254780944

254780944

hypothetical protein CLIBASIA_04215

GeneID in NCBI database:8209966Locus tag:CLIBASIA_04215
Protein GI in NCBI database:254780944Protein Accession:YP_003065357.1
Gene range:+(934926, 935612)Protein Length:228aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized conserved protein
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED4 TM-Helix
HMMTOP4 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM2 TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MKKKSFHTSISAKVRNNFFAGFIICAPIAITIWLSLSLIHWFDGFIVPYIPMQYNPEYYCDFSIPGFGLLVVIVGINIVGFFGRNLLGRFVFFLSESILNNTPIVRHLYKSTKQIIRTLLKEDSTSFKNACLVEYPSAGFWSLCFLTTEVKGEIKEKFSNIGCEDMVTVFIPPTPLPTAGMLVFVPRNKVIMLKMSAEDSAKMLISGGLLIPDNISYDAQPESNSVKK
ccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccEEEEEEEEccccEEEEEEEEcccccHHHHHHcccccccEEEEEccccccccccEEEEEEHHHEEEccccHHHHHHHHHccccccccccccccccccccccc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHcccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccccEEEEEEEEcccccHHHHHccccccccEEEEEEcccccccccEEEEEcHHHcEcccccHHHHHHHHHHcccEccccccccccccHHHHcc
MKKKSFHTSISAKVRNNFFAGFIICAPIAITIWLSLSLIHwfdgfivpyipmqynpeyycdfsipgFGLLVVIVGINIVGFFGRNLLGRFVFFLSESILNNTPIVRHLYKSTKQIIRTLLKEDSTSFKNAClveypsagfwsLCFLTTEVKGEIKEKfsnigcedmvtvfipptplptagmlvfvpRNKVIMLKMSAEDSAKMLISggllipdnisydaqpesnsvkk
MKKKSFHTSISAKVRNNFFAGFIICAPIAITIWLSLSLIHWFDGFIVPYIPMQYNPEYYCDFSIPGFGLLVVIVGINIVGFFGRNLLGRFVFFLSESILNNTPIVRHLYKSTKQIIRTLLKEDSTSFKNACLVEYPSAGFWSLCFLTTEVKGEIKEKFSNIGCEDMVTVFIPPTPLPTAGMLVFVPRNKVIMLKMSAEDSAKMLISGGLLipdnisydaqpesnsvkk
MKKKSFHTSISAKVRNNFFAGFIICAPIAITIWLSLSLIHWFDGFIVPYIPMQYNPEYYCDFSIPgfgllvvivginivgffgRNLLGRFVFFLSESILNNTPIVRHLYKSTKQIIRTLLKEDSTSFKNACLVEYPSAGFWSLCFLTTEVKGEIKEKFSNIGCEDMVTVFIPPTPLPTAGMLVFVPRNKVIMLKMSAEDSAKMLISGGLLIPDNISYDAQPESNSVKK
************KVRNNFFAGFIICAPIAITIWLSLSLIHWFDGFIVPYIPMQYNPEYYCDFSIPGFGLLVVIVGINIVGFFGRNLLGRFVFFLSESILNNTPIVRHLYKSTKQII*************ACLVEYPSAGFWSLCFLTTEVKGEIKEKFSNIGCEDMVTVFIPPTPLPTAGMLVFVPRNKVIMLKMSAEDSAKMLISGGL*******************
*********ISAKVRNNFFAGFIICAPIAITIWLSLSLIHWFDGFIVPYIPMQYNPEYYCDFSIPGFGLLVVIVGINIVGFFGRNLLGRFVFFLSESILNNTPIVRHLYKSTKQIIRTLLKEDSTSFKNACLVEYPSAGFWSLCFLTTEVKGEIKEKFSNIGCEDMVTVFIPPTPLPTAGMLVFVPRNKVIMLKMSAEDSAKMLISGGLLIPDNISYD**********
*KKKSFHTSISAKVRNNFFAGFIICAPIAITIWLSLSLIHWFDGFIVPYIPMQYNPEYYCDFSIPGFGLLVVIVGINIVGFFGRNLLGRFVFFLSESILNNTPIVRHLYKSTKQIIRTLLKEDSTSFKNACLVEYPSAGFWSLCFLTTEVKGEIKEKFSNIGCEDMVTVFIPPTPLPTAGMLVFVPRNKVIMLKMSAEDSAKMLISGGLLIPDN**************
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKKSFHTSISAKVRNNFFAGFIICAPIAITIWLSLSLIHWFDGFIVPYIPMQYNPEYYCDFSIPGFGLLVVIVGINIVGFFGRNLLGRFVFFLSESILNNTPIVRHLYKSTKQIIRTLLKEDSTSFKNACLVEYPSAGFWSLCFLTTEVKGEIKEKFSNIGCEDMVTVFIPPTPLPTAGMLVFVPRNKVIMLKMSAEDSAKMLISGGLLIPDNISYDAQPESNSVKK
MKKKSFHTSISAKVRNNFFAGFIICAPIAITIWLSLSLIHWFDGFIVPYIPMQYNPEYYCDFSIPGFGLLVVIVGINIVGFFGRNLLGRFVFFLSESILNNTPIVRHLYKSTKQIIRTLLKEDSTSFKNACLVEYPSAGFWSLCFLTTEVKGEIKEKFSNIGCEDMVTVFIPPTPLPTAGMLVFVPRNKVIMLKMSAEDSAKMLISGGLLIPDNISYDAQPESNSVKK
MKKKSFHTSISAKVRNNFFAGFIICAPIAITIWLSLSLIHWFDGFIVPYIPMQYNPEYYCDFSIPGFGLLVVIVGINIVGFFGRNLLGRFVFFLSESILNNTPIVRHLYKSTKQIIRTLLKEDSTSFKNACLVEYPSAGFWSLCFLTTEVKGEIKEKFSNIGCEDMVTVFIPPTPLPTAGMLVFVPRNKVIMLKMSAEDSAKMLISGGLLIPDNISYDAQPESNSVKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target228 hypothetical protein CLIBASIA_04215 [Candidatus Liberib
315122357239 hypothetical protein CKC_03045 [Candidatus Liberibacter 1 2e-91
327188305228 hypothetical protein RHECNPAF_920011 [Rhizobium etli CN 1 7e-69
241204636235 hypothetical protein Rleg_1911 [Rhizobium leguminosarum 1 4e-68
190891736235 hypothetical protein RHECIAT_CH0002142 [Rhizobium etli 1 6e-68
116252135235 hypothetical protein RL2383 [Rhizobium leguminosarum bv 1 6e-68
209549323235 hypothetical protein Rleg2_1727 [Rhizobium leguminosaru 1 7e-68
150396616230 hypothetical protein Smed_1402 [Sinorhizobium medicae W 1 1e-67
86357711235 hypothetical protein RHE_CH02092 [Rhizobium etli CFN 42 1 1e-67
15965407230 hypothetical protein SMc00229 [Sinorhizobium meliloti 1 1 2e-67
222085968233 hypothetical protein Arad_2358 [Agrobacterium radiobact 1 4e-67
>gi|315122357|ref|YP_004062846.1| hypothetical protein CKC_03045 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 239 Back     alignment and organism information
 Score =  339 bits (870), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 172/226 (76%), Positives = 198/226 (87%)

Query: 1   MKKKSFHTSISAKVRNNFFAGFIICAPIAITIWLSLSLIHWFDGFIVPYIPMQYNPEYYC 60
           M KKS H+SISAK+RNNFFAG IICAP AITIW +LSLI WFD FIVPYIP +YNP YY 
Sbjct: 1   MYKKSLHSSISAKIRNNFFAGLIICAPAAITIWFTLSLIQWFDSFIVPYIPNRYNPGYYV 60

Query: 61  DFSIPGFGLLVVIVGINIVGFFGRNLLGRFVFFLSESILNNTPIVRHLYKSTKQIIRTLL 120
           DF +PGFGLL+VI+GINIVGF GRNLLGRF FF+ E+IL+NTPIVRHLYK T+QIIRT+L
Sbjct: 61  DFPVPGFGLLIVIIGINIVGFLGRNLLGRFFFFMGEAILSNTPIVRHLYKGTQQIIRTIL 120

Query: 121 KEDSTSFKNACLVEYPSAGFWSLCFLTTEVKGEIKEKFSNIGCEDMVTVFIPPTPLPTAG 180
           K++S SFK+ACLVEYPS+GFWSLCFLTT+VKGE++EKF + G  DMVTVFIPPTPLPTAG
Sbjct: 121 KKNSNSFKHACLVEYPSSGFWSLCFLTTDVKGELQEKFLDRGNPDMVTVFIPPTPLPTAG 180

Query: 181 MLVFVPRNKVIMLKMSAEDSAKMLISGGLLIPDNISYDAQPESNSV 226
           MLVFVPR KVIML M+AEDSAKMLISGGLLIP+N+    + +S+S 
Sbjct: 181 MLVFVPREKVIMLDMTAEDSAKMLISGGLLIPENVKCRKEYKSDSA 226


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|327188305|gb|EGE55524.1| hypothetical protein RHECNPAF_920011 [Rhizobium etli CNPAF512] Length = 228 Back     alignment and organism information
>gi|241204636|ref|YP_002975732.1| hypothetical protein Rleg_1911 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 235 Back     alignment and organism information
>gi|190891736|ref|YP_001978278.1| hypothetical protein RHECIAT_CH0002142 [Rhizobium etli CIAT 652] Length = 235 Back     alignment and organism information
>gi|116252135|ref|YP_767973.1| hypothetical protein RL2383 [Rhizobium leguminosarum bv. viciae 3841] Length = 235 Back     alignment and organism information
>gi|209549323|ref|YP_002281240.1| hypothetical protein Rleg2_1727 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 235 Back     alignment and organism information
>gi|150396616|ref|YP_001327083.1| hypothetical protein Smed_1402 [Sinorhizobium medicae WSM419] Length = 230 Back     alignment and organism information
>gi|86357711|ref|YP_469603.1| hypothetical protein RHE_CH02092 [Rhizobium etli CFN 42] Length = 235 Back     alignment and organism information
>gi|15965407|ref|NP_385760.1| hypothetical protein SMc00229 [Sinorhizobium meliloti 1021] Length = 230 Back     alignment and organism information
>gi|222085968|ref|YP_002544500.1| hypothetical protein Arad_2358 [Agrobacterium radiobacter K84] Length = 233 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target228 hypothetical protein CLIBASIA_04215 [Candidatus Liberib
pfam04367108 pfam04367, DUF502, Protein of unknown function (DUF502) 2e-28
COG2928222 COG2928, COG2928, Uncharacterized conserved protein [Fu 3e-53
>gnl|CDD|146814 pfam04367, DUF502, Protein of unknown function (DUF502) Back     alignment and domain information
>gnl|CDD|32752 COG2928, COG2928, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 228 hypothetical protein CLIBASIA_04215 [Candidatus Liberib
COG2928222 Uncharacterized conserved protein [Function unknown] 100.0
pfam04367108 DUF502 Protein of unknown function (DUF502). Predicted 100.0
PRK10573397 type IV pilin biogenesis protein; Provisional 91.68
>COG2928 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>pfam04367 DUF502 Protein of unknown function (DUF502) Back     alignment and domain information
>PRK10573 type IV pilin biogenesis protein; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00