSLPIQMIAYCTAVFMGTDVDQPRN 600

Query: 601 LAKSVTVE 608
           LAKSVTVE
Sbjct: 601 LAKSVTVE 608


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86357710|ref|YP_469602.1| D-fructose-6-phosphate amidotransferase [Rhizobium etli CFN 42] Length = 608 Back     alignment and organism information
>gi|327188306|gb|EGE55525.1| glucosamine--fructose-6-phosphate aminotransferase protein [Rhizobium etli CNPAF512] Length = 608 Back     alignment and organism information
>gi|227822019|ref|YP_002825990.1| glucosamine--fructose-6-phosphate aminotransferase [Sinorhizobium fredii NGR234] Length = 608 Back     alignment and organism information
>gi|190891735|ref|YP_001978277.1| glucosamine--fructose-6-phosphate aminotransferase [Rhizobium etli CIAT 652] Length = 608 Back     alignment and organism information
>gi|241204635|ref|YP_002975731.1| glucosamine--fructose-6-phosphate aminotransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 608 Back     alignment and organism information
>gi|209549322|ref|YP_002281239.1| glucosamine--fructose-6-phosphate aminotransferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 608 Back     alignment and organism information
>gi|222085967|ref|YP_002544499.1| glucosamine--fructose-6-phosphate aminotransferase, isomerizing [Agrobacterium radiobacter K84] Length = 608 Back     alignment and organism information
>gi|116252134|ref|YP_767972.1| glucosamine--fructose-6-phosphate aminotransferase [Rhizobium leguminosarum bv. viciae 3841] Length = 608 Back     alignment and organism information
>gi|150396618|ref|YP_001327085.1| glucosamine--fructose-6-phosphate aminotransferase [Sinorhizobium medicae WSM419] Length = 608 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target608 glucosamine--fructose-6-phosphate aminotransferase [Can
PRK00331604 PRK00331, PRK00331, glucosamine--fructose-6-phosphate a 0.0
TIGR01135607 TIGR01135, glmS, glucosamine--fructose-6-phosphate amin 0.0
PTZ00295640 PTZ00295, PTZ00295, glucosamine-fructose-6-phosphate am 1e-127
KOG1268670 KOG1268, KOG1268, KOG1268, Glucosamine 6-phosphate synt 1e-122
PTZ00394670 PTZ00394, PTZ00394, glucosamine-fructose-6-phosphate am 1e-117
PLN02981680 PLN02981, PLN02981, glucosamine:fructose-6-phosphate am 1e-111
COG0449597 COG0449, GlmS, Glucosamine 6-phosphate synthetase, cont 0.0
cd00714215 cd00714, GFAT, Glutamine amidotransferases class-II (Gn 4e-77
cd00352220 cd00352, Gn_AT_II, Glutamine amidotransferases class-II 4e-40
cd00715252 cd00715, GPATase_N, Glutamine amidotransferases class-I 2e-29
TIGR01134442 TIGR01134, purF, amidophosphoribosyltransferase 4e-29
pfam00310223 pfam00310, GATase_2, Glutamine amidotransferases class- 1e-28
COG0034470 COG0034, PurF, Glutamine phosphoribosylpyrophosphate am 1e-27
PRK05793469 PRK05793, PRK05793, amidophosphoribosyltransferase; Pro 1e-23
PRK06388474 PRK06388, PRK06388, amidophosphoribosyltransferase; Pro 2e-20
cd01907249 cd01907, GlxB, Glutamine amidotransferases class-II (Gn 6e-20
PLN02440479 PLN02440, PLN02440, amidophosphoribosyltransferase 7e-20
PRK09246501 PRK09246, PRK09246, amidophosphoribosyltransferase; Pro 1e-18
PRK08341442 PRK08341, PRK08341, amidophosphoribosyltransferase; Pro 2e-18
PRK06781471 PRK06781, PRK06781, amidophosphoribosyltransferase; Pro 2e-15
PRK07631475 PRK07631, PRK07631, amidophosphoribosyltransferase; Pro 3e-14
PRK08525445 PRK08525, PRK08525, amidophosphoribosyltransferase; Pro 6e-14
PRK07272484 PRK07272, PRK07272, amidophosphoribosyltransferase; Pro 1e-13
COG0367542 COG0367, AsnB, Asparagine synthase (glutamine-hydrolyzi 3e-13
PRK09123479 PRK09123, PRK09123, amidophosphoribosyltransferase; Pro 6e-12
cd00712220 cd00712, AsnB, Glutamine amidotransferases class-II (GA 1e-10
PLN02549578 PLN02549, PLN02549, asparagine synthase (glutamine-hydr 1e-08
PRK09431554 PRK09431, asnB, asparagine synthetase B; Provisional 2e-08
PRK07847510 PRK07847, PRK07847, amidophosphoribosyltransferase; Pro 3e-07
PTZ00077586 PTZ00077, PTZ00077, asparagine synthetase-like protein; 1e-04
TIGR01536467 TIGR01536, asn_synth_AEB, asparagine synthase (glutamin 1e-04
COG0121252 COG0121, COG0121, Predicted glutamine amidotransferase 2e-04
COG2222340 COG2222, AgaS, Predicted phosphosugar isomerases [Cell 4e-45
PRK11382340 PRK11382, frlB, fructoselysine-6-P-deglycase; Provision 3e-04
cd05009153 cd05009, SIS_GlmS_GlmD_2, SIS (Sugar ISomerase) domain 6e-44
pfam01380131 pfam01380, SIS, SIS domain 3e-18
cd05010151 cd05010, SIS_AgaS_like, AgaS-like protein 8e-06
cd05008126 cd05008, SIS_GlmS_GlmD_1, SIS (Sugar ISomerase) domain 5e-37
pfam01380131 pfam01380, SIS, SIS domain 7e-20
cd05710120 cd05710, SIS_1, A subgroup of the SIS domain 1e-06
KOG0572474 KOG0572, KOG0572, KOG0572, Glutamine phosphoribosylpyro 7e-18
PRK07349500 PRK07349, PRK07349, amidophosphoribosyltransferase; Pro 1e-14
cd01908257 cd01908, YafJ, Glutamine amidotransferases class-II (Gn 3e-09
COG0067371 COG0067, GltB, Glutamate synthase domain 1 [Amino acid 8e-07
TIGR03108628 TIGR03108, eps_aminotran_1, exosortase 1 system-associa 0.001
cd05007257 cd05007, SIS_Etherase, N-acetylmuramic acid 6-phosphate 4e-06
COG2103298 COG2103, COG2103, Predicted sugar phosphate isomerase [ 2e-05
cd05014128 cd05014, SIS_Kpsf, KpsF-like protein 3e-05
COG0794202 COG0794, GutQ, Predicted sugar phosphate isomerase invo 6e-05
PRK05441299 PRK05441, murQ, N-acetylmuramic acid-6-phosphate ethera 2e-04
cd05013139 cd05013, SIS_RpiR, RpiR-like protein 0.001
TIGR00274291 TIGR00274, TIGR00274, N-acetylmuramic acid 6-phosphate 0.003
TIGR02815372 TIGR02815, agaS_fam, putative sugar isomerase, AgaS fam 1e-04
COG1737281 COG1737, RpiR, Transcriptional regulators [Transcriptio 0.001
>gnl|CDD|178980 PRK00331, PRK00331, glucosamine--fructose-6-phosphate aminotransferase; Reviewed Back     alignment and domain information
>gnl|CDD|130205 TIGR01135, glmS, glucosamine--fructose-6-phosphate aminotransferase (isomerizing) Back     alignment and domain information
>gnl|CDD|185544 PTZ00295, PTZ00295, glucosamine-fructose-6-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|36482 KOG1268, KOG1268, KOG1268, Glucosamine 6-phosphate synthetases, contain amidotransferase and phosphosugar isomerase domains [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>gnl|CDD|173585 PTZ00394, PTZ00394, glucosamine-fructose-6-phosphate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|178562 PLN02981, PLN02981, glucosamine:fructose-6-phosphate aminotransferase Back     alignment and domain information
>gnl|CDD|30798 COG0449, GlmS, Glucosamine 6-phosphate synthetase, contains amidotransferase and phosphosugar isomerase domains [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|48478 cd00714, GFAT, Glutamine amidotransferases class-II (Gn-AT)_GFAT-type Back     alignment and domain information
>gnl|CDD|48475 cd00352, Gn_AT_II, Glutamine amidotransferases class-II (GATase) Back     alignment and domain information
>gnl|CDD|48479 cd00715, GPATase_N, Glutamine amidotransferases class-II (GN-AT)_GPAT- type Back     alignment and domain information
>gnl|CDD|162218 TIGR01134, purF, amidophosphoribosyltransferase Back     alignment and domain information
>gnl|CDD|144048 pfam00310, GATase_2, Glutamine amidotransferases class-II Back     alignment and domain information
>gnl|CDD|30383 COG0034, PurF, Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|180262 PRK05793, PRK05793, amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|102351 PRK06388, PRK06388, amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|73286 cd01907, GlxB, Glutamine amidotransferases class-II (Gn-AT)_GlxB-type Back     alignment and domain information
>gnl|CDD|178059 PLN02440, PLN02440, amidophosphoribosyltransferase Back     alignment and domain information
>gnl|CDD|181724 PRK09246, PRK09246, amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|181395 PRK08341, PRK08341, amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|136048 PRK06781, PRK06781, amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|181061 PRK07631, PRK07631, amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|181456 PRK08525, PRK08525, amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|180913 PRK07272, PRK07272, amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|30716 COG0367, AsnB, Asparagine synthase (glutamine-hydrolyzing) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181660 PRK09123, PRK09123, amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|48476 cd00712, AsnB, Glutamine amidotransferases class-II (GATase) asparagine synthase_B type Back     alignment and domain information
>gnl|CDD|178164 PLN02549, PLN02549, asparagine synthase (glutamine-hydrolyzing) Back     alignment and domain information
>gnl|CDD|181851 PRK09431, asnB, asparagine synthetase B; Provisional Back     alignment and domain information
>gnl|CDD|181143 PRK07847, PRK07847, amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|185431 PTZ00077, PTZ00077, asparagine synthetase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|162406 TIGR01536, asn_synth_AEB, asparagine synthase (glutamine-hydrolyzing) Back     alignment and domain information
>gnl|CDD|30470 COG0121, COG0121, Predicted glutamine amidotransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|32404 COG2222, AgaS, Predicted phosphosugar isomerases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|183111 PRK11382, frlB, fructoselysine-6-P-deglycase; Provisional Back     alignment and domain information
>gnl|CDD|88406 cd05009, SIS_GlmS_GlmD_2, SIS (Sugar ISomerase) domain repeat 2 found in Glucosamine 6-phosphate synthase (GlmS) and Glucosamine-6-phosphate deaminase (GlmD) Back     alignment and domain information
>gnl|CDD|144827 pfam01380, SIS, SIS domain Back     alignment and domain information
>gnl|CDD|88407 cd05010, SIS_AgaS_like, AgaS-like protein Back     alignment and domain information
>gnl|CDD|88405 cd05008, SIS_GlmS_GlmD_1, SIS (Sugar ISomerase) domain repeat 1 found in Glucosamine 6-phosphate synthase (GlmS) and Glucosamine-6-phosphate deaminase (GlmD) Back     alignment and domain information
>gnl|CDD|144827 pfam01380, SIS, SIS domain Back     alignment and domain information
>gnl|CDD|88414 cd05710, SIS_1, A subgroup of the SIS domain Back     alignment and domain information
>gnl|CDD|35792 KOG0572, KOG0572, KOG0572, Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|180940 PRK07349, PRK07349, amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|48481 cd01908, YafJ, Glutamine amidotransferases class-II (Gn-AT)_YafJ-type Back     alignment and domain information
>gnl|CDD|30416 COG0067, GltB, Glutamate synthase domain 1 [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|132152 TIGR03108, eps_aminotran_1, exosortase 1 system-associated amidotransferase 1 Back     alignment and domain information
>gnl|CDD|88404 cd05007, SIS_Etherase, N-acetylmuramic acid 6-phosphate etherase Back     alignment and domain information
>gnl|CDD|32286 COG2103, COG2103, Predicted sugar phosphate isomerase [General function prediction only] Back     alignment and domain information
>gnl|CDD|88409 cd05014, SIS_Kpsf, KpsF-like protein Back     alignment and domain information
>gnl|CDD|31137 COG0794, GutQ, Predicted sugar phosphate isomerase involved in capsule formation [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|180083 PRK05441, murQ, N-acetylmuramic acid-6-phosphate etherase; Reviewed Back     alignment and domain information
>gnl|CDD|88408 cd05013, SIS_RpiR, RpiR-like protein Back     alignment and domain information
>gnl|CDD|129375 TIGR00274, TIGR00274, N-acetylmuramic acid 6-phosphate etherase Back     alignment and domain information
>gnl|CDD|131862 TIGR02815, agaS_fam, putative sugar isomerase, AgaS family Back     alignment and domain information
>gnl|CDD|31923 COG1737, RpiR, Transcriptional regulators [Transcription] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 608 glucosamine--fructose-6-phosphate aminotransferase [Can
TIGR01135628 glmS glucosamine--fructose-6-phosphate aminotransferase 100.0
PRK00331604 glucosamine--fructose-6-phosphate aminotransferase; Rev 100.0
PTZ00295691 glucosamine-fructose-6-phosphate aminotransferase; Prov 100.0
COG0449597 GlmS Glucosamine 6-phosphate synthetase, contains amido 100.0
KOG1268670 consensus 100.0
PRK11382347 frlB fructoselysine-6-P-deglycase; Provisional 100.0
COG2222340 AgaS Predicted phosphosugar isomerases [Cell envelope b 100.0
TIGR02815374 agaS_fam putative sugar isomerase, AgaS family; InterPr 100.0
PRK08674328 bifunctional phosphoglucose/phosphomannose isomerase; V 100.0
cd00714215 GFAT Glutamine amidotransferases class-II (Gn-AT)_GFAT- 100.0
cd00715252 GPATase_N Glutamine amidotransferases class-II (GN-AT)_ 100.0
PRK08525445 amidophosphoribosyltransferase; Provisional 100.0
PRK06781471 amidophosphoribosyltransferase; Provisional 100.0
PRK07349495 amidophosphoribosyltransferase; Provisional 100.0
PRK09246503 amidophosphoribosyltransferase; Provisional 100.0
PRK07631475 amidophosphoribosyltransferase; Provisional 100.0
PRK05793472 amidophosphoribosyltransferase; Provisional 100.0
PRK06388474 amidophosphoribosyltransferase; Provisional 100.0
PRK07272484 amidophosphoribosyltransferase; Provisional 100.0
PRK09123480 amidophosphoribosyltransferase; Provisional 100.0
PRK08341442 amidophosphoribosyltransferase; Provisional 100.0
cd01907249 GlxB Glutamine amidotransferases class-II (Gn-AT)_GlxB- 100.0
PRK07847489 amidophosphoribosyltransferase; Provisional 100.0
TIGR01134467 purF amidophosphoribosyltransferase; InterPro: IPR00585 100.0
COG0034470 PurF Glutamine phosphoribosylpyrophosphate amidotransfe 100.0
pfam00310223 GATase_2 Glutamine amidotransferases class-II. 100.0
KOG0572474 consensus 100.0
cd00352220 Gn_AT_II Glutamine amidotransferases class-II (GATase). 100.0
TIGR01536646 asn_synth_AEB asparagine synthase (glutamine-hydrolyzin 100.0
PRK09431555 asnB asparagine synthetase B; Provisional 99.97
TIGR03108628 eps_aminotran_1 exosortase 1 system-associated amidotra 99.97
PTZ00077610 asparagine synthetase; Provisional 99.97
TIGR03104589 trio_amidotrans asparagine synthase family amidotransfe 99.97
cd00712220 AsnB Glutamine amidotransferases class-II (GATase) aspa 99.97
COG0367542 AsnB Asparagine synthase (glutamine-hydrolyzing) [Amino 99.97
cd03766181 Gn_AT_II_novel Gn_AT_II_novel. This asparagine synthase 99.89
cd01908257 YafJ Glutamine amidotransferases class-II (Gn-AT)_YafJ- 99.88
TIGR03442251 conserved hypothetical protein TIGR03442. Members of th 99.85
KOG0571543 consensus 99.83
COG0121252 Predicted glutamine amidotransferase [General function 99.52
cd00713413 GltS Glutamine amidotransferases class-II (Gn-AT), glut 99.22
cd05009153 SIS_GlmS_GlmD_2 SIS (Sugar ISomerase) domain repeat 2 f 100.0
cd05010151 SIS_AgaS_like AgaS-like protein. AgaS contains a SIS (S 100.0
pfam01380131 SIS SIS domain. SIS (Sugar ISomerase) domains are found 99.27
PRK00331 604 glucosamine--fructose-6-phosphate aminotransferase; Rev 98.82
cd05710120 SIS_1 A subgroup of the SIS domain. SIS (Sugar ISomeras 98.73
PTZ00295 691 glucosamine-fructose-6-phosphate aminotransferase; Prov 98.53
COG1737281 RpiR Transcriptional regulators [Transcription] 98.51
cd05005179 SIS_PHI Hexulose-6-phosphate isomerase (PHI). PHI is a 98.47
cd05013139 SIS_RpiR RpiR-like protein. RpiR contains a SIS (Sugar 98.4
TIGR03127179 RuMP_HxlB 6-phospho 3-hexuloisomerase. Members of this 98.39
cd05008126 SIS_GlmS_GlmD_1 SIS (Sugar ISomerase) domain repeat 1 f 98.28
COG0449 597 GlmS Glucosamine 6-phosphate synthetase, contains amido 98.23
PRK11543 321 gutQ D-arabinose 5-phosphate isomerase; Provisional 97.39
PRK13937192 phosphoheptose isomerase; Provisional 96.97
PRK10892 326 D-arabinose 5-phosphate isomerase; Provisional 96.97
PRK02947247 hypothetical protein; Provisional 96.74
pfam10432154 bact-PGI_C Bacterial phospho-glucose isomerase C-termin 96.25
KOG1268 670 consensus 94.96
PRK05441273 murQ N-acetylmuramic acid-6-phosphate etherase; Reviewe 93.92
cd05637132 SIS_PGI_PMI_2 The members of this protein family contai 93.83
cd05008126 SIS_GlmS_GlmD_1 SIS (Sugar ISomerase) domain repeat 1 f 100.0
cd05710120 SIS_1 A subgroup of the SIS domain. SIS (Sugar ISomeras 99.97
pfam01380131 SIS SIS domain. SIS (Sugar ISomerase) domains are found 99.94
cd05014128 SIS_Kpsf KpsF-like protein. KpsF is an arabinose-5-phos 99.78
PRK11302284 DNA-binding transcriptional regulator HexR; Provisional 99.6
cd05005179 SIS_PHI Hexulose-6-phosphate isomerase (PHI). PHI is a 99.59
TIGR03127179 RuMP_HxlB 6-phospho 3-hexuloisomerase. Members of this 99.57
COG0794202 GutQ Predicted sugar phosphate isomerase involved in ca 99.56
PRK11337293 DNA-binding transcriptional repressor RpiR; Provisional 99.56
cd05013139 SIS_RpiR RpiR-like protein. RpiR contains a SIS (Sugar 99.55
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisional 99.53
PRK05441273 murQ N-acetylmuramic acid-6-phosphate etherase; Reviewe 99.43
cd05007257 SIS_Etherase N-acetylmuramic acid 6-phosphate etherase. 99.42
PRK12570296 N-acetylmuramic acid-6-phosphate etherase; Reviewed 99.35
TIGR00393272 kpsF sugar isomerase, KpsF/GutQ family; InterPro: IPR00 99.28
COG0279176 GmhA Phosphoheptose isomerase [Carbohydrate transport a 98.7
COG2222340 AgaS Predicted phosphosugar isomerases [Cell envelope b 98.61
PRK02947247 hypothetical protein; Provisional 98.51
cd05009153 SIS_GlmS_GlmD_2 SIS (Sugar ISomerase) domain repeat 2 f 98.42
COG0166446 Pgi Glucose-6-phosphate isomerase [Carbohydrate transpo 98.04
COG4821243 Uncharacterized protein containing SIS (Sugar ISomerase 98.02
cd05010151 SIS_AgaS_like AgaS-like protein. AgaS contains a SIS (S 97.98
pfam00342483 PGI Phosphoglucose isomerase. Phosphoglucose isomerase 97.72
PRK00179525 pgi glucose-6-phosphate isomerase; Reviewed 97.59
PRK09533 950 bifunctional transaldolase/phosoglucose isomerase; Vali 97.18
PRK04020204 rps2P 30S ribosomal protein S2; Provisional 95.46
PTZ00254242 40S ribosomal protein SA; Provisional 94.42
TIGR01012197 Sa_S2_E_A ribosomal protein S2; InterPro: IPR005707 Rib 94.0
COG0067371 GltB Glutamate synthase domain 1 [Amino acid transport 99.86
cd01909199 betaLS_CarA_N Glutamine amidotransferases class-II (GAT 99.66
PRK11557282 putative DNA-binding transcriptional regulator; Provisi 99.64
COG1737281 RpiR Transcriptional regulators [Transcription] 99.56
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 99.55
COG2103298 Predicted sugar phosphate isomerase [General function p 99.28
TIGR00274291 TIGR00274 glucokinase regulator homolog; InterPro: IPR0 99.15
PRK11382347 frlB fructoselysine-6-P-deglycase; Provisional 98.75
TIGR00441186 gmhA phosphoheptose isomerase; InterPro: IPR004515 Phos 98.58
LOAD_sis90 consensus 99.57
cd0479587 SIS SIS domain. SIS (Sugar ISomerase) domains are found 99.2
cd05017119 SIS_PGI_PMI_1 The members of this protein family contai 99.07
PRK13938196 phosphoheptose isomerase; Provisional 98.64
cd05006177 SIS_GmhA Phosphoheptose isomerase is a member of the SI 98.63
PRK00414192 gmhA phosphoheptose isomerase; Reviewed 98.59
PRK13937192 phosphoheptose isomerase; Provisional 98.46
PRK13936197 phosphoheptose isomerase; Provisional 98.34
PRK10886196 DnaA initiator-associating protein DiaA; Provisional 98.18
PRK03868409 glucose-6-phosphate isomerase; Provisional 97.91
PRK08674328 bifunctional phosphoglucose/phosphomannose isomerase; V 97.67
cd05015158 SIS_PGI_1 Phosphoglucose isomerase (PGI) contains two S 97.66
PRK00973454 glucose-6-phosphate isomerase; Provisional 97.56
KOG2446546 consensus 90.91
PRK11750 1483 gltB glutamate synthase subunit alpha; Provisional 99.34
KOG0399 2142 consensus 97.97
TIGR02128338 G6PI_arch bifunctional phosphoglucose/phosphomannose is 99.25
TIGR01135 628 glmS glucosamine--fructose-6-phosphate aminotransferase 98.44
PRK11302284 DNA-binding transcriptional regulator HexR; Provisional 98.3
PRK11337293 DNA-binding transcriptional repressor RpiR; Provisional 98.22
PRK11557282 putative DNA-binding transcriptional regulator; Provisi 98.11
cd0479587 SIS SIS domain. SIS (Sugar ISomerase) domains are found 98.11
cd05014128 SIS_Kpsf KpsF-like protein. KpsF is an arabinose-5-phos 97.84
COG0794202 GutQ Predicted sugar phosphate isomerase involved in ca 96.96
cd05006177 SIS_GmhA Phosphoheptose isomerase is a member of the SI 96.67
PRK10886196 DnaA initiator-associating protein DiaA; Provisional 96.15
PRK13936197 phosphoheptose isomerase; Provisional 96.15
PRK00414192 gmhA phosphoheptose isomerase; Reviewed 95.69
PRK13938196 phosphoheptose isomerase; Provisional 95.17
TIGR00274291 TIGR00274 glucokinase regulator homolog; InterPro: IPR0 94.67
LOAD_sis90 consensus 94.58
COG0279176 GmhA Phosphoheptose isomerase [Carbohydrate transport a 93.16
cd01910224 Wali7 This domain is present in Wali7, a protein of unk 98.17
KOG0573520 consensus 97.96
TIGR02128 338 G6PI_arch bifunctional phosphoglucose/phosphomannose is 95.26
cd05017119 SIS_PGI_PMI_1 The members of this protein family contai 94.93
cd02751 609 MopB_DMSOR-like The MopB_DMSOR-like CD contains dimethy 94.83
cd02766501 MopB_3 The MopB_3 CD includes a group of related unchar 93.42
cd02759477 MopB_Acetylene-hydratase The MopB_Acetylene-hydratase C 90.67
cd02769 609 MopB_DMSOR-BSOR-TMAOR The MopB_DMSOR-BSOR-TMAOR CD cont 94.23
>TIGR01135 glmS glucosamine--fructose-6-phosphate aminotransferase, isomerizing; InterPro: IPR005855 Glucosamine:fructose-6-phosphate aminotransferase (2 Back     alignment and domain information
>PRK00331 glucosamine--fructose-6-phosphate aminotransferase; Reviewed Back     alignment and domain information
>PTZ00295 glucosamine-fructose-6-phosphate aminotransferase; Provisional Back     alignment and domain information
>COG0449 GlmS Glucosamine 6-phosphate synthetase, contains amidotransferase and phosphosugar isomerase domains [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG1268 consensus Back     alignment and domain information
>PRK11382 frlB fructoselysine-6-P-deglycase; Provisional Back     alignment and domain information
>COG2222 AgaS Predicted phosphosugar isomerases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02815 agaS_fam putative sugar isomerase, AgaS family; InterPro: IPR014180 Some members of this protein family are found in genic regions associated with N-acetyl-galactosamine and galactosamine utilisation and are suggested to be isomerases Back     alignment and domain information
>PRK08674 bifunctional phosphoglucose/phosphomannose isomerase; Validated Back     alignment and domain information
>cd00714 GFAT Glutamine amidotransferases class-II (Gn-AT)_GFAT-type Back     alignment and domain information
>cd00715 GPATase_N Glutamine amidotransferases class-II (GN-AT)_GPAT- type Back     alignment and domain information
>PRK08525 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK06781 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07349 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09246 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07631 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK05793 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK06388 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07272 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09123 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08341 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>cd01907 GlxB Glutamine amidotransferases class-II (Gn-AT)_GlxB-type Back     alignment and domain information
>PRK07847 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR01134 purF amidophosphoribosyltransferase; InterPro: IPR005854 Purine nucleotides are synthesised both via the de novo pathway and via the salvage pathway and are vital for cell functions and cell proliferation through DNA and RNA syntheses and ATP energy supply Back     alignment and domain information
>COG0034 PurF Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>pfam00310 GATase_2 Glutamine amidotransferases class-II Back     alignment and domain information
>KOG0572 consensus Back     alignment and domain information
>cd00352 Gn_AT_II Glutamine amidotransferases class-II (GATase) Back     alignment and domain information
>TIGR01536 asn_synth_AEB asparagine synthase (glutamine-hydrolyzing); InterPro: IPR006426 These sequences represent glutamine-hydrolysing asparagine synthase Back     alignment and domain information
>PRK09431 asnB asparagine synthetase B; Provisional Back     alignment and domain information
>TIGR03108 eps_aminotran_1 exosortase 1 system-associated amidotransferase 1 Back     alignment and domain information
>PTZ00077 asparagine synthetase; Provisional Back     alignment and domain information
>TIGR03104 trio_amidotrans asparagine synthase family amidotransferase Back     alignment and domain information
>cd00712 AsnB Glutamine amidotransferases class-II (GATase) asparagine synthase_B type Back     alignment and domain information
>COG0367 AsnB Asparagine synthase (glutamine-hydrolyzing) [Amino acid transport and metabolism] Back     alignment and domain information
>cd03766 Gn_AT_II_novel Gn_AT_II_novel Back     alignment and domain information
>cd01908 YafJ Glutamine amidotransferases class-II (Gn-AT)_YafJ-type Back     alignment and domain information
>TIGR03442 conserved hypothetical protein TIGR03442 Back     alignment and domain information
>KOG0571 consensus Back     alignment and domain information
>COG0121 Predicted glutamine amidotransferase [General function prediction only] Back     alignment and domain information
>cd00713 GltS Glutamine amidotransferases class-II (Gn-AT), glutamate synthase (GltS)-type Back     alignment and domain information
>cd05009 SIS_GlmS_GlmD_2 SIS (Sugar ISomerase) domain repeat 2 found in Glucosamine 6-phosphate synthase (GlmS) and Glucosamine-6-phosphate deaminase (GlmD) Back     alignment and domain information
>cd05010 SIS_AgaS_like AgaS-like protein Back     alignment and domain information
>pfam01380 SIS SIS domain Back     alignment and domain information
>PRK00331 glucosamine--fructose-6-phosphate aminotransferase; Reviewed Back     alignment and domain information
>cd05710 SIS_1 A subgroup of the SIS domain Back     alignment and domain information
>PTZ00295 glucosamine-fructose-6-phosphate aminotransferase; Provisional Back     alignment and domain information
>COG1737 RpiR Transcriptional regulators [Transcription] Back     alignment and domain information
>cd05005 SIS_PHI Hexulose-6-phosphate isomerase (PHI) Back     alignment and domain information
>cd05013 SIS_RpiR RpiR-like protein Back     alignment and domain information
>TIGR03127 RuMP_HxlB 6-phospho 3-hexuloisomerase Back     alignment and domain information
>cd05008 SIS_GlmS_GlmD_1 SIS (Sugar ISomerase) domain repeat 1 found in Glucosamine 6-phosphate synthase (GlmS) and Glucosamine-6-phosphate deaminase (GlmD) Back     alignment and domain information
>COG0449 GlmS Glucosamine 6-phosphate synthetase, contains amidotransferase and phosphosugar isomerase domains [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>PRK13937 phosphoheptose isomerase; Provisional Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>PRK02947 hypothetical protein; Provisional Back     alignment and domain information
>pfam10432 bact-PGI_C Bacterial phospho-glucose isomerase C-terminal region Back     alignment and domain information
>KOG1268 consensus Back     alignment and domain information
>PRK05441 murQ N-acetylmuramic acid-6-phosphate etherase; Reviewed Back     alignment and domain information
>cd05637 SIS_PGI_PMI_2 The members of this protein family contain the SIS (Sugar ISomerase) domain and have both the phosphoglucose isomerase (PGI) and the phosphomannose isomerase (PMI) functions Back     alignment and domain information
>cd05008 SIS_GlmS_GlmD_1 SIS (Sugar ISomerase) domain repeat 1 found in Glucosamine 6-phosphate synthase (GlmS) and Glucosamine-6-phosphate deaminase (GlmD) Back     alignment and domain information
>cd05710 SIS_1 A subgroup of the SIS domain Back     alignment and domain information
>pfam01380 SIS SIS domain Back     alignment and domain information
>cd05014 SIS_Kpsf KpsF-like protein Back     alignment and domain information
>PRK11302 DNA-binding transcriptional regulator HexR; Provisional Back     alignment and domain information
>cd05005 SIS_PHI Hexulose-6-phosphate isomerase (PHI) Back     alignment and domain information
>TIGR03127 RuMP_HxlB 6-phospho 3-hexuloisomerase Back     alignment and domain information
>COG0794 GutQ Predicted sugar phosphate isomerase involved in capsule formation [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11337 DNA-binding transcriptional repressor RpiR; Provisional Back     alignment and domain information
>cd05013 SIS_RpiR RpiR-like protein Back     alignment and domain information
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>PRK05441 murQ N-acetylmuramic acid-6-phosphate etherase; Reviewed Back     alignment and domain information
>cd05007 SIS_Etherase N-acetylmuramic acid 6-phosphate etherase Back     alignment and domain information
>PRK12570 N-acetylmuramic acid-6-phosphate etherase; Reviewed Back     alignment and domain information
>TIGR00393 kpsF sugar isomerase, KpsF/GutQ family; InterPro: IPR004800 This is a family of closely related proteins with the phosphosugar-binding domain SIS (Sugar ISomerase) followed by two copies of the CBS (named after Cystathionine Beta Synthase) domain Back     alignment and domain information
>COG0279 GmhA Phosphoheptose isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2222 AgaS Predicted phosphosugar isomerases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK02947 hypothetical protein; Provisional Back     alignment and domain information
>cd05009 SIS_GlmS_GlmD_2 SIS (Sugar ISomerase) domain repeat 2 found in Glucosamine 6-phosphate synthase (GlmS) and Glucosamine-6-phosphate deaminase (GlmD) Back     alignment and domain information
>COG0166 Pgi Glucose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4821 Uncharacterized protein containing SIS (Sugar ISomerase) phosphosugar binding domain [General function prediction only] Back     alignment and domain information
>cd05010 SIS_AgaS_like AgaS-like protein Back     alignment and domain information
>pfam00342 PGI Phosphoglucose isomerase Back     alignment and domain information
>PRK00179 pgi glucose-6-phosphate isomerase; Reviewed Back     alignment and domain information
>PRK09533 bifunctional transaldolase/phosoglucose isomerase; Validated Back     alignment and domain information
>PRK04020 rps2P 30S ribosomal protein S2; Provisional Back     alignment and domain information
>PTZ00254 40S ribosomal protein SA; Provisional Back     alignment and domain information
>TIGR01012 Sa_S2_E_A ribosomal protein S2; InterPro: IPR005707 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG0067 GltB Glutamate synthase domain 1 [Amino acid transport and metabolism] Back     alignment and domain information
>cd01909 betaLS_CarA_N Glutamine amidotransferases class-II (GATase) asparagine synthase_betaLS-type Back     alignment and domain information
>PRK11557 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>COG1737 RpiR Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>COG2103 Predicted sugar phosphate isomerase [General function prediction only] Back     alignment and domain information
>TIGR00274 TIGR00274 glucokinase regulator homolog; InterPro: IPR005488 The glucokinase regulatory protein (GCKR) is a vertebrate protein that inhibits glucokinase by forming an inactive complex with the enzyme Back     alignment and domain information
>PRK11382 frlB fructoselysine-6-P-deglycase; Provisional Back     alignment and domain information
>TIGR00441 gmhA phosphoheptose isomerase; InterPro: IPR004515 Phosphoheptose isomerase is involved in lipopolysaccharide biosynthesis, and more specifically in the synthesis of glyceromannoheptose 7-phosphate Back     alignment and domain information
>LOAD_sis consensus Back     alignment and domain information
>cd04795 SIS SIS domain Back     alignment and domain information
>cd05017 SIS_PGI_PMI_1 The members of this protein family contain the SIS (Sugar ISomerase) domain and have both the phosphoglucose isomerase (PGI) and the phosphomannose isomerase (PMI) functions Back     alignment and domain information
>PRK13938 phosphoheptose isomerase; Provisional Back     alignment and domain information
>cd05006 SIS_GmhA Phosphoheptose isomerase is a member of the SIS (Sugar ISomerase) superfamily Back     alignment and domain information
>PRK00414 gmhA phosphoheptose isomerase; Reviewed Back     alignment and domain information
>PRK13937 phosphoheptose isomerase; Provisional Back     alignment and domain information
>PRK13936 phosphoheptose isomerase; Provisional Back     alignment and domain information
>PRK10886 DnaA initiator-associating protein DiaA; Provisional Back     alignment and domain information
>PRK03868 glucose-6-phosphate isomerase; Provisional Back     alignment and domain information
>PRK08674 bifunctional phosphoglucose/phosphomannose isomerase; Validated Back     alignment and domain information
>cd05015 SIS_PGI_1 Phosphoglucose isomerase (PGI) contains two SIS (Sugar ISomerase) domains Back     alignment and domain information
>PRK00973 glucose-6-phosphate isomerase; Provisional Back     alignment and domain information
>KOG2446 consensus Back     alignment and domain information
>PRK11750 gltB glutamate synthase subunit alpha; Provisional Back     alignment and domain information
>KOG0399 consensus Back     alignment and domain information
>TIGR02128 G6PI_arch bifunctional phosphoglucose/phosphomannose isomerase; InterPro: IPR011857 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 Back     alignment and domain information
>TIGR01135 glmS glucosamine--fructose-6-phosphate aminotransferase, isomerizing; InterPro: IPR005855 Glucosamine:fructose-6-phosphate aminotransferase (2 Back     alignment and domain information
>PRK11302 DNA-binding transcriptional regulator HexR; Provisional Back     alignment and domain information
>PRK11337 DNA-binding transcriptional repressor RpiR; Provisional Back     alignment and domain information
>PRK11557 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>cd04795 SIS SIS domain Back     alignment and domain information
>cd05014 SIS_Kpsf KpsF-like protein Back     alignment and domain information
>COG0794 GutQ Predicted sugar phosphate isomerase involved in capsule formation [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd05006 SIS_GmhA Phosphoheptose isomerase is a member of the SIS (Sugar ISomerase) superfamily Back     alignment and domain information
>PRK10886 DnaA initiator-associating protein DiaA; Provisional Back     alignment and domain information
>PRK13936 phosphoheptose isomerase; Provisional Back     alignment and domain information
>PRK00414 gmhA phosphoheptose isomerase; Reviewed Back     alignment and domain information
>PRK13938 phosphoheptose isomerase; Provisional Back     alignment and domain information
>TIGR00274 TIGR00274 glucokinase regulator homolog; InterPro: IPR005488 The glucokinase regulatory protein (GCKR) is a vertebrate protein that inhibits glucokinase by forming an inactive complex with the enzyme Back     alignment and domain information
>LOAD_sis consensus Back     alignment and domain information
>COG0279 GmhA Phosphoheptose isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01910 Wali7 This domain is present in Wali7, a protein of unknown function, expressed in wheat and induced by aluminum Back     alignment and domain information
>KOG0573 consensus Back     alignment and domain information
>TIGR02128 G6PI_arch bifunctional phosphoglucose/phosphomannose isomerase; InterPro: IPR011857 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 Back     alignment and domain information
>cd05017 SIS_PGI_PMI_1 The members of this protein family contain the SIS (Sugar ISomerase) domain and have both the phosphoglucose isomerase (PGI) and the phosphomannose isomerase (PMI) functions Back     alignment and domain information
>cd02751 MopB_DMSOR-like The MopB_DMSOR-like CD contains dimethylsulfoxide reductase (DMSOR), biotin sulfoxide reductase (BSOR), trimethylamine N-oxide reductase (TMAOR) and other related proteins Back     alignment and domain information
>cd02766 MopB_3 The MopB_3 CD includes a group of related uncharacterized bacterial and archaeal molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site Back     alignment and domain information
>cd02759 MopB_Acetylene-hydratase The MopB_Acetylene-hydratase CD contains acetylene hydratase (Ahy) and other related proteins Back     alignment and domain information
>cd02769 MopB_DMSOR-BSOR-TMAOR The MopB_DMSOR-BSOR-TMAOR CD contains dimethylsulfoxide reductase (DMSOR), biotin sulfoxide reductase (BSOR), trimethylamine N-oxide reductase (TMAOR) and other related proteins Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target608 glucosamine--fructose-6-phosphate aminotransferase [Can
1jxa_A608 Glucosamine 6-Phosphate Synthase With Glucose 6-Pho 1e-160
2j6h_A608 E. Coli Glucosamine-6-P Synthase In Complex With Gl 1e-159
1mos_A368 Isomerase Domain Of Glucosamine 6-Phosphate Synthas 6e-88
2v4m_A376 The Isomerase Domain Of Human Glutamine-Fructose-6- 2e-81
2zj3_A375 Isomerase Domain Of Human Glucose:fructose-6-Phosph 2e-81
2poc_A367 The Crystal Structure Of Isomerase Domain Of Glucos 2e-79
3fj1_A344 Crystal Structure Of Putative Phosphosugar Isomeras 9e-31
2aml_A373 Crystal Structure Of Lmo0035 Protein (46906266) Fro 3e-23
3c3j_A384 Crystal Structure Of Tagatose-6-Phosphate KetoseALD 2e-08
3i0z_A389 Crystal Structure Of Putative Putative Tagatose-6-P 2e-07
3odp_A393 Crystal Structure Of A Putative Tagatose-6-Phosphat 2e-07
cbx90232.1_s300 o gi|220702255|pdb|2ZJ3|A Chain A [Leptosphaeria ma 3e-67
2cb0_A333 Crystal Structure Of Glucosamine 6-Phosphate Deamin 4e-33
2dec_A325 Crystal Structure Of The Ph0510 Protein From Pyroco 2e-32
3hba_A334 Crystal Structure Of A Putative Phosphosugar Isomer 6e-32
1j5x_A342 Crystal Structure Of Glucosamine-6-Phosphate Deamin 3e-28
3g68_A352 Crystal Structure Of A Putative Phosphosugar Isomer 3e-19
3eua_A329 Crystal Structure Of A Putative Phosphosugar Isomer 2e-16
3fkj_A347 Crystal Structure Of A Putative Phosphosugar Isomer 1e-14
3knz_A366 Crystal Structure Of Putative Sugar Binding Protein 1e-13
1xff_A240 Glutaminase Domain Of Glucosamine 6-Phosphate Synth 5e-62
1gph_1465 Structure Of The Allosteric Regulatory Enzyme Of Pu 2e-41
1ao0_A459 Glutamine Phosphoribosylpyrophosphate (Prpp) Amidot 3e-41
1ecf_A504 Escherichia Coli Glutamine Phosphoribosylpyrophosph 4e-40
1ct9_A553 Crystal Structure Of Asparagine Synthetase B From E 7e-08
2a3n_A355 Crystal Structure Of A Putative Glucosamine-Fructos 2e-06
1te5_A257 The 2.0 Angstrom Crystal Structure Of Predicted Glu 6e-04
>gi|17942686|pdb|1JXA|A Chain A, Glucosamine 6-Phosphate Synthase With Glucose 6-Phosphate Length = 608 Back     alignment and structure
 Score =  568 bits (1464), Expect = e-160,   Method: Composition-based stats.
 Identities = 255/611 (41%), Positives = 374/611 (61%), Gaps = 7/611 (1%)

Query: 2   CGIVGIVGRESVGERLFKALKRLEYRGYDSSGMATIC-DGKIQCVRAQGKLSELEKELNK 60
           CGIVG + +  V E L + L+RLEYRGYDS+G+A +  +G +  +R  GK+  L +   +
Sbjct: 1   CGIVGAIAQRDVAEILLEGLRRLEYRGYDSAGLAVVDAEGHMTRLRRLGKVQMLAQAAEE 60

Query: 61  KPLKGNIGIAHTRWATHGLPNKENSHPHCIEGIAVTHNGIIENFSRLKKEHFSSQQVFLT 120
            PL G  GIAHTRWATHG P++ N+HPH  E I V HNGIIEN   L++E  +    F++
Sbjct: 61  HPLHGGTGIAHTRWATHGEPSEVNAHPHVSEHIVVVHNGIIENHEPLREELKARGYTFVS 120

Query: 121 ETDTEVIACLLEKFIKNGSSKKETMQKLMQCLTGSYSIAVIFEDDPHSIIVARKGPPLII 180
           ETDTEVIA L+   +K G + +E + + +  L G+Y   ++    P +++ AR G PL+I
Sbjct: 121 ETDTEVIAHLVNWELKQGGTLREAVLRAIPQLRGAYGTVIMDSRHPDTLLAARSGSPLVI 180

Query: 181 GHGEGEMFVGSDVTALTLLTDKVTYMEDGDWAIIRNSGLTIYDSQGYEIERPIQIVQIAP 240
           G G GE F+ SD  AL  +T +  ++E+GD A I    + I+D  G E++R      +  
Sbjct: 181 GLGMGENFIASDQLALLPVTRRFIFLEEGDIAEITRRSVNIFDKTGAEVKRQDIESNLQY 240

Query: 241 FLIGKGNYRHFMEKEIYEQPEAISRVLSHYINLSDHT--IIPNIFNYDFANISGLLVSSC 298
               KG YRH+M+KEIYEQP AI   L+  I+        +    +   + +  + + +C
Sbjct: 241 DAGDKGIYRHYMQKEIYEQPNAIKNTLTGRISHGQVDLSELGPNADELLSKVEHIQILAC 300

Query: 299 GTSYLAGLVGKFWFERLARLKVEIDVSSEFRYRDFVYSSKWASLFISQSGETADTLASLR 358
           GTSY +G+V ++WFE LA +  +++++SEFRYR          + +SQSGETADTLA LR
Sbjct: 301 GTSYNSGMVSRYWFESLAGIPCDVEIASEFRYRKSAVRRNSLMITLSQSGETADTLAGLR 360

Query: 359 YMRT-QGLTIGSLVNVLESTIARESDFIFPIKAGPEIGVASTKAFTCQLLVLVIMAIYAG 417
             +    L   ++ NV  S++ RESD      AG EIGVASTKAFT QL VL+++     
Sbjct: 361 LSKELGYLGSLAICNVPGSSLVRESDLALMTNAGTEIGVASTKAFTTQLTVLLMLVAKLS 420

Query: 418 KVRGYINEEQERELIRSLVEIPRKMFDVLQNIYSQIEKLCCGLAKCQTLLYVGRGSSYPL 477
           K++G ++   E +++  L  +P ++  +L     +IE L    +     L++GRG  YP+
Sbjct: 421 KLKG-LDASIEHDIVHGLQALPSRIEQMLSQ-DKRIEALAEDFSDKHHALFLGRGDQYPI 478

Query: 478 ALEGALKIKEISYLHAEGYAAGELKHGPIALITEGTFVIAIAPYDRFFQKTLSNIQEIVT 537
           ALEGALK+KEISY+HAE YAAGELKHGP+ALI     VI +AP +   +K  SNI+E+  
Sbjct: 479 ALEGALKLKEISYIHAEAYAAGELKHGPLALIDADMPVIVVAPNNELLEKLKSNIEEVRA 538

Query: 538 RGGRVIFITDEEGLKRQDFPSIETIVLPSMGEIVSPIVFSLPIQMIAYCTAVLIGTDVDQ 597
           RGG++    D+         ++  I +P + E+++PI +++P+Q++AY  A++ GTDVDQ
Sbjct: 539 RGGQLYVFADQ-DAGFVSSDNMHIIEMPHVEEVIAPIFYTVPLQLLAYHVALIKGTDVDQ 597

Query: 598 PRNLAKSVTVE 608
           PRNLAKSVTVE
Sbjct: 598 PRNLAKSVTVE 608


>gi|118138642|pdb|2J6H|A Chain A, E. Coli Glucosamine-6-P Synthase In Complex With Glucose-6p And 5-Oxo-L-Norleucine Length = 608 Back     alignment and structure