254780945

254780945

ATP-dependent DNA helicase RecG

GeneID in NCBI database:8209967Locus tag:CLIBASIA_04220
Protein GI in NCBI database:254780945Protein Accession:YP_003065358.1
Gene range:-(935628, 937730)Protein Length:700aa
Gene description:ATP-dependent DNA helicase RecG
COG prediction:[L] [K] RecG-like helicase
KEGG prediction:ATP-dependent DNA helicase RecG; K03655 ATP-dependent DNA helicase RecG [EC:3.6.1.-]
SEED prediction:ATP-dependent DNA helicase RecG (EC 3.6.1.-)
Pathway involved in KEGG:Homologous recombination [PATH:las03440]
Subsystem involved in SEED:DNA-replication;
Transcription factors bacterial
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700
MRPSFLNPLFAPLSTFRGVGKKYSLFLSKIINCGNANETRFIDLLFYHPSSFIDRHYRPKISEISEERIVTITGYISQHSSFQLQKRRPYKILLNDGTGEITLLFFYRKTEMLKNVFFEGRKITVTGKIKKLKNRIIMVHPHYIFHNSQDVNFPLIEAVYSLPTGLSVDLFKKIIVEALSRLPVLPEWIEKDLLQKKSFPSIAEAFNIIHNPRKAKDFEWTSPARERLAYDELLAGQIALLLMRKQFKKEIGIPINVEGKIAQKILRNIPFSPTKSQESAIKDILQDMSQKNRMLRILQGDVGSGKTLVALIAMAAAVEAGGQAVIMAPIGILAQQHYEFIKKYTQNTQIIVEIITGNMPQAHRRKALERIAHGQAHIIIGTHALFQDSIQYYKLILVIVDEQHRFGVQQRLKLTQKATAPHVLLMTATPIPRTLVLTSLGDIDISKITEKPAGRKPIKTVIIPINRIDEVIERLKVVLSEGKKAYWICPQIEEKKESNFRSVVERFNSLHEHFTSSIAIIHGRMSDIDKESVMDSFKNGTCKLLIATTVIEVGIDVVDASIIIIENAEHFGLAQLHQLRGRVGRGEEISSCILLYHPPLSKNSYTRLSVLKNTEDGFLIAEEDLKQRKEGEILGIKQSGMPKFLIAQPELHDSLLEIARKDAKHILTQDPDLTSVRGQSIRILLYLYQYNEAFQFIRAG
ccccHHHHHcccHHHcccccHHHHHHHHHHccccccccccHHHHHHHccccEEcccccccHHHcccccEEEEEEEEEEEcccccccccEEEEEEEEcccEEEEEEEEccHHHHHHHcccccEEEEEEEEEccccEEEEEccEEEEccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHcccccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHccccccEEEEcHHHHHHHHHcccccEEEEcccHHcccHHHHHHHHccccccEEEEcccccHHHHHHHHHcccccHHHHHHccccccEEEEEEccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHccccEEEEEcHHHHHccccccccEEEEccccccHHHHHHHHHHHcccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccHHHHHHcHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
cccHHcccccccccccccccHHHHHHHHHHHHccccccccHHHHHHccccccHHccccccHHHcccccEEEEEEEEEEcccccccccEEEEEEEEccccEEEEEEEcccHHHHHHHcccccEEEEEEEEccccccEEEEccccEEccccccccccccccEEccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHcccccHHHHHHHHccccccccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccHHHHcccccccHHHHHHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHccEEEEEcHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHccccccEEcccccccccEEEEEEcHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHccccEEEEEEEEEEEEccccccEEEEEccHHHHHHHHHHHHcccccccccccEEEEEEcccccHHHHHHHHHHHcccccEEEEHHHcccccccccccccccccccEEEEcHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcHHHHHHHHccc
mrpsflnplfaplstfrgvgkKYSLFLSKIIncgnanetRFIDLLfyhpssfidrhyrpkiseisEERIVTITGYISQhssfqlqkrrpykillndgtgEITLLFFYRKTEMLKNVFFEGRKITVTGKIKKLKNRiimvhphyifhnsqdvnfpLIEAVyslptglsVDLFKKIIVEALsrlpvlpewiekdllqkksfpsIAEAFNIihnprkakdfewtspareRLAYDELLAGQIALLLMRKQFKkeigipinvEGKIAQKIlrnipfsptksqESAIKDILQDMSQKNRMLRILQGDVGSGKTLVALIAMAAAVEAGGQAVIMAPIGILAQQHYEFIKKYTQNTQIIVEIITGNMPQAHRRKALERIAHGQAHIIIGTHALFQDSIQYYKLILVIVDEQHRFGVQQRLKLtqkataphvllmtatpiprtlvltslgdidiskitekpagrkpiktviipinRIDEVIERLKVVLSEgkkaywicpqieekkesNFRSVVERFNSLHEHFTSSIAIIHGrmsdidkesvmdsfkngtCKLLIATTVIEVGIDVVDASIIIIENAEHFGLAQLHQLRgrvgrgeeISSCIllyhpplsknsytRLSVLKNTEDGFLIAEEDLKQRkegeilgikqsgmpkfliaqpELHDSLLEIARKDAKhiltqdpdltsvrgQSIRILLYLYQYNEAFQFIRAG
mrpsflnplfaplstfrgVGKKYSLFLSKIINCGNANETRFIDLLFYHPSSFIDRHYRPKISEISEERIVTITGYISqhssfqlqkrrpyKILLNDGTGEITLLFFYRKTEMLKnvffegrkitvtgkikKLKNRIIMVHPHYIFHNSQDVNFPLIEAVYSLPTGLSVDLFKKIIVEALSRLPVLPEWIEKDLLQKKSFPSIAEAFniihnprkakdfewtsPARERLAYDELLAGQIALLLMRKQFKKEIGIPINVEGKIAQKILRnipfsptksqESAIKDILQDMSQKNRMLRILQGDVGSGKTLVALIAMAAAVEAGGQAVIMAPIGILAQQHYEFIKKYTQNTQIIVEIITGNMPQAHRRKALERIAHGQAHIIIGTHALFQDSIQYYKLILVIVDEQHRFGVQQRLKLTQKATAPHVLLMTATPIPRTLVLTSLGDIdiskitekpagrkpiktviipinrideVIERLKVVLSegkkaywicpqieekkesNFRSVVERFNSLHEHFTSSIAIIHGRMSDIDKESVMDSFKNGTCKLLIATTVIEVGIDVVDASIIIIENAEHFGLAQLHQLRGRVGRGEEISSCILlyhpplsknsYTRLSVLKNTEDGFLIAEEDLKQRKEGEILGIKQSGMPKFLIAQPELHDSLLEIARKDAKHiltqdpdltsvrgQSIRILLYLYQYNEAFQFIRAG
MRPSFLNPLFAPLSTFRGVGKKYSLFLSKIINCGNANETRFIDLLFYHPSSFIDRHYRPKISEISEERIVTITGYISQHSSFQLQKRRPYKILLNDGTGEITLLFFYRKTEMLKNVFFEGRKITVTGKIKKLKNRIIMVHPHYIFHNSQDVNFPLIEAVYSLPTGLSVDLFKKIIVEALSRLPVLPEWIEKDLLQKKSFPSIAEAFNIIHNPRKAKDFEWTSPARERLAYDELLAGQIALLLMRKQFKKEIGIPINVEGKIAQKILRNIPFSPTKSQESAIKDILQDMSQKNRMLRILQGDVGSGKTlvaliamaaaveaggqaviMAPIGILAQQHYEFIKKYTQNTQIIVEIITGNMPQAHRRKALERIAHGQAHIIIGTHALFQDSIQYYKLILVIVDEQHRFGVQQRLKLTQKATAPHVLLMTATPIPRTLVLTSLGDIDISKITEKPAGRKPIKTVIIPINRIDEVIERLKVVLSEGKKAYWICPQIEEKKESNFRSVVERFNSLHEHFTSSIAIIHGRMSDIDKESVMDSFKNGTCKLLIATTVIEVGIDVVDASIIIIENAEHFGLAQLHQLRGRVGRGEEISSCILLYHPPLSKNSYTRLSVLKNTEDGFLIAEEDLKQRKEGEILGIKQSGMPKFLIAQPELHDSLLEIARKDAKHILTQDPDLTSVRGQSIRILLYLYQYNEAFQFIRAG
*RPSFLNPLFAPLSTFRGVGKKYSLFLSKIINCGNANETRFIDLLFYHPSSFIDRHYRPKISEISEERIVTITGYI***************ILLNDGTGEITLLFFYRKTEMLKNVFFEGRKITVTGKIKKLKNRIIMVHPHYIFHNSQDVNFPLIEAVYSLPTGLSVDLFKKIIVEALSRLPVLPEWIEKDLLQKKSFPSIAEAFNIIHNPRKAKDFEWTSPARERLAYDELLAGQIALL******************KIAQKILRNIPFSPTKSQESAIKDILQDMSQKNRMLRILQGDVGSGKTLVALIAMAAAVEAGGQAVIMAPIGILAQQHYEFIKKYTQNTQIIVEIITGNMP******ALERIAHGQAHIIIGTHALFQDSIQYYKLILVIVDEQHRFGVQQRLKLTQKATAPHVLLMTATPIPRTLVLTSLGDIDISKITEKPAGRKPIKTVIIPINRIDEVIERLKVVLSEGKKAYWICPQIEEKKESNFRSVVERFNSLHEHFTSSIAIIHGRMSDIDKESVMDSFKNGTCKLLIATTVIEVGIDVVDASIIIIENAEHFGLAQLHQLRGRVGRGEEISSCILLYHPPLSKNSYTRLSVLKNTEDGFLIAEEDLKQRKEGEILGIKQSGMPKFLIAQPELHDSLLEIARKDAKHILTQDPDLTSVRGQSIRILLYLYQYNEAFQFIRAG
MRPSFLNPLFAPLSTFRGVGKKYSLFLSKIINCGNANETRFIDLLFYHPSSFIDRHYRPKISEISEERIVTITGYISQHSSFQLQKRRPYKILLNDGTGEITLLFFYRKTEMLKNVFFEGRKITVTGKIKKLKNRIIMVHPHYIFHNSQDVNFPLIEAVYSLPTGLSVDLFKKIIVEALSRLPVLPEWIEKDLLQKKSFPSIAEAFNIIHNPRKAKDFEWTSPARERLAYDELLAGQIALLLMRKQFKKEIGIPINVEGKIAQKILRNIPFSPTKSQESAIKDILQDMSQKNRMLRILQGDVGSGKTLVALIAMAAAVEAGGQAVIMAPIGILAQQHYEFIKKYTQNTQIIVEIITGNMPQAHRRKALERIAHGQAHIIIGTHALFQDSIQYYKLILVIVDEQHRFGVQQRLKLTQKATAPHVLLMTATPIPRTLVLTSLGDIDISKITEKPAGRKPIKTVIIPINRIDEVIERLKVVLSEGKKAYWICPQIEEKKESNFRSVVERFNSLHEHFTSSIAIIHGRMSDIDKESVMDSFKNGTCKLLIATTVIEVGIDVVDASIIIIENAEHFGLAQLHQLRGRVGRGEEISSCILLYHPPLSKNSYTRLSVLKNTEDGFLIAEEDLKQRKEGEILGIKQSGMPKFLIAQPELHDSLLEIARKDAKHILTQDPDLTSVRGQSIRILLYLYQYNEAFQFIRAG
****FLNPLFAPLSTFRGVGKKYSLFLSKIINCGNANETRFIDLLFYHPSSFIDRHYRPKISEISEERIVTITGYISQHSSFQLQKRRPYKILLNDGTGEITLLFFYRKTEMLKNVFFEGRKITVTGKIKKLKNRIIMVHPHYIFHNSQDVNFPLIEAVYSLPTGLSVDLFKKIIVEALSRLPVLPEWIEKDLLQKKSFPSIAEAFNIIHNPRKAKDFEWTSPARERLAYDELLAGQIALLLMRKQFKKEIGIPINVEGKIAQKILRNIPFSPTKSQESAIKDILQDMSQKNRMLRILQGDVGSGKTLVALIAMAAAVEAGGQAVIMAPIGILAQQHYEFIKKYTQNTQIIVEIITGNMPQAHRRKALERIAHGQAHIIIGTHALFQDSIQYYKLILVIVDEQHRFGVQQRLKLTQKATAPHVLLMTATPIPRTLVLTSLGDIDISKITEKPAGRKPIKTVIIPINRIDEVIERLKVVLSEGKKAYWICPQIEEKKESNFRSVVERFNSLHEHFTSSIAIIHGRMSDIDKESVMDSFKNGTCKLLIATTVIEVGIDVVDASIIIIENAEHFGLAQLHQLRGRVGRGEEISSCILLYHPPLSKNSYTRLSVLKNTEDGFLIAEEDLKQRKEGEILGIKQSGMPKFLIAQPELHDSLLEIARKDAKHILTQDPDLTSVRGQSIRILLYLYQYNEAFQFIRAG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRPSFLNPLFAPLSTFRGVGKKYSLFLSKIINCGNANETRFIDLLFYHPSSFIDRHYRPKISEISEERIVTITGYISQHSSFQLQKRRPYKILLNDGTGEITLLFFYRKTEMLKNVFFEGRKITVTGKIKKLKNRIIMVHPHYIFHNSQDVNFPLIEAVYSLPTGLSVDLFKKIIVEALSRLPVLPEWIEKDLLQKKSFPSIAEAFNIIHNPRKAKDFEWTSPARERLAYDELLAGQIALLLMRKQFKKEIGIPINVEGKIAQKILRNIPFSPTKSQESAIKDILQDMSQKNRMLRILQGDVGSGKTLVALIAMAAAVEAGGQAVIMAPIGILAQQHYEFIKKYTQNTQIIVEIITGNMPQAHRRKALERIAHGQAHIIIGTHALFQDSIQYYKLILVIVDEQHRFGVQQRLKLTQKATAPHVLLMTATPIPRTLVLTSLGDIDISKITEKPAGRKPIKTVIIPINRIDEVIERLKVVLSEGKKAYWICPQIEEKKESNFRSVVERFNSLHEHFTSSIAIIHGRMSDIDKESVMDSFKNGTCKLLIATTVIEVGIDVVDASIIIIENAEHFGLAQLHQLRGRVGRGEEISSCILLYHPPLSKNSYTRLSVLKNTEDGFLIAEEDLKQRKEGEILGIKQSGMPKFLIAQPELHDSLLEIARKDAKHILTQDPDLTSVRGQSIRILLYLYQYNEAFQFIRAG
MRPSFLNPLFAPLSTFRGVGKKYSLFLSKIINCGNANETRFIDLLFYHPSSFIDRHYRPKISEISEERIVTITGYISQHSSFQLQKRRPYKILLNDGTGEITLLFFYRKTEMLKNVFFEGRKITVTGKIKKLKNRIIMVHPHYIFHNSQDVNFPLIEAVYSLPTGLSVDLFKKIIVEALSRLPVLPEWIEKDLLQKKSFPSIAEAFNIIHNPRKAKDFEWTSPARERLAYDELLAGQIALLLMRKQFKKEIGIPINVEGKIAQKILRNIPFSPTKSQESAIKDILQDMSQKNRMLRILQGDVGSGKTLVALIAMAAAVEAGGQAVIMAPIGILAQQHYEFIKKYTQNTQIIVEIITGNMPQAHRRKALERIAHGQAHIIIGTHALFQDSIQYYKLILVIVDEQHRFGVQQRLKLTQKATAPHVLLMTATPIPRTLVLTSLGDIDISKITEKPAGRKPIKTVIIPINRIDEVIERLKVVLSEGKKAYWICPQIEEKKESNFRSVVERFNSLHEHFTSSIAIIHGRMSDIDKESVMDSFKNGTCKLLIATTVIEVGIDVVDASIIIIENAEHFGLAQLHQLRGRVGRGEEISSCILLYHPPLSKNSYTRLSVLKNTEDGFLIAEEDLKQRKEGEILGIKQSGMPKFLIAQPELHDSLLEIARKDAKHILTQDPDLTSVRGQSIRILLYLYQYNEAFQFIRAG
MRPSFLNPLFAPLSTFRGVGKKYSLFLSKIINCGNANETRFIDLLFYHPSSFIDRHYRPKISEISEERIVTITGYISQHSSFQLQKRRPYKILLNDGTGEITLLFFYRKTEMLKNVFFEGRKITVTGKIKKLKNRIIMVHPHYIFHNSQDVNFPLIEAVYSLPTGLSVDLFKKIIVEALSRLPVLPEWIEKDLLQKKSFPSIAEAFNIIHNPRKAKDFEWTSPARERLAYDELLAGQIALLLMRKQFKKEIGIPINVEGKIAQKILRNIPFSPTKSQESAIKDILQDMSQKNRMLRILQGDVGSGKTLVALIAMAAAVEAGGQAVIMAPIGILAQQHYEFIKKYTQNTQIIVEIITGNMPQAHRRKALERIAHGQAHIIIGTHALFQDSIQYYKLILVIVDEQHRFGVQQRLKLTQKATAPHVLLMTATPIPRTLVLTSLGDIDISKITEKPAGRKPIKTVIIPINRIDEVIERLKVVLSEGKKAYWICPQIEEKKESNFRSVVERFNSLHEHFTSSIAIIHGRMSDIDKESVMDSFKNGTCKLLIATTVIEVGIDVVDASIIIIENAEHFGLAQLHQLRGRVGRGEEISSCILLYHPPLSKNSYTRLSVLKNTEDGFLIAEEDLKQRKEGEILGIKQSGMPKFLIAQPELHDSLLEIARKDAKHILTQDPDLTSVRGQSIRILLYLYQYNEAFQFIRAG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target700 ATP-dependent DNA helicase RecG [Candidatus Liberibacte
254780947 1187 transcription-repair coupling factor [Candidatus L 1e-56
254780382465 ATP dependent RNA helicase protein [Candidatus Lib 8e-09
254780601 573 ATP-dependent RNA helicase protein [Candidatus Lib 3e-08
254780619 731 primosome assembly protein PriA [Candidatus Liberi 8e-06
254780991 805 excinuclease ABC subunit B [Candidatus Liberibacte 2e-04
>gi|254780947|ref|YP_003065360.1| transcription-repair coupling factor [Candidatus Liberibacter asiaticus str. psy62] Length = 1187 Back     alignment
 Score =  212 bits (540), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 137/395 (34%), Positives = 214/395 (54%), Gaps = 19/395 (4%)

Query: 254 PINVEGKIAQKILRNIPFSPTKSQESAIKDILQDMSQKNRMLRILQGDVGSGKTLVALIA 313
           P+ V   +  + ++  P   T+ QE AI  ++QD+S    M R++ GDVG GKT +AL A
Sbjct: 607 PLMVSQDLYSQFIKRFPHVETEDQEKAIDAVIQDLSSGRLMDRLICGDVGFGKTEIALRA 666

Query: 314 MAAAVEAGGQAVIMAPIGILAQQHYEFIKKYTQNTQIIVEIITGNMPQAHRRKALERIAH 373
              AV  G Q  ++AP  +L +QH+    +  Q   + +  I+  +         + I  
Sbjct: 667 AFIAVMNGLQVAVIAPTTLLVRQHFRLFSERFQGFSVRIASISRFVQTKEAALHKKSITE 726

Query: 374 GQAHIIIGTHALFQDSIQYYKLILVIVDEQHRFGVQQRLKLTQKATAPHVLLMTATPIPR 433
           GQ  I+IGTHAL    I +  L L+I+DE+  FGV+ +  L +  T  HVL ++ATPIPR
Sbjct: 727 GQVDIVIGTHALLNPKITFANLGLIIIDEEQHFGVKHKEALKETHTGVHVLTLSATPIPR 786

Query: 434 TLVLTSLGDIDISKITEKPAGRKPIKTVIIPINRIDEVIERLKVVLSEGKKAYWICPQIE 493
           TL L   G  ++S I+  P  R   +T I   + +  V E L      G +++++CP++ 
Sbjct: 787 TLQLAITGVRELSLISMPPINRIACRTSISIFDPL-VVRETLMREYYRGGQSFYVCPRLS 845

Query: 494 --EKKESNFRSVVERFNSLHEHFTSSIAIIHGRMSDIDKESVMDSFKNGTCKLLIATTVI 551
             EK  +  +S V             IA+ HG+MS  + E  M++F  G   +L++T+++
Sbjct: 846 DLEKCYTFLQSEVPELK---------IAMAHGQMSPKNLEDKMNAFYEGQYDVLLSTSIV 896

Query: 552 EVGIDVVDASIIIIENAEHFGLAQLHQLRGRVGRGEEISSCILLYHP---PLSKNSYTRL 608
           E G+D+  A+ +I++ A+ FGLAQL+QLRGRVGR  +I+S  L   P   PL+  +  RL
Sbjct: 897 ESGLDLPKANTMIVQRADMFGLAQLYQLRGRVGRS-KIASFALFLLPENRPLTAAAQKRL 955

Query: 609 SVLKNTED---GFLIAEEDLKQRKEGEILGIKQSG 640
            +L++      GF +A  DL  R  G +LG +QSG
Sbjct: 956 RILQSLNTLGAGFQLASYDLDIRGTGNLLGEEQSG 990

>gi|254780382|ref|YP_003064795.1| ATP dependent RNA helicase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 465 Back     alignment
 Score = 53.9 bits (128), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 70/316 (22%), Positives = 130/316 (41%), Gaps = 54/316 (17%)

Query: 302 VGSGKTLVALIAMAAAVEAG------GQAVIMAPIGILAQQHYEFIKKYTQNTQIIVEII 355
            G+GKT   ++ M   +E G       + +I+ P   LA Q  +  +KY +N  + V ++
Sbjct: 47  TGTGKTASFVLPMLTILEKGRARVRMPRTLILEPTRELAAQVADNFEKYGKNYNLTVALL 106

Query: 356 TGNMPQAHRRKALERIAHGQAHIIIGTHALFQDSIQYYKLIL-----VIVDEQHRFGVQQ 410
            G +P   + K LER     A ++I T     D     KL++     +++DE  R     
Sbjct: 107 IGGIPFEAQNKKLER----GADVLICTPGRILDHFNRGKLLMNNIEILVIDEADR----- 157

Query: 411 RLKLTQKATAPHVLLMTA-TPIPR-TLVLTSLGDIDISKITEKPAGRKPIKTVIIPINRI 468
              +      P++  +T+  P  R TL+ ++    ++ K++E    + P +  +   +  
Sbjct: 158 ---MLDMGFIPYIQNITSLVPFTRQTLLFSATMTDELQKVSENFL-QNPKRIEVNTPSST 213

Query: 469 DEVIERLKVVL------------------SEGKKAYWICPQIEEKKESNFRSVVERFNSL 510
            E IE   V                       K     C Q         ++VV   +SL
Sbjct: 214 AETIEHCFVATYAQYSKKCALLQQLLQSQDTMKNGIIFCNQK--------KNVVNLCHSL 265

Query: 511 HEHFTSSIAIIHGRMSDIDKESVMDSFKNGTCKLLIATTVIEVGIDVVDASIIIIENAEH 570
            E    S+  IHG +    +  ++ +FK GT +L++A+ +   G+D+ D   +   +  +
Sbjct: 266 -EKQGFSVCAIHGNIDQRSRMKILSNFKEGTIQLMVASDLAARGLDIPDVGHVFNFDVPN 324

Query: 571 FGLAQLHQLRGRVGRG 586
                +H++ GR GR 
Sbjct: 325 RAENYIHRI-GRTGRA 339

>gi|254780601|ref|YP_003065014.1| ATP-dependent RNA helicase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 573 Back     alignment
 Score = 52.0 bits (123), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 74/318 (23%), Positives = 130/318 (40%), Gaps = 50/318 (15%)

Query: 297 ILQGDVGSGKTLVALIAMAAAVEAGGQ---------AVIMAPIGILAQQHYEFIKKYTQN 347
           ++    GSGKT+   +A+A+ + A            A+ +AP   LA Q    ++     
Sbjct: 41  LVSAQTGSGKTVAFGLALASTLLAENDRFSPASAPLALAIAPTRELAVQVGRELEWLYAK 100

Query: 348 TQIIVEIITGNMPQAHRRKALERIAHGQAHIIIGTHALFQDSIQYYKL--------ILVI 399
           T ++V +  G +     R+ L+      AHI++GT     D I+   L        +L  
Sbjct: 101 TGVVVAVCIGGVSVHRERRDLQ----NGAHIVVGTPGRLCDHIRGKGLNISHLKAVVLDE 156

Query: 400 VDEQHRFGVQQRLK--LTQKATAPHVLLMTATPIPRTLVLTSLGDIDISKITEKPAGRK- 456
            DE    G +  ++  L        +L+ +AT  P    L      D  ++      R+ 
Sbjct: 157 ADEMLDLGFRDDIEFILDSSPKKRRMLMFSATISPAITTLAKNYQKDAVRVNIASENRQH 216

Query: 457 ---PIKTVIIPINRIDEVIERLKVVLSEG-KKAYWICPQIEEKKESNFRSVVERFNS-LH 511
                + V++ ++  D  I  + ++   G K A   C         + R+ V RF   L 
Sbjct: 217 SDIDYRAVLVALSDRDNAI--VNILRYHGAKNAIVFC---------STRASVSRFTKVLA 265

Query: 512 EHFTSSIAIIHGRMSDIDKESVMDSFKNGTCKLLIATTVIEVGIDVVDASIII----IEN 567
           EH    +A+  G +S  ++ + +   ++G  ++ IAT V   GID+ D  ++I      N
Sbjct: 266 EHLFQVVAL-SGELSQQERSNALQMMRDGRARVCIATDVAARGIDLPDLELVIHAELSSN 324

Query: 568 AEHFGLAQLHQLRGRVGR 585
            E+     LH+  GR GR
Sbjct: 325 PENL----LHR-SGRTGR 337

>gi|254780619|ref|YP_003065032.1| primosome assembly protein PriA [Candidatus Liberibacter asiaticus str. psy62] Length = 731 Back     alignment
 Score = 43.9 bits (102), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 37/138 (26%), Positives = 69/138 (50%), Gaps = 10/138 (7%)

Query: 275 KSQESAIKDILQDMSQKNRMLRILQGDVGSGKTLVALIAMAAAVEAGGQAVIMAP-IGIL 333
           K+Q+  ++ ++  +  K   + ++ G  GSGKT V L  +AA +  G Q +I+ P I + 
Sbjct: 201 KNQQDVVEQVV-PLCTKGFAVSLISGVTGSGKTEVYLEIVAAVLHLGKQVLILLPEISLT 259

Query: 334 AQQHYEFIKKYTQNTQIIVEIITGNMPQAHRRKALERIAHGQAHIIIGTH-ALFQDSIQY 392
           +     F K++          ++ +M    R K   ++A G   +I+G   ALF   + +
Sbjct: 260 SAILERFQKRFGVKPAEWHSSLSTSM----REKIWRQVARGAISVIVGVRSALF---LPF 312

Query: 393 YKLILVIVDEQHRFGVQQ 410
            KL L+++DE+H    +Q
Sbjct: 313 KKLGLIVIDEEHDISYKQ 330

>gi|254780991|ref|YP_003065404.1| excinuclease ABC subunit B [Candidatus Liberibacter asiaticus str. psy62] Length = 805 Back     alignment
 Score = 39.7 bits (91), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 42/75 (56%), Gaps = 6/75 (8%)

Query: 271 FSPTKSQESAIKDILQDMSQKNRMLRILQGDVGSGKTLVALIAMAAAVEAGGQ-AVIMAP 329
           + P+  Q +AI  +L+ +  + + +++L G  GSGKT      MA  +EA  + A++MAP
Sbjct: 147 YHPSGDQPAAIAQLLKGIHSREK-VQLLLGVTGSGKTFT----MAKVIEAMQRPAIVMAP 201

Query: 330 IGILAQQHYEFIKKY 344
             ILA Q Y   K +
Sbjct: 202 NKILAAQLYSEFKNF 216

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target700 ATP-dependent DNA helicase RecG [Candidatus Liberibacte
315122358700 ATP-dependent DNA helicase RecG [Candidatus Liberibacte 1 0.0
222085971701 ATP-dependent DNA helicase RecG [Agrobacterium radiobac 1 0.0
325293166704 ATP-dependent DNA helicase [Agrobacterium sp. H13-3] Le 1 0.0
159184915701 ATP-dependent DNA helicase [Agrobacterium tumefaciens s 1 0.0
327188304701 ATP-dependent DNA helicase protein [Rhizobium etli CNPA 1 0.0
190891737701 ATP-dependent DNA helicase [Rhizobium etli CIAT 652] Le 1 0.0
222148733790 ATP-dependent DNA helicase RecG [Agrobacterium vitis S4 1 0.0
209549324701 ATP-dependent DNA helicase RecG [Rhizobium leguminosaru 1 0.0
86357712701 ATP-dependent DNA helicase protein [Rhizobium etli CFN 1 0.0
37728039701 recombination and repair protein [Rhizobium etli] Lengt 1 0.0
>gi|315122358|ref|YP_004062847.1| ATP-dependent DNA helicase RecG [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 700 Back     alignment and organism information
 Score = 1183 bits (3061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/700 (81%), Positives = 642/700 (91%)

Query: 1   MRPSFLNPLFAPLSTFRGVGKKYSLFLSKIINCGNANETRFIDLLFYHPSSFIDRHYRPK 60
           MRPS LNPLFAPLS+ RGVG+K  L  SKII+ GNANE+RFIDLLFY+PSSFIDR Y PK
Sbjct: 1   MRPSLLNPLFAPLSSLRGVGEKNVLLFSKIIDFGNANESRFIDLLFYYPSSFIDRRYHPK 60

Query: 61  ISEISEERIVTITGYISQHSSFQLQKRRPYKILLNDGTGEITLLFFYRKTEMLKNVFFEG 120
           ISEISEER+VTITG+I+   S +  K+ PY+ILLNDGTGEI+LLFF++KTE LKN+FF+G
Sbjct: 61  ISEISEERVVTITGHIASLPSVRSPKKIPYQILLNDGTGEISLLFFHKKTEWLKNIFFKG 120

Query: 121 RKITVTGKIKKLKNRIIMVHPHYIFHNSQDVNFPLIEAVYSLPTGLSVDLFKKIIVEALS 180
           RKITVTG+IKK KNR+ M+HPHY F++SQDV  PLIE +YSLPTGLS D FKKI+ EALS
Sbjct: 121 RKITVTGQIKKFKNRLTMIHPHYFFYDSQDVILPLIEPIYSLPTGLSADFFKKIVDEALS 180

Query: 181 RLPVLPEWIEKDLLQKKSFPSIAEAFNIIHNPRKAKDFEWTSPARERLAYDELLAGQIAL 240
           RLP LPEW+E DLLQ+KSFPS+ EAF IIHNPR  KDFEWTSPARERLAYDE LAGQIAL
Sbjct: 181 RLPTLPEWLENDLLQEKSFPSMKEAFKIIHNPRDVKDFEWTSPARERLAYDEFLAGQIAL 240

Query: 241 LLMRKQFKKEIGIPINVEGKIAQKILRNIPFSPTKSQESAIKDILQDMSQKNRMLRILQG 300
           LL+RK+FK+E+GIPI VEGKIAQKI++++PFSPTKSQ  AI+DILQDMSQKNRMLRILQG
Sbjct: 241 LLVRKKFKEELGIPIQVEGKIAQKIVQSLPFSPTKSQNLAIRDILQDMSQKNRMLRILQG 300

Query: 301 DVGSGKTLVALIAMAAAVEAGGQAVIMAPIGILAQQHYEFIKKYTQNTQIIVEIITGNMP 360
           DVGSGKTLVALIAMA AVEAGGQAVIMAPIGILAQQHYEFIKKYTQ++QI +EIITGNMP
Sbjct: 301 DVGSGKTLVALIAMATAVEAGGQAVIMAPIGILAQQHYEFIKKYTQDSQIGIEIITGNMP 360

Query: 361 QAHRRKALERIAHGQAHIIIGTHALFQDSIQYYKLILVIVDEQHRFGVQQRLKLTQKATA 420
           ++ R+ AL+RIA+GQA IIIGTHALFQDSIQY+KLIL++VDEQHRFGVQQRLKLTQK  +
Sbjct: 361 KSQRKIALKRIANGQAQIIIGTHALFQDSIQYHKLILIVVDEQHRFGVQQRLKLTQKGNS 420

Query: 421 PHVLLMTATPIPRTLVLTSLGDIDISKITEKPAGRKPIKTVIIPINRIDEVIERLKVVLS 480
           PHVLLMTATPIPRTL+LT+ GDI++SKITEKPAGRKPIKTVIIPI+RI+EV+ERLKVV+S
Sbjct: 421 PHVLLMTATPIPRTLILTAFGDINVSKITEKPAGRKPIKTVIIPISRINEVVERLKVVVS 480

Query: 481 EGKKAYWICPQIEEKKESNFRSVVERFNSLHEHFTSSIAIIHGRMSDIDKESVMDSFKNG 540
           E KKAYWICPQIEEK+ES+F SV+ERF SL E F S IAIIHGRMSD DKES+M+SFKNG
Sbjct: 481 ENKKAYWICPQIEEKEESHFCSVIERFKSLQEQFGSDIAIIHGRMSDTDKESIMNSFKNG 540

Query: 541 TCKLLIATTVIEVGIDVVDASIIIIENAEHFGLAQLHQLRGRVGRGEEISSCILLYHPPL 600
           T KLLIATTVIEVG+DV+DASIIIIE+AEHFGLAQLHQLRGRVGRGEE+SSCILLYHPPL
Sbjct: 541 TYKLLIATTVIEVGVDVIDASIIIIEHAEHFGLAQLHQLRGRVGRGEEVSSCILLYHPPL 600

Query: 601 SKNSYTRLSVLKNTEDGFLIAEEDLKQRKEGEILGIKQSGMPKFLIAQPELHDSLLEIAR 660
           S+ SYTRLS+L+NTEDGFLIAEEDLKQR EGEILGIKQSGMPKFLIAQPELH +LLEIAR
Sbjct: 601 SRVSYTRLSILRNTEDGFLIAEEDLKQRGEGEILGIKQSGMPKFLIAQPELHSTLLEIAR 660

Query: 661 KDAKHILTQDPDLTSVRGQSIRILLYLYQYNEAFQFIRAG 700
           KDA +I+ QDP+LTSVRG+S+RILLYLY+YNEAFQFI+AG
Sbjct: 661 KDAINIIKQDPNLTSVRGRSLRILLYLYRYNEAFQFIKAG 700


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085971|ref|YP_002544503.1| ATP-dependent DNA helicase RecG [Agrobacterium radiobacter K84] Length = 701 Back     alignment and organism information
>gi|325293166|ref|YP_004279030.1| ATP-dependent DNA helicase [Agrobacterium sp. H13-3] Length = 704 Back     alignment and organism information
>gi|159184915|ref|NP_354765.2| ATP-dependent DNA helicase [Agrobacterium tumefaciens str. C58] Length = 701 Back     alignment and organism information
>gi|327188304|gb|EGE55523.1| ATP-dependent DNA helicase protein [Rhizobium etli CNPAF512] Length = 701 Back     alignment and organism information
>gi|190891737|ref|YP_001978279.1| ATP-dependent DNA helicase [Rhizobium etli CIAT 652] Length = 701 Back     alignment and organism information
>gi|222148733|ref|YP_002549690.1| ATP-dependent DNA helicase RecG [Agrobacterium vitis S4] Length = 790 Back     alignment and organism information
>gi|209549324|ref|YP_002281241.1| ATP-dependent DNA helicase RecG [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 701 Back     alignment and organism information
>gi|86357712|ref|YP_469604.1| ATP-dependent DNA helicase protein [Rhizobium etli CFN 42] Length = 701 Back     alignment and organism information
>gi|37728039|gb|AAO43500.1| recombination and repair protein [Rhizobium etli] Length = 701 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target700 ATP-dependent DNA helicase RecG [Candidatus Liberibacte
PRK10917681 PRK10917, PRK10917, ATP-dependent DNA helicase RecG; Pr 0.0
COG1200677 COG1200, RecG, RecG-like helicase [DNA replication, rec 0.0
TIGR00643630 TIGR00643, recG, ATP-dependent DNA helicase RecG 1e-173
COG1197 1139 COG1197, Mfd, Transcription-repair coupling factor (sup 2e-88
TIGR00580926 TIGR00580, mfd, transcription-repair coupling factor (m 7e-85
PRK10689 1147 PRK10689, PRK10689, transcription-repair coupling facto 1e-67
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicases [DN 1e-18
TIGR00595505 TIGR00595, priA, primosomal protein N' 1e-13
KOG0330476 KOG0330, KOG0330, KOG0330, ATP-dependent RNA helicase [ 2e-07
COG1203733 COG1203, COG1203, Predicted helicases [General function 1e-06
KOG0347731 KOG0347, KOG0347, KOG0347, RNA helicase [RNA processing 3e-04
pfam00270167 pfam00270, DEAD, DEAD/DEAH box helicase 2e-26
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 1e-22
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 2e-16
PRK13766 773 PRK13766, PRK13766, Hef nuclease; Provisional 1e-09
PRK05580 679 PRK05580, PRK05580, primosome assembly protein PriA; Va 3e-09
cd00268203 cd00268, DEADc, DEAD-box helicases 7e-09
COG1110 1187 COG1110, COG1110, Reverse gyrase [DNA replication, reco 6e-06
KOG0346569 KOG0346, KOG0346, KOG0346, RNA helicase [RNA processing 2e-05
COG1204 766 COG1204, COG1204, Superfamily II helicase [General func 2e-04
KOG0348 708 KOG0348, KOG0348, KOG0348, ATP-dependent RNA helicase [ 3e-04
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal domain 1e-16
COG1198730 COG1198, PriA, Primosomal protein N' (replication facto 2e-15
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-terminal do 4e-14
smart0049082 smart00490, HELICc, helicase superfamily c-terminal dom 8e-13
KOG0354 746 KOG0354, KOG0354, KOG0354, DEAD-box like helicase [Gene 2e-04
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replication, r 5e-04
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function pred 5e-14
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily II [ 1e-13
COG4098441 COG4098, comFA, Superfamily II DNA/RNA helicase require 6e-12
KOG0335482 KOG0335, KOG0335, KOG0335, ATP-dependent RNA helicase [ 5e-11
KOG0327397 KOG0327, KOG0327, KOG0327, Translation initiation facto 2e-09
KOG0328400 KOG0328, KOG0328, KOG0328, Predicted ATP-dependent RNA 7e-09
KOG0334 997 KOG0334, KOG0334, KOG0334, RNA helicase [RNA processing 8e-09
KOG4284 980 KOG4284, KOG4284, KOG4284, DEAD box protein [Transcript 2e-08
COG0514 590 COG0514, RecQ, Superfamily II DNA helicase [DNA replica 3e-07
KOG0339731 KOG0339, KOG0339, KOG0339, ATP-dependent RNA helicase [ 3e-06
KOG0333673 KOG0333, KOG0333, KOG0333, U5 snRNP-like RNA helicase s 1e-05
KOG0344593 KOG0344, KOG0344, KOG0344, ATP-dependent RNA helicase [ 2e-04
KOG0326459 KOG0326, KOG0326, KOG0326, ATP-dependent RNA helicase [ 4e-04
KOG0332477 KOG0332, KOG0332, KOG0332, ATP-dependent RNA helicase [ 2e-11
KOG0331519 KOG0331, KOG0331, KOG0331, ATP-dependent RNA helicase [ 1e-09
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 1e-05
KOG0341610 KOG0341, KOG0341, KOG0341, DEAD-box protein abstrakt [R 9e-05
KOG0336629 KOG0336, KOG0336, KOG0336, ATP-dependent RNA helicase [ 1e-04
KOG0337529 KOG0337, KOG0337, KOG0337, ATP-dependent RNA helicase [ 3e-04
COG1205 851 COG1205, COG1205, Distinct helicase family with a uniqu 2e-11
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase 3e-04
KOG0344593 KOG0344, KOG0344, KOG0344, ATP-dependent RNA helicase [ 5e-11
cd0448875 cd04488, RecG_wedge_OBF, RecG_wedge_OBF: A subfamily of 8e-10
pfam0133675 pfam01336, tRNA_anti, OB-fold nucleic acid binding doma 0.001
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replication, r 1e-07
KOG0351 941 KOG0351, KOG0351, KOG0351, ATP-dependent DNA helicase [ 6e-07
TIGR00614470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ f 2e-05
TIGR01587358 TIGR01587, cas3_core, CRISPR-associated helicase Cas3 2e-05
KOG0350620 KOG0350, KOG0350, KOG0350, DEAD-box ATP-dependent RNA h 8e-07
TIGR01054 1171 TIGR01054, rgy, reverse gyrase 1e-05
COG4581 1041 COG4581, COG4581, Superfamily II RNA helicase [DNA repl 7e-05
PRK02362 737 PRK02362, PRK02362, ski2-like helicase; Provisional 0.001
>gnl|CDD|182836 PRK10917, PRK10917, ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>gnl|CDD|31393 COG1200, RecG, RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>gnl|CDD|161975 TIGR00643, recG, ATP-dependent DNA helicase RecG Back     alignment and domain information
>gnl|CDD|31390 COG1197, Mfd, Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>gnl|CDD|161938 TIGR00580, mfd, transcription-repair coupling factor (mfd) Back     alignment and domain information
>gnl|CDD|182649 PRK10689, PRK10689, transcription-repair coupling factor; Provisional Back     alignment and domain information
>gnl|CDD|30859 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161946 TIGR00595, priA, primosomal protein N' Back     alignment and domain information
>gnl|CDD|35551 KOG0330, KOG0330, KOG0330, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|31396 COG1203, COG1203, Predicted helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|35568 KOG0347, KOG0347, KOG0347, RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|144015 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|128763 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|28927 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|184313 PRK13766, PRK13766, Hef nuclease; Provisional Back     alignment and domain information
>gnl|CDD|180144 PRK05580, PRK05580, primosome assembly protein PriA; Validated Back     alignment and domain information
>gnl|CDD|28928 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|31307 COG1110, COG1110, Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|35567 KOG0346, KOG0346, KOG0346, RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|31397 COG1204, COG1204, Superfamily II helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|35569 KOG0348, KOG0348, KOG0348, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|28960 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|31391 COG1198, PriA, Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|144016 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|128766 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|35575 KOG0354, KOG0354, KOG0354, DEAD-box like helicase [General function prediction only] Back     alignment and domain information
>gnl|CDD|31308 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|31394 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|31261 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|33855 COG4098, comFA, Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|35556 KOG0335, KOG0335, KOG0335, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35548 KOG0327, KOG0327, KOG0327, Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35549 KOG0328, KOG0328, KOG0328, Predicted ATP-dependent RNA helicase FAL1, involved in rRNA maturation, DEAD-box superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|35555 KOG0334, KOG0334, KOG0334, RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|39485 KOG4284, KOG4284, KOG4284, DEAD box protein [Transcription] Back     alignment and domain information
>gnl|CDD|30860 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|35560 KOG0339, KOG0339, KOG0339, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35554 KOG0333, KOG0333, KOG0333, U5 snRNP-like RNA helicase subunit [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35565 KOG0344, KOG0344, KOG0344, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35547 KOG0326, KOG0326, KOG0326, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35553 KOG0332, KOG0332, KOG0332, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35552 KOG0331, KOG0331, KOG0331, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|35562 KOG0341, KOG0341, KOG0341, DEAD-box protein abstrakt [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35557 KOG0336, KOG0336, KOG0336, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|35558 KOG0337, KOG0337, KOG0337, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|31398 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|177796 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|35565 KOG0344, KOG0344, KOG0344, ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|72960 cd04488, RecG_wedge_OBF, RecG_wedge_OBF: A subfamily of OB folds corresponding to the OB fold found in the N-terminal (wedge) domain of Escherichia coli RecG Back     alignment and domain information
>gnl|CDD|144799 pfam01336, tRNA_anti, OB-fold nucleic acid binding domain Back     alignment and domain information
>gnl|CDD|31308 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|35572 KOG0351, KOG0351, KOG0351, ATP-dependent DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>gnl|CDD|162437 TIGR01587, cas3_core, CRISPR-associated helicase Cas3 Back     alignment and domain information
>gnl|CDD|35571 KOG0350, KOG0350, KOG0350, DEAD-box ATP-dependent RNA helicase [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|162177 TIGR01054, rgy, reverse gyrase Back     alignment and domain information
>gnl|CDD|34219 COG4581, COG4581, Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|179415 PRK02362, PRK02362, ski2-like helicase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 700 ATP-dependent DNA helicase RecG [Candidatus Liberibacte
COG1200677 RecG RecG-like helicase [DNA replication, recombination 100.0
PRK10917677 ATP-dependent DNA helicase RecG; Provisional 100.0
TIGR00643721 recG ATP-dependent DNA helicase RecG; InterPro: IPR0046 100.0
TIGR00580997 mfd transcription-repair coupling factor; InterPro: IPR 100.0
PRK10689 1148 transcription-repair coupling factor; Provisional 100.0
COG1197 1139 Mfd Transcription-repair coupling factor (superfamily I 100.0
KOG0334 997 consensus 99.59
KOG0347731 consensus 99.51
KOG0947 1248 consensus 99.14
COG1110 1187 Reverse gyrase [DNA replication, recombination, and rep 97.2
PRK05580699 primosome assembly protein PriA; Validated 100.0
COG1198730 PriA Primosomal protein N' (replication factor Y) - sup 100.0
KOG0385 971 consensus 98.38
KOG0353 695 consensus 98.2
TIGR01970 858 DEAH_box_HrpB ATP-dependent helicase HrpB; InterPro: IP 98.08
KOG1123776 consensus 96.44
COG3973747 Superfamily I DNA and RNA helicases [General function p 94.44
PRK11192417 ATP-dependent RNA helicase SrmB; Provisional 99.97
PRK01172 674 ski2-like helicase; Provisional 99.95
PRK11776459 ATP-dependent RNA helicase DbpA; Provisional 99.95
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 99.94
PRK02362 736 ski2-like helicase; Provisional 99.94
PRK10590457 ATP-dependent RNA helicase RhlE; Provisional 99.94
PTZ00110602 helicase; Provisional 99.94
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 99.93
PRK00254 717 ski2-like helicase; Provisional 99.93
PRK13766 764 Hef nuclease; Provisional 99.93
PRK04537 574 ATP-dependent RNA helicase RhlB; Provisional 99.93
PRK01297472 ATP-dependent RNA helicase RhlB; Provisional 99.93
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA replicat 99.91
COG4098441 comFA Superfamily II DNA/RNA helicase required for DNA 99.89
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 99.88
COG1204 766 Superfamily II helicase [General function prediction on 99.87
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recombinati 99.86
PRK13767 878 ATP-dependent helicase; Provisional 99.86
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Transcript 99.85
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanisms] 99.83
COG1205 851 Distinct helicase family with a unique C-terminal domai 99.82
KOG0354 746 consensus 99.8
KOG0952 1230 consensus 99.78
KOG0331519 consensus 99.77
PRK05298657 excinuclease ABC subunit B; Provisional 99.75
COG1201 814 Lhr Lhr-like helicases [General function prediction onl 99.75
KOG0335482 consensus 99.74
KOG0350620 consensus 99.73
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, reco 99.73
KOG0348708 consensus 99.7
KOG0342543 consensus 99.7
KOG0333673 consensus 99.69
KOG0345 567 consensus 99.69
COG1202 830 Superfamily II helicase, archaea-specific [General func 99.66
PRK09694878 hypothetical protein; Provisional 99.65
KOG0343 758 consensus 99.62
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 99.6
KOG4284 980 consensus 99.58
KOG0339731 consensus 99.58
KOG0328400 consensus 99.55
KOG0330476 consensus 99.55
KOG0338691 consensus 99.55
COG4581 1041 Superfamily II RNA helicase [DNA replication, recombina 99.54
TIGR00631667 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 A 99.53
KOG0951 1674 consensus 99.51
KOG0326459 consensus 99.5
KOG0332477 consensus 99.46
KOG0340442 consensus 99.43
KOG0327397 consensus 99.42
KOG0351 941 consensus 99.4
KOG0346569 consensus 99.32
PRK04914 955 ATP-dependent helicase HepA; Validated 99.29
KOG0337529 consensus 99.29
KOG0950 1008 consensus 99.26
PRK11448 1126 hsdR type I restriction enzyme EcoKI subunit R; Provisi 99.24
KOG0352 641 consensus 99.19
KOG0948 1041 consensus 99.07
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombinatio 99.05
TIGR00614497 recQ_fam ATP-dependent DNA helicase, RecQ family; Inter 98.92
TIGR01389 607 recQ ATP-dependent DNA helicase RecQ; InterPro: IPR0062 98.79
KOG0920 924 consensus 98.67
KOG0922 674 consensus 98.63
COG4889 1518 Predicted helicase [General function prediction only] 98.54
KOG0387 923 consensus 98.22
KOG0329387 consensus 98.2
KOG0390776 consensus 97.88
COG0610 962 Type I site-specific restriction-modification system, R 97.74
KOG0389941 consensus 97.65
KOG0384 1373 consensus 96.89
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family [Tra 96.11
KOG1000689 consensus 95.86
COG1444 758 Predicted P-loop ATPase fused to an acetyltransferase [ 93.02
KOG0921 1282 consensus 90.46
TIGR00595524 priA primosomal protein N'; InterPro: IPR005259 All pro 99.93
KOG0336629 consensus 99.47
TIGR01587424 cas3_core CRISPR-associated helicase Cas3; InterPro: IP 99.44
KOG0341610 consensus 99.22
PRK12903 885 secA preprotein translocase subunit SecA; Reviewed 99.18
PRK12326 775 preprotein translocase subunit SecA; Reviewed 99.07
KOG09511674 consensus 98.09
KOG0925 699 consensus 97.58
KOG0386 1157 consensus 96.85
KOG03921549 consensus 96.32
KOG0344593 consensus 99.91
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. subt 99.78
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 99.68
PRK09401 1176 reverse gyrase; Reviewed 99.61
COG1110 1187 Reverse gyrase [DNA replication, recombination, and rep 99.54
TIGR01054 1843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 99.34
PRK11131 1295 ATP-dependent RNA helicase HrpA; Provisional 99.3
PRK12906 823 secA preprotein translocase subunit SecA; Reviewed 99.08
PRK09200 799 preprotein translocase subunit SecA; Reviewed 99.06
PRK12904 833 preprotein translocase subunit SecA; Reviewed 99.06
PRK12898673 secA preprotein translocase subunit SecA; Reviewed 98.97
COG4096 875 HsdR Type I site-specific restriction-modification syst 98.65
KOG0953 700 consensus 98.42
KOG0924 1042 consensus 97.94
TIGR01054 1843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 97.89
KOG4150 1034 consensus 95.64
TIGR02621 975 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-sub 95.62
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 99.76
smart00487201 DEXDc DEAD-like helicases superfamily. 99.71
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 99.65
cd00268203 DEADc DEAD-box helicases. A diverse family of proteins 99.46
pfam04851103 ResIII Type III restriction enzyme, res subunit. 99.18
pfam00176295 SNF2_N SNF2 family N-terminal domain. This domain is fo 98.58
pfam07652146 Flavi_DEAD Flavivirus DEAD domain. 97.98
TIGR00963 904 secA preprotein translocase, SecA subunit; InterPro: IP 97.92
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 96.35
smart00382148 AAA ATPases associated with a variety of cellular activ 96.16
PRK07952242 DNA replication protein DnaC; Validated 95.95
TIGR01448769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 95.9
PRK13342417 recombination factor protein RarA; Reviewed 94.92
pfam04466387 Terminase_3 Phage terminase large subunit. Initiation o 94.63
pfam03354473 Terminase_1 Phage Terminase. The majority of the member 92.91
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 92.9
KOG0388 1185 consensus 92.72
pfam03237380 Terminase_6 Terminase-like family. This family represen 92.25
COG4626546 Phage terminase-like protein, large subunit [General fu 91.99
PRK10536262 hypothetical protein; Provisional 91.76
KOG0344593 consensus 99.72
cd00079131 HELICc Helicase superfamily c-terminal domain; associat 99.71
TIGR00643 721 recG ATP-dependent DNA helicase RecG; InterPro: IPR0046 98.21
PRK10689 1148 transcription-repair coupling factor; Provisional 97.95
COG1197 1139 Mfd Transcription-repair coupling factor (superfamily I 97.61
TIGR00580 997 mfd transcription-repair coupling factor; InterPro: IPR 97.56
smart00487201 DEXDc DEAD-like helicases superfamily. 93.62
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 93.14
cd00268203 DEADc DEAD-box helicases. A diverse family of proteins 92.68
COG0556663 UvrB Helicase subunit of the DNA excision repair comple 99.63
cd0448875 RecG_wedge_OBF RecG_wedge_OBF: A subfamily of OB folds 99.42
PRK13480314 3'-5' exoribonuclease YhaM; Provisional 98.25
pfam0133675 tRNA_anti OB-fold nucleic acid binding domain. This fam 98.15
PRK07211473 replication factor A; Reviewed 97.15
cd0449283 YhaM_OBF_like YhaM_OBF_like: A subfamily of OB folds si 97.08
PRK06461130 single-stranded DNA-binding protein; Reviewed 97.04
cd0448584 DnaE_OBF DnaE_OBF: A subfamily of OB folds correspondin 97.0
cd0447895 RPA2_DBD_D RPA2_DBD_D: A subfamily of OB folds correspo 96.54
cd0352475 RPA2_OBF_family RPA2_OBF_family: A family of oligonucle 96.41
cd0448978 ExoVII_LU_OBF ExoVII_LU_OBF: A subfamily of OB folds co 96.37
PRK00448 1436 polC DNA polymerase III PolC; Validated 96.22
cd0448482 polC_OBF polC_OBF: A subfamily of OB folds correspondin 96.22
COG1570440 XseA Exonuclease VII, large subunit [DNA replication, r 96.18
PRK07211473 replication factor A; Reviewed 96.13
cd04474104 RPA1_DBD_A RPA1_DBD_A: A subfamily of OB folds correspo 96.07
cd0449182 SoSSB_OBF SoSSB_OBF: A subfamily of OB folds similar to 96.05
PRK12366649 replication factor A; Reviewed 95.97
cd0448392 hOBFC1_like hOBFC1_like: A subfamily of OB folds simila 95.82
KOG1805 1100 consensus 95.53
COG5235258 RFA2 Single-stranded DNA-binding replication protein A 95.52
COG2176 1444 PolC DNA polymerase III, alpha subunit (gram-positive t 95.47
cd0449079 PolII_SU_OBF PolII_SU_OBF: A subfamily of OB folds corr 95.31
COG4085204 Predicted RNA-binding protein, contains TRAM domain [Ge 94.95
KOG3108265 consensus 94.27
PRK07217311 replication factor A; Reviewed 94.26
PRK06386358 replication factor A; Reviewed 93.31
PRK00484491 lysS lysyl-tRNA synthetase; Reviewed 93.3
PRK05159434 aspC aspartyl-tRNA synthetase; Provisional 93.05
COG0017435 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation 92.51
cd0448773 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB folds 92.34
cd04497138 hPOT1_OB1_like hPOT1_OB1_like: A subfamily of OB folds 92.24
PRK00476587 aspS aspartyl-tRNA synthetase; Validated 92.23
TIGR01405 1264 polC_Gram_pos DNA polymerase III, alpha subunit, Gram-p 92.02
pfam04076126 BOF Bacterial OB fold (BOF) protein. Proteins in this f 91.28
smart0049082 HELICc helicase superfamily c-terminal domain. 99.18
pfam0027178 Helicase_C Helicase conserved C-terminal domain. The Pr 99.14
PRK07279 1033 dnaE DNA polymerase III DnaE; Reviewed 97.6
PRK07012 1173 consensus 97.58
PRK07374 1171 dnaE DNA polymerase III subunit alpha; Validated 97.57
PRK07892 1180 consensus 97.5
PRK06826 1157 dnaE DNA polymerase III DnaE; Reviewed 97.5
PRK05673 1143 dnaE DNA polymerase III subunit alpha; Validated 97.44
PRK06920 1107 dnaE DNA polymerase III DnaE; Reviewed 97.16
PRK08957 1159 consensus 97.06
PRK06326 1240 consensus 96.98
PRK08512 1185 consensus 96.44
KOG0949 1330 consensus 96.19
PRK07135 987 dnaE DNA polymerase III DnaE; Validated 94.28
PRK05898971 dnaE DNA polymerase III DnaE; Validated 92.09
CHL00122 891 secA preprotein translocase subunit SecA; Validated 99.04
PRK00440318 rfc replication factor C small subunit; Reviewed 95.48
PRK00652334 lpxK tetraacyldisaccharide 4'-kinase; Reviewed 94.52
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 98.98
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 98.92
PRK12902 946 secA preprotein translocase subunit SecA; Reviewed 98.89
PRK12899 969 secA preprotein translocase subunit SecA; Reviewed 98.79
PRK13107 908 preprotein translocase subunit SecA; Reviewed 98.75
PRK12901 1111 secA preprotein translocase subunit SecA; Reviewed 98.71
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, RNA h 98.47
pfam07517381 SecA_DEAD SecA DEAD-like domain. SecA protein binds to 98.31
pfam09848348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 97.2
cd00079131 HELICc Helicase superfamily c-terminal domain; associat 96.96
PRK11192417 ATP-dependent RNA helicase SrmB; Provisional 96.88
PRK04537574 ATP-dependent RNA helicase RhlB; Provisional 96.8
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 96.78
PRK10590457 ATP-dependent RNA helicase RhlE; Provisional 96.68
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 96.6
PRK05298657 excinuclease ABC subunit B; Provisional 96.49
PRK11776459 ATP-dependent RNA helicase DbpA; Provisional 96.35
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA replicat 96.17
COG4098441 comFA Superfamily II DNA/RNA helicase required for DNA 95.9
PRK01297472 ATP-dependent RNA helicase RhlB; Provisional 95.9
TIGR00631667 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 A 95.59
PRK13767 878 ATP-dependent helicase; Provisional 95.44
KOG0333673 consensus 95.25
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Transcript 94.93
PRK09694878 hypothetical protein; Provisional 93.9
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 92.88
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanisms] 90.64
PRK08074 932 bifunctional ATP-dependent DNA helicase/DNA polymerase 98.97
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polymerase 98.42
TIGR01407 944 dinG_rel DnaQ family exonuclease/DinG family helicase, 97.8
PRK09401 1176 reverse gyrase; Reviewed 97.28
COG0556663 UvrB Helicase subunit of the DNA excision repair comple 96.01
PRK12900 983 secA preprotein translocase subunit SecA; Reviewed 98.87
COG1199654 DinG Rad3-related DNA helicases [Transcription / DNA re 96.5
KOG0349725 consensus 98.6
KOG0923 902 consensus 97.9
PRK10917677 ATP-dependent DNA helicase RecG; Provisional 98.58
COG1200677 RecG RecG-like helicase [DNA replication, recombination 98.38
COG1198730 PriA Primosomal protein N' (replication factor Y) - sup 97.19
TIGR00595524 priA primosomal protein N'; InterPro: IPR005259 All pro 93.97
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 98.13
PRK08074932 bifunctional ATP-dependent DNA helicase/DNA polymerase 92.42
PRK12366649 replication factor A; Reviewed 97.67
PRK04036497 DNA polymerase II small subunit; Validated 95.61
PRK029831099 lysS lysyl-tRNA synthetase; Provisional 91.48
PRK07373447 DNA polymerase III subunit alpha; Reviewed 97.65
smart00489289 DEXDc3 DEAD-like helicases superfamily. 97.61
smart00488289 DEXDc2 DEAD-like helicases superfamily. 97.61
KOG1803649 consensus 97.24
PRK08116262 hypothetical protein; Validated 96.61
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 96.48
PRK08533230 flagellar accessory protein FlaH; Reviewed 96.4
PRK01216351 DNA polymerase IV; Validated 96.3
KOG1802 935 consensus 95.83
PRK06835330 DNA replication protein DnaC; Validated 95.68
PRK06921265 hypothetical protein; Provisional 95.68
COG3267269 ExeA Type II secretory pathway, component ExeA (predict 95.65
TIGR00150147 TIGR00150 conserved hypothetical protein TIGR00150; Int 95.46
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 95.36
PRK08939306 primosomal protein DnaI; Reviewed 95.33
PRK12377248 putative replication protein; Provisional 94.98
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 94.77
COG1484254 DnaC DNA replication protein [DNA replication, recombin 94.66
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 94.57
PRK06067241 flagellar accessory protein FlaH; Validated 94.1
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4. 93.72
PRK04328250 hypothetical protein; Provisional 93.16
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 92.88
COG0389354 DinP Nucleotidyltransferase/DNA polymerase involved in 92.79
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 90.69
pfam06745231 KaiC KaiC. This family represents a conserved region wi 90.62
cd01394218 radB RadB. The archaeal protein radB shares similarity 90.09
PRK05580699 primosome assembly protein PriA; Validated 97.58
smart0049082 HELICc helicase superfamily c-terminal domain. 96.75
pfam0027178 Helicase_C Helicase conserved C-terminal domain. The Pr 96.62
PRK056721050 dnaE2 error-prone DNA polymerase; Validated 97.4
PRK06658 1145 consensus 97.31
PRK08744 1195 consensus 96.17
KOG0391 1958 consensus 94.82
COG0587 1139 DnaE DNA polymerase III, alpha subunit [DNA replication 94.26
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4. 97.28
PRK09074 1149 consensus 97.19
PRK06637 1182 consensus 97.17
PRK03348456 DNA polymerase IV; Provisional 95.87
TIGR00348813 hsdR type I site-specific deoxyribonuclease, HsdR famil 96.94
PRK09183258 transposase/IS protein; Provisional 96.87
PRK08181269 transposase; Validated 96.85
PRK06526254 transposase; Provisional 96.61
TIGR02538577 type_IV_pilB type IV-A pilus assembly ATPase PilB; Inte 90.3
PTZ00110602 helicase; Provisional 96.43
COG1107715 Archaea-specific RecJ-like exonuclease, contains DnaJ-t 96.33
TIGR00617671 rpa1 replication factor-a protein 1 (rpa1); InterPro: I 95.42
PRK00286443 xseA exodeoxyribonuclease VII large subunit; Reviewed 96.31
cd01700344 Pol_V Pol V was discovered in Escherichia coli as Umuc 95.91
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor type A 93.17
TIGR02903616 spore_lon_C ATP-dependent protease, Lon family; InterPr 91.89
PRK04195403 replication factor C large subunit; Provisional 91.65
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 90.45
PRK02406355 DNA polymerase IV; Validated 95.84
cd01124187 KaiC KaiC is a circadian clock protein primarily found 95.59
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 92.11
PRK08840464 replicative DNA helicase; Provisional 91.89
pfam05707183 Zot Zonular occludens toxin (Zot). This family consists 91.77
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 91.74
PRK08506473 replicative DNA helicase; Provisional 90.35
cd01701405 Pol_zeta Pol_zeta, a member of the Y-family of DNA poly 95.79
PRK03352345 DNA polymerase IV; Validated 95.32
pfam00580494 UvrD-helicase UvrD/REP helicase. The Rep family helicas 94.62
cd00424341 Pol_Y Y-family of DNA polymerases. Pol_Y's can transver 94.22
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 91.75
PRK03103410 DNA polymerase IV; Reviewed 95.49
PRK03858398 DNA polymerase IV; Validated 95.24
PRK02794417 DNA polymerase IV; Provisional 95.46
cd03586337 Pol_IV_kappa Pol_IV_kappa, a member of the Y-family of 94.82
cd01702358 Pol_eta Pol eta is member of the DNA polimerase Y-famil 94.54
PRK11773722 uvrD DNA-dependent helicase II; Provisional 95.08
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 94.8
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 92.12
PRK10416499 cell division protein FtsY; Provisional 90.96
COG3587 985 Restriction endonuclease [Defense mechanisms] 94.59
PRK03609422 umuC DNA polymerase V subunit UmuC; Reviewed 94.33
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 94.32
PRK08402357 replication factor A; Reviewed 93.81
TIGR02236333 recomb_radA DNA repair and recombination protein RadA; 91.62
pfam05970418 DUF889 PIF1 helicase. The PIF1 helicase inhibits telome 92.67
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 92.64
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 91.94
pfam1173192 Cdd1 Pathogenicity locus. Cdd1 is expressed as part of 91.81
COG3743133 Uncharacterized conserved protein [Function unknown] 91.21
pfam1039152 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda 90.36
smart00483334 POLXc DNA polymerase X family. includes vertebrate poly 91.18
KOG0952 1230 consensus 90.66
PTZ00205571 DNA polymerase kappa; Provisional 90.46
cd03769134 SR_IS607_transposase_like Serine Recombinase (SR) famil 90.16
cd00141307 NT_POLXc Nucleotidyltransferase (NT) domain of family X 90.14
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG; InterPro: IPR004609 The ATP-dependent DNA helicase RecG 3 Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor; InterPro: IPR004576 All proteins in this family for which functions are known are DNA-dependent ATPases that function in the process of transcription-coupled DNA repair in which the repair of the transcribed strand of actively transcribed genes is repaired at a higher rate than the repair of non-transcribed regions of the genome and than the non-transcribed strand of the same gene Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0334 consensus Back     alignment and domain information
>KOG0347 consensus Back     alignment and domain information
>KOG0947 consensus Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0385 consensus Back     alignment and domain information
>KOG0353 consensus Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB; InterPro: IPR010225 This entry represents HrpB, one of two related predicted DEAH-box ATP-dependent helicases of unknown function found in many proteobacteria, but also in a few species of other lineages Back     alignment and domain information
>KOG1123 consensus Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information