254780952

254780952

DNA helicase II

GeneID in NCBI database:8209974Locus tag:CLIBASIA_04255
Protein GI in NCBI database:254780952Protein Accession:YP_003065365.1
Gene range:-(947244, 949301)Protein Length:685aa
Gene description:DNA helicase II
COG prediction:[L] Superfamily I DNA and RNA helicases
KEGG prediction:DNA helicase II; K03657 DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.1.-]
SEED prediction:ATP-dependent DNA helicase UvrD/PcrA
Pathway involved in KEGG:Nucleotide excision repair [PATH:las03420]
Mismatch repair [PATH:las03430]
Subsystem involved in SEED:DNA repair, bacterial UvrD and related helicases
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-----
MQQDDQKSHFSHILKGDFVPSCVPNYLKGLNAQQTHAVTIPDDTPLLILAGAGTGKTTVLIARMLHLICHKEIPPSKILAMTFTNQAIQEMKNRLACYLGEKIPRIQTFHSFCASILRKHGEVVGLPTDFAILDSAESRTIIKQLLKDLQIDDKDYDPHEVIEKIDYWQNRGWNPKDIPQSSLTEDAEIPKAIYIQYVAYLQKTKSCDFGGLIIKTIEVLHHPHVLKKYHEKIPYIMVDEYQDINTPQYLLLRLLCQKEDSKQGARICCVGDENQCIYEWRGAQFSHILNFQKDFKDANIIKLEQNYRSTTHILNTANKLISHNKQRFDKKLFTQRDCHDDAKVSIHVSQSDNSELSTIIQEIINIQNTGMSLNNIAILVRTSWQTRKFEDAFLEQEIPHKVIGGSFYDRQEIRDALAYFRLVCQEHRDEDFKRIINCPKRGIGKESLHKIQYHASQHHISLLQASEKLIDSGQFRPQIRQSLQNFVKDIRRWNNCSKKMDPAPIANMILEQSGYMAMWKNNKSSEKSQERLDNLRELLSIIEKHETLEGFVLQAPLRENLGSFIPDSNCIQIMTLHAAKGLEFDTVFISGWEQGLLPHQLSINEGNVEGERRLAYVGITRAKKKCHLFYTINRRTHDFTRVERYQPSQVSQFLLELYDPSHTQEIIYDDIYGTFSEHWNQIPEP
ccccccccccccccccccccccHHHHHHHccHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHHHcccccHHHEEEEcccHHHHHHHHHHHHHHccccccEEEEHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHccccEEEEEccccccHHHHHHHHHHHcccccccccEEEEEEcccccccccccccHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHccHHcccccccccccccccccEEEEEcccHHHHHHHHHHHHHHHHHccccHHHEEEEEccHHHHHHHHHHHHHccccEEEEcccHHccHHHHHHHHHHHHHccccccHHHHHHHccccccccHHHHHHHHHHHHHccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccEEEEEHHHHccccccEEEEEcccccccccHHcccHHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccccccccccccHHHHccccHHHHHcccccccccccHHHHHcccc
ccEEccccHHHHHHHcccccccHHHHHHcccHHHHHHHHccccccEEEEEcccccHHHHHHHHHHHHHHcccccHHHEEEEEccHHHHHHHHHHHHHHHHccccEEccHHHHHHHHHHHHHHHcccccccEEEccHHHHHHHHHHHHHcccccccccHHHHHHHHcccccccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccEEEEEcHHHcccHHHccccHHHHHHHHHccccEEEEEcEcccccHHHHHHHHHHHcccccccccccEccccccccccEEEEEcccHHHHHHHHHHHHHHHHHccccccHEEEEEEccHHHHHHHHHHHHccccEEEEcccHHHcHHHHHHHHHHHHHHccccHHHHHHHcccccccccccccHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEHHHHccccEEEEEEcccEcEcccEccccccHHHHHHHHHHHHHHHHHHHHEEEEEHcHcEEcccccccccccccccHHHHHcccHHHHHHHHHHHccccccccccccccc
mqqddqkshfshilkgdfvpscvpnylkglnaqqthavtipddtpllilagagtgKTTVLIARMLHLIchkeippskilAMTFTNQAIQEMKNRLACylgekipriqTFHSFCASILRKhgevvglptdfailDSAESRTIIKQLLKDlqiddkdydphevIEKIDYwqnrgwnpkdipqssltedaeipkAIYIQYVAYLQktkscdfgglIIKTIEVLhhphvlkkyhekipyimvdeyqdintpQYLLLRLLCQkedskqgariccvgdenqciyeWRGAQFSHILNFqkdfkdaniIKLEQNYRSTTHILNTANKLISHNkqrfdkklftqrdchddakvsihvsqsdnsELSTIIQEIINIQNTGMSLNNIAILVRTSWQTRKFEDAFleqeiphkviggsfydrQEIRDALAYFRLVCQEHRDEDFKRIincpkrgigkesLHKIQYHASQHHISLLQASEklidsgqfrPQIRQSLQNFVKDIRRwnncskkmdpapiaNMILEQSGYMAMWknnkssekSQERLDNLRELLSIIEKHETLegfvlqaplrenlgsfipdsnciQIMTLHaakglefdtVFISGweqgllphqlsinegnvegeRRLAYVGITRAKKKCHLFYTinrrthdftrveryqpsqVSQFLLElydpshtqeiiyDDIYGtfsehwnqipep
mqqddqkshfshilkgdfVPSCVPNYLKGLNAQQTHAVTIPDDTPLLILAGAGTGKTTVLIARMLHLICHKEIPPSKILAMTFTNQAIQEMKNRLACYLGEKIPRIQTFHSFCASILRKHGEVVGLPTDFAILDSAESRTIIKQLLKdlqiddkdyDPHEVIEKidywqnrgwnPKDIPQSSLTEDAEIPKAIYIQYVAYLQKTKSCDFGGLIIKTIEVLHHPHVLKKYHEKIPYIMVDEYQDINTPQYLLLRLLCQKEDSKQGARICCVGDENQCIYEWRGAQFSHILNFQKDFKDANIIKLEQNYRSTTHILNTANKLISHNKQRFDKKLFTQRDCHDDAKVSihvsqsdnseLSTIIQEIINIQNTGMSLNNIAILVRTSWQTRKFEDAFLEQEIPHKVIGGSFYDRQEIRDALAYFRLVCQEHRDEDFKRIINCPKRGIGKESLHKIQYHASQHHISLLQASEKLIDSGQFRPQIRQSLQNFVKDIRRWnncskkmdpapIANMILEQSGYMAMWKNNKSSEKSQERLDNLRELLSIIEKHETLEGFVLQAPLRENLGSFIPDSNCIQIMTLHAAKGLEFDTVFISGWEQGLLPHQLSINEGNVEGERRLAYVGItrakkkchlfytinrrthdftrverYQPSQVSQFLLELYDPSHTQEIIYDDIYGTFSEHWNQIPEP
MQQDDQKSHFSHILKGDFVPSCVPNYLKGLNAQQTHAVTIPDDTPLLILAGAGTGKTTVLIARMLHLICHKEIPPSKILAMTFTNQAIQEMKNRLACYLGEKIPRIQTFHSFCASILRKHGEVVGLPTDFAILDSAESRTiikqllkdlqiddkdYDPHEVIEKIDYWQNRGWNPKDIPQSSLTEDAEIPKAIYIQYVAYLQKTKSCDFGGLIIKTIEVLHHPHVLKKYHEKIPYIMVDEYQDINTPQYLLLRLLCQKEDSKQGARICCVGDENQCIYEWRGAQFSHILNFQKDFKDANIIKLEQNYRSTTHILNTANKLISHNKQRFDKKLFTQRDCHDDAKVSIHVSQSDNSELStiiqeiiniqntGMSLNNIAILVRTSWQTRKFEDAFLEQEIPHKVIGGSFYDRQEIRDALAYFRLVCQEHRDEDFKRIINCPKRGIGKESLHKIQYHASQHHISLLQASEKLIDSGQFRPQIRQSLQNFVKDIRRWNNCSKKMDPAPIANMILEQSGYMAMWKNNKSSEKSQERLDNLRELLSIIEKHETLEGFVLQAPLRENLGSFIPDSNCIQIMTLHAAKGLEFDTVFISGWEQGLLPHQLSINEGNVEGERRLAYVGITRAKKKCHLFYTINRRTHDFTRVERYQPSQVSQFLLELYDPSHTQEIIYDDIYGTFSEHWNQIPEP
*********************CVPNYLKGLNAQQTHAVTIPDDTPLLILAGAGTGKTTVLIARMLHLICHKEIPPSKILAMTFTNQAIQEMKNRLACYLGEKIPRIQTFHSFCASILRKHGEVVGLPTDFAILDSAESRTIIKQLLKDLQIDDKDYDPHEVIEKIDYWQNRGWNPKDIPQSSLTEDAEIPKAIYIQYVAYLQKTKSCDFGGLIIKTIEVLHHPHVLKKYHEKIPYIMVDEYQDINTPQYLLLRLLCQKEDSKQGARICCVGDENQCIYEWRGAQFSHILNFQKDFKDANIIKLEQNYRSTTHILNTANKLISHNKQRFDKKLFTQRDCHDDAKVSIHVSQSDNSELSTIIQEIINIQNTGMSLNNIAILVRTSWQTRKFEDAFLEQEIPHKVIGGSFYDRQEIRDALAYFRLVCQEHRDEDFKRIINCPKRGIGKESLHKIQYHASQHHISLLQASEKLIDS**F**QIRQSLQNFVKDIRRWNNCSKKMDPAPIANMILEQSGYMAMW************LDNLRELLSIIEKHETLEGFVLQAPLRENLGSFIPDSNCIQIMTLHAAKGLEFDTVFISGWEQGLLP**********EG**RLAYVGITRAKKKCHLFYTINRRTHDFTRVERYQPSQVSQFLLELYDPSH***********************
*********FSHILKGDFVPSCVPNYLKGLNAQQTHAVTIPDDTPLLILAGAGTGKTTVLIARMLHLICHKEIPPSKILAMTFTNQAIQEMKNRLACYLGEKIPRIQTFHSFCASILRKHGEVVGLPTDFAILDSAESRTIIKQLLKDLQIDDKDYDPHEVIEKIDYWQNRGWNPKDIPQSSLTEDAEIPKAIYIQYVAYLQKTKSCDFGGLIIKTIEVLHHPHVLKKYHEKIPYIMVDEYQDINTPQYLLLRLLCQKEDSKQGARICCVGDENQCIYEWRGAQFSHILNFQKDFKDANIIKLEQNYRSTTHILNTANKLISHNKQRFDKKLFTQRDCHDDAKVSIHVSQSDNSELSTIIQEIINIQNTGMSLNNIAILVRTSWQTRKFEDAFLEQEIPHKVIGGSFYDRQEIRDALAYFRLVCQEHRDEDFKRIINCPKRGIGKESLHKIQYHASQHHISLLQASEKLIDSGQFRPQIRQSLQNFVKDIRRWNNCSKKMDPAPIANMILEQSGYMAMWKNN*********LDNLRELLSIIEKHETLEGFVLQAPLRENLGSFIPDSNCIQIMTLHAAKGLEFDTVFISGWEQGLLPHQLSINEGNVEGERRLAYVGITRAKKKCHLFYTINRRTHDFTRVERYQPSQVSQFLLELYDPSHTQEIIYDDIYGTFSEHWNQIPEP
MQQDDQKSHFSHILKGDFVPSCVPNYLKGLNAQQTHAVTIPDDTPLLILAGAGTGKTTVLIARMLHLICHKEIPPSKILAMTFTNQAIQEMKNRLACYLGEKIPRIQTFHSFCASILRKHGEVVGLPTDFAILDSAESRTIIKQLLKDLQIDDKDYDPHEVIEKIDYWQNRGWNPKDIPQSSLTEDAEIPKAIYIQYVAYLQKTKSCDFGGLIIKTIEVLHHPHVLKKYHEKIPYIMVDEYQDINTPQYLLLRLLCQKEDSKQGARICCVGDENQCIYEWRGAQFSHILNFQKDFKDANIIKLEQNYRSTTHILNTANKLISHNKQRFDKKLFTQRDCHDDAKVSIHVSQSDNSELSTIIQEIINIQNTGMSLNNIAILVRTSWQTRKFEDAFLEQEIPHKVIGGSFYDRQEIRDALAYFRLVCQEHRDEDFKRIINCPKRGIGKESLHKIQYHASQHHISLLQASEKLIDSGQFRPQIRQSLQNFVKDIRRWNNCSKKMDPAPIANMILEQSGYMAMWKNNKSSEKSQERLDNLRELLSIIEKHETLEGFVLQAPLRENLGSFIPDSNCIQIMTLHAAKGLEFDTVFISGWEQGLLPHQLSINEGNVEGERRLAYVGITRAKKKCHLFYTINRRTHDFTRVERYQPSQVSQFLLELYDPSHTQEIIYDDI**************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQQDDQKSHFSHILKGDFVPSCVPNYLKGLNAQQTHAVTIPDDTPLLILAGAGTGKTTVLIARMLHLICHKEIPPSKILAMTFTNQAIQEMKNRLACYLGEKIPRIQTFHSFCASILRKHGEVVGLPTDFAILDSAESRTIIKQLLKDLQIDDKDYDPHEVIEKIDYWQNRGWNPKDIPQSSLTEDAEIPKAIYIQYVAYLQKTKSCDFGGLIIKTIEVLHHPHVLKKYHEKIPYIMVDEYQDINTPQYLLLRLLCQKEDSKQGARICCVGDENQCIYEWRGAQFSHILNFQKDFKDANIIKLEQNYRSTTHILNTANKLISHNKQRFDKKLFTQRDCHDDAKVSIHVSQSDNSELSTIIQEIINIQNTGMSLNNIAILVRTSWQTRKFEDAFLEQEIPHKVIGGSFYDRQEIRDALAYFRLVCQEHRDEDFKRIINCPKRGIGKESLHKIQYHASQHHISLLQASEKLIDSGQFRPQIRQSLQNFVKDIRRWNNCSKKMDPAPIANMILEQSGYMAMWKNNKSxxxxxxxxxxxxxxxxxxxxxETLEGFVLQAPLRENLGSFIPDSNCIQIMTLHAAKGLEFDTVFISGWEQGLLPHQLSINEGNVEGERRLAYVGITRAKKKCHLFYTINRRTHDFTRVERYQPSQVSQFLLELYDPSHTQEIIYDDIYGTFSEHWNQIPEP
MQQDDQKSHFSHILKGDFVPSCVPNYLKGLNAQQTHAVTIPDDTPLLILAGAGTGKTTVLIARMLHLICHKEIPPSKILAMTFTNQAIQEMKNRLACYLGEKIPRIQTFHSFCASILRKHGEVVGLPTDFAILDSAESRTIIKQLLKDLQIDDKDYDPHEVIEKIDYWQNRGWNPKDIPQSSLTEDAEIPKAIYIQYVAYLQKTKSCDFGGLIIKTIEVLHHPHVLKKYHEKIPYIMVDEYQDINTPQYLLLRLLCQKEDSKQGARICCVGDENQCIYEWRGAQFSHILNFQKDFKDANIIKLEQNYRSTTHILNTANKLISHNKQRFDKKLFTQRDCHDDAKVSIHVSQSDNSELSTIIQEIINIQNTGMSLNNIAILVRTSWQTRKFEDAFLEQEIPHKVIGGSFYDRQEIRDALAYFRLVCQEHRDEDFKRIINCPKRGIGKESLHKIQYHASQHHISLLQASEKLIDSGQFRPQIRQSLQNFVKDIRRWNNCSKKMDPAPIANMILEQSGYMAMWKNNKSSEKSQERLDNLRELLSIIEKHETLEGFVLQAPLRENLGSFIPDSNCIQIMTLHAAKGLEFDTVFISGWEQGLLPHQLSINEGNVEGERRLAYVGITRAKKKCHLFYTINRRTHDFTRVERYQPSQVSQFLLELYDPSHTQEIIYDDIYGTFSEHWNQIPEP
MQQDDQKSHFSHILKGDFVPSCVPNYLKGLNAQQTHAVTIPDDTPLLILAGAGTGKTTVLIARMLHLICHKEIPPSKILAMTFTNQAIQEMKNRLACYLGEKIPRIQTFHSFCASILRKHGEVVGLPTDFAILDSAESRTIIKQLLKDLQIDDKDYDPHEVIEKIDYWQNRGWNPKDIPQSSLTEDAEIPKAIYIQYVAYLQKTKSCDFGGLIIKTIEVLHHPHVLKKYHEKIPYIMVDEYQDINTPQYLLLRLLCQKEDSKQGARICCVGDENQCIYEWRGAQFSHILNFQKDFKDANIIKLEQNYRSTTHILNTANKLISHNKQRFDKKLFTQRDCHDDAKVSIHVSQSDNSELSTIIQEIINIQNTGMSLNNIAILVRTSWQTRKFEDAFLEQEIPHKVIGGSFYDRQEIRDALAYFRLVCQEHRDEDFKRIINCPKRGIGKESLHKIQYHASQHHISLLQASEKLIDSGQFRPQIRQSLQNFVKDIRRWNNCSKKMDPAPIANMILEQSGYMAMWKNNKSSEKSQERLDNLRELLSIIEKHETLEGFVLQAPLRENLGSFIPDSNCIQIMTLHAAKGLEFDTVFISGWEQGLLPHQLSINEGNVEGERRLAYVGITRAKKKCHLFYTINRRTHDFTRVERYQPSQVSQFLLELYDPSHTQEIIYDDIYGTFSEHWNQIPEP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target685 DNA helicase II [Candidatus Liberibacter asiaticus str.
315122506681 DNA helicase II [Candidatus Liberibacter solanacearum C 1 0.0
325293426 824 DNA helicase II [Agrobacterium sp. H13-3] Length = 824 1 1e-160
209550144 825 UvrD/REP helicase [Rhizobium leguminosarum bv. trifolii 1 1e-159
159185029 824 DNA helicase II [Agrobacterium tumefaciens str. C58] Le 1 1e-159
86358422 808 DNA helicase II protein [Rhizobium etli CFN 42] Length 1 1e-159
116253019 829 ATP-dependent DNA helicase [Rhizobium leguminosarum bv. 1 1e-159
241205526 826 UvrD/REP helicase [Rhizobium leguminosarum bv. trifolii 1 1e-159
190892554 832 ATP-dependent DNA helicase II protein [Rhizobium etli C 1 1e-159
222149095 858 DNA helicase II [Agrobacterium vitis S4] Length = 858 1 1e-158
222086413 828 DNA helicase II protein [Agrobacterium radiobacter K84] 1 1e-157
>gi|315122506|ref|YP_004062995.1| DNA helicase II [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 681 Back     alignment and organism information
 Score = 1052 bits (2721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/676 (73%), Positives = 588/676 (86%), Gaps = 3/676 (0%)

Query: 1   MQQDDQKSHFSHILKGDFVPSCVPNYLKGLNAQQTHAVTIPDDTPLLILAGAGTGKTTVL 60
           +QQDD+KS+F +I   + + S   NYL+GLN QQ HA+T  D  PLLILAGAGTGKTTVL
Sbjct: 7   VQQDDKKSYFLNISPANIIDS--HNYLEGLNPQQVHAITFTDKYPLLILAGAGTGKTTVL 64

Query: 61  IARMLHLICHKEIPPSKILAMTFTNQAIQEMKNRLACYLGEKIPRIQTFHSFCASILRKH 120
           IARMLHLI  K+IP SKILAMTFTNQAIQEMKNRLAC  G  IP+IQTFHSF ASILR+H
Sbjct: 65  IARMLHLIYQKKIPASKILAMTFTNQAIQEMKNRLACLSGH-IPQIQTFHSFSASILRQH 123

Query: 121 GEVVGLPTDFAILDSAESRTIIKQLLKDLQIDDKDYDPHEVIEKIDYWQNRGWNPKDIPQ 180
           G VVGLPTDF ILDS +SRTIIK++LK  +ID+K +  ++V +KIDYWQN GWNP++IP+
Sbjct: 124 GNVVGLPTDFTILDSGDSRTIIKEILKKNKIDEKKWSIYQVTDKIDYWQNHGWNPENIPE 183

Query: 181 SSLTEDAEIPKAIYIQYVAYLQKTKSCDFGGLIIKTIEVLHHPHVLKKYHEKIPYIMVDE 240
           SSL+ED  IPK IYI YV +LQKTKSCDFGGLI+K IE LHHPH+LK YH+K+ YIMVDE
Sbjct: 184 SSLSEDEIIPKEIYIDYVDHLQKTKSCDFGGLILKAIEALHHPHILKYYHQKLSYIMVDE 243

Query: 241 YQDINTPQYLLLRLLCQKEDSKQGARICCVGDENQCIYEWRGAQFSHILNFQKDFKDANI 300
           YQDINT QYLLLRLLCQKED +  A ICCVGDE+QCIYEWRGAQFSHI+NFQKDFK+A+I
Sbjct: 244 YQDINTAQYLLLRLLCQKEDKQDNASICCVGDEDQCIYEWRGAQFSHIINFQKDFKEASI 303

Query: 301 IKLEQNYRSTTHILNTANKLISHNKQRFDKKLFTQRDCHDDAKVSIHVSQSDNSELSTII 360
           IKLEQNYRST+HILNTANKLI+HNKQRF+K LFT+R C DD+KV+IHVSQ+D SELSTII
Sbjct: 304 IKLEQNYRSTSHILNTANKLIAHNKQRFNKNLFTKRHCPDDSKVTIHVSQNDTSELSTII 363

Query: 361 QEIINIQNTGMSLNNIAILVRTSWQTRKFEDAFLEQEIPHKVIGGSFYDRQEIRDALAYF 420
            EI  IQNTGMSLNNIAILVRT+WQTRKFEDAF+E++IP+KVIGGSFYDRQEIRD+ AYF
Sbjct: 364 TEIRKIQNTGMSLNNIAILVRTAWQTRKFEDAFIEEKIPYKVIGGSFYDRQEIRDSFAYF 423

Query: 421 RLVCQEHRDEDFKRIINCPKRGIGKESLHKIQYHASQHHISLLQASEKLIDSGQFRPQIR 480
           RL+CQ + ++DFKRIIN PKRGIGKES  KIQ HA+Q  ISLL+ASE+LI + +FRPQIR
Sbjct: 424 RLICQGNNEQDFKRIINLPKRGIGKESFRKIQNHAAQRQISLLEASEELIKNNEFRPQIR 483

Query: 481 QSLQNFVKDIRRWNNCSKKMDPAPIANMILEQSGYMAMWKNNKSSEKSQERLDNLRELLS 540
           +SL  FV +IRRWN+ + + +P  +A MILE+SGY+AMWKN+KSSEKSQERL+N++EL+S
Sbjct: 484 KSLHTFVNEIRRWNSLTNQTNPMHLAQMILEESGYIAMWKNDKSSEKSQERLENIKELIS 543

Query: 541 IIEKHETLEGFVLQAPLRENLGSFIPDSNCIQIMTLHAAKGLEFDTVFISGWEQGLLPHQ 600
            IE++ETL  ++LQAPLRE +G  + + N +QIMTLHAAKGLEFDTVFI GWEQGLLPHQ
Sbjct: 544 KIEQYETLPSYILQAPLREGVGPSVINPNYLQIMTLHAAKGLEFDTVFIPGWEQGLLPHQ 603

Query: 601 LSINEGNVEGERRLAYVGITRAKKKCHLFYTINRRTHDFTRVERYQPSQVSQFLLELYDP 660
           LS+NEG++EGERRLAY+GITRAK  CHLFYTINRRTHDFTR ERYQPS+VSQFL+E+YDP
Sbjct: 604 LSLNEGDLEGERRLAYMGITRAKNNCHLFYTINRRTHDFTRTERYQPSEVSQFLIEIYDP 663

Query: 661 SHTQEIIYDDIYGTFS 676
           SH QEII+D+IYG+FS
Sbjct: 664 SHVQEIIHDNIYGSFS 679


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325293426|ref|YP_004279290.1| DNA helicase II [Agrobacterium sp. H13-3] Length = 824 Back     alignment and organism information
>gi|209550144|ref|YP_002282061.1| UvrD/REP helicase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 825 Back     alignment and organism information
>gi|159185029|ref|NP_355024.2| DNA helicase II [Agrobacterium tumefaciens str. C58] Length = 824 Back     alignment and organism information
>gi|86358422|ref|YP_470314.1| DNA helicase II protein [Rhizobium etli CFN 42] Length = 808 Back     alignment and organism information
>gi|116253019|ref|YP_768857.1| ATP-dependent DNA helicase [Rhizobium leguminosarum bv. viciae 3841] Length = 829 Back     alignment and organism information
>gi|241205526|ref|YP_002976622.1| UvrD/REP helicase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 826 Back     alignment and organism information
>gi|190892554|ref|YP_001979096.1| ATP-dependent DNA helicase II protein [Rhizobium etli CIAT 652] Length = 832 Back     alignment and organism information
>gi|222149095|ref|YP_002550052.1| DNA helicase II [Agrobacterium vitis S4] Length = 858 Back     alignment and organism information
>gi|222086413|ref|YP_002544947.1| DNA helicase II protein [Agrobacterium radiobacter K84] Length = 828 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target685 DNA helicase II [Candidatus Liberibacter asiaticus str.
TIGR01073726 TIGR01073, pcrA, ATP-dependent DNA helicase PcrA 1e-153
PRK11773721 PRK11773, uvrD, DNA-dependent helicase II; Provisional 1e-136
TIGR01074664 TIGR01074, rep, ATP-dependent DNA helicase Rep 1e-126
TIGR01075715 TIGR01075, uvrD, DNA helicase II 1e-125
PRK10919672 PRK10919, PRK10919, ATP-dependent DNA helicase Rep; Pro 1e-103
TIGR00609 1087 TIGR00609, recB, exodeoxyribonuclease V, beta subunit 3e-20
COG0210655 COG0210, UvrD, Superfamily I DNA and RNA helicases [DNA 1e-142
pfam00580494 pfam00580, UvrD-helicase, UvrD/REP helicase 1e-109
COG1074 1139 COG1074, RecB, ATP-dependent exoDNAse (exonuclease V) b 6e-35
KOG2108 853 KOG2108, KOG2108, KOG2108, 3'-5' DNA helicase [Replicat 1e-34
TIGR02785 1232 TIGR02785, addA_Gpos, recombination helicase AddA, Firm 2e-17
PRK11054684 PRK11054, helD, DNA helicase IV; Provisional 2e-14
TIGR02785 1232 TIGR02785, addA_Gpos, recombination helicase AddA, Firm 1e-13
TIGR02784 1141 TIGR02784, addA_alphas, double-strand break repair heli 9e-11
COG1074 1139 COG1074, RecB, ATP-dependent exoDNAse (exonuclease V) b 3e-14
PRK13909 910 PRK13909, PRK13909, putative recombination protein RecB 9e-09
KOG1803649 KOG1803, KOG1803, KOG1803, DNA helicase [Replication, r 5e-04
PRK11054684 PRK11054, helD, DNA helicase IV; Provisional 1e-10
TIGR02784 1141 TIGR02784, addA_alphas, double-strand break repair heli 4e-09
PRK10876 1181 PRK10876, recB, exonuclease V subunit beta; Provisional 7e-04
PRK13909 910 PRK13909, PRK13909, putative recombination protein RecB 4e-08
PRK11054684 PRK11054, helD, DNA helicase IV; Provisional 9e-07
>gnl|CDD|162191 TIGR01073, pcrA, ATP-dependent DNA helicase PcrA Back     alignment and domain information
>gnl|CDD|183307 PRK11773, uvrD, DNA-dependent helicase II; Provisional Back     alignment and domain information
>gnl|CDD|130146 TIGR01074, rep, ATP-dependent DNA helicase Rep Back     alignment and domain information
>gnl|CDD|130147 TIGR01075, uvrD, DNA helicase II Back     alignment and domain information
>gnl|CDD|182838 PRK10919, PRK10919, ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>gnl|CDD|161956 TIGR00609, recB, exodeoxyribonuclease V, beta subunit Back     alignment and domain information
>gnl|CDD|30559 COG0210, UvrD, Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|144246 pfam00580, UvrD-helicase, UvrD/REP helicase Back     alignment and domain information
>gnl|CDD|31272 COG1074, RecB, ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|37319 KOG2108, KOG2108, KOG2108, 3'-5' DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|163019 TIGR02785, addA_Gpos, recombination helicase AddA, Firmicutes type Back     alignment and domain information
>gnl|CDD|182930 PRK11054, helD, DNA helicase IV; Provisional Back     alignment and domain information
>gnl|CDD|163019 TIGR02785, addA_Gpos, recombination helicase AddA, Firmicutes type Back     alignment and domain information
>gnl|CDD|163018 TIGR02784, addA_alphas, double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>gnl|CDD|31272 COG1074, RecB, ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|184388 PRK13909, PRK13909, putative recombination protein RecB; Provisional Back     alignment and domain information
>gnl|CDD|37014 KOG1803, KOG1803, KOG1803, DNA helicase [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|182930 PRK11054, helD, DNA helicase IV; Provisional Back     alignment and domain information
>gnl|CDD|163018 TIGR02784, addA_alphas, double-strand break repair helicase AddA, alphaproteobacterial type Back     alignment and domain information
>gnl|CDD|182801 PRK10876, recB, exonuclease V subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|184388 PRK13909, PRK13909, putative recombination protein RecB; Provisional Back     alignment and domain information
>gnl|CDD|182930 PRK11054, helD, DNA helicase IV; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 685 DNA helicase II [Candidatus Liberibacter asiaticus str.
TIGR01073811 pcrA ATP-dependent DNA helicase PcrA; InterPro: IPR0057 100.0
TIGR01074677 rep ATP-dependent DNA helicase Rep; InterPro: IPR005752 100.0
TIGR01075741 uvrD DNA helicase II; InterPro: IPR005753 The SOS respo 100.0
PRK11773722 uvrD DNA-dependent helicase II; Provisional 100.0
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 100.0
COG0210655 UvrD Superfamily I DNA and RNA helicases [DNA replicati 100.0
COG1074 1139 RecB ATP-dependent exoDNAse (exonuclease V) beta subuni 100.0
TIGR02773 1192 addB_Gpos ATP-dependent nuclease subunit B; InterPro: I 100.0
TIGR02785 1295 addA_Gpos recombination helicase AddA; InterPro: IPR014 100.0
TIGR02784 1190 addA_alphas double-strand break repair helicase AddA; I 100.0
PRK13909 911 putative recombination protein RecB; Provisional 100.0
PRK10876 1181 recB exonuclease V subunit beta; Provisional 100.0
TIGR00609 1324 recB exodeoxyribonuclease V, beta subunit; InterPro: IP 100.0
COG3857 1108 AddB ATP-dependent nuclease, subunit B [DNA replication 99.96
pfam00580494 UvrD-helicase UvrD/REP helicase. The Rep family helicas 100.0
PRK11054684 helD DNA helicase IV; Provisional 100.0
COG3972660 Superfamily I DNA and RNA helicases [General function p 99.84
KOG1803649 consensus 99.78
TIGR01448769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 99.75
KOG18051100 consensus 99.7
KOG2108 853 consensus 100.0
COG3973747 Superfamily I DNA and RNA helicases [General function p 99.96
KOG1802935 consensus 99.4
TIGR03623 874 probable DNA repair protein. Members of this protein fa 99.84
TIGR02774 1116 rexB_recomb ATP-dependent nuclease subunit B; InterPro: 99.23
PRK10875607 recD exonuclease V subunit alpha; Provisional 99.8
TIGR01447753 recD exodeoxyribonuclease V, alpha subunit; InterPro: I 99.71
KOG18071025 consensus 99.06
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 98.69
PRK10536262 hypothetical protein; Provisional 98.44
COG0507696 RecD ATP-dependent exoDNAse (exonuclease V), alpha subu 98.35
TIGR00376709 TIGR00376 DNA helicase, putative; InterPro: IPR004483 E 98.15
PRK138261102 Dtr system oriT relaxase; Provisional 98.06
PRK13709 1756 conjugal transfer nickase/helicase TraI; Provisional 97.71
PRK05580699 primosome assembly protein PriA; Validated 97.6
pfam00270167 DEAD DEAD/DEAH box helicase. Members of this family inc 97.56
COG1201 814 Lhr Lhr-like helicases [General function prediction onl 97.55
smart00487201 DEXDc DEAD-like helicases superfamily. 97.5
pfam04851103 ResIII Type III restriction enzyme, res subunit. 97.35
PRK02362736 ski2-like helicase; Provisional 97.31
PRK08074932 bifunctional ATP-dependent DNA helicase/DNA polymerase 97.23
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 97.17
COG1205 851 Distinct helicase family with a unique C-terminal domai 97.11
COG1198730 PriA Primosomal protein N' (replication factor Y) - sup 97.09
PRK13767 878 ATP-dependent helicase; Provisional 96.97
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 96.93
cd00268203 DEADc DEAD-box helicases. A diverse family of proteins 96.9
COG1204766 Superfamily II helicase [General function prediction on 96.82
PRK13889992 conjugal transfer relaxase TraA; Provisional 96.77
PRK09694878 hypothetical protein; Provisional 96.74
TIGR01970 858 DEAH_box_HrpB ATP-dependent helicase HrpB; InterPro: IP 96.63
PRK13766764 Hef nuclease; Provisional 96.63
PRK10590457 ATP-dependent RNA helicase RhlE; Provisional 96.61
PRK01297472 ATP-dependent RNA helicase RhlB; Provisional 96.57
PRK11192417 ATP-dependent RNA helicase SrmB; Provisional 96.57
KOG0952 1230 consensus 96.55
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 96.54
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Transcript 96.5
smart00488289 DEXDc2 DEAD-like helicases superfamily. 96.44
smart00489289 DEXDc3 DEAD-like helicases superfamily. 96.44
PRK114481126 hsdR type I restriction enzyme EcoKI subunit R; Provisi 96.44
PRK00254717 ski2-like helicase; Provisional 96.42
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 96.19
KOG0926 1172 consensus 96.16
COG4098441 comFA Superfamily II DNA/RNA helicase required for DNA 96.13
COG2256436 MGS1 ATPase related to the helicase subunit of the Holl 96.02
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 95.9
PRK11131 1295 ATP-dependent RNA helicase HrpA; Provisional 95.89
PRK01172674 ski2-like helicase; Provisional 95.81
PRK11776459 ATP-dependent RNA helicase DbpA; Provisional 95.79
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 95.72
KOG0330476 consensus 95.6
PTZ00110602 helicase; Provisional 95.58
pfam06745231 KaiC KaiC. This family represents a conserved region wi 95.55
COG1199654 DinG Rad3-related DNA helicases [Transcription / DNA re 95.43
PRK04537574 ATP-dependent RNA helicase RhlB; Provisional 95.35
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. subt 95.3
pfam02399 829 Herpes_ori_bp Origin of replication binding protein. Th 95.3
PRK09302501 circadian clock protein KaiC; Reviewed 95.21
pfam10412386 TrwB_AAD_bind Type IV secretion-system coupling protein 95.1
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 95.08
pfam05876552 Terminase_GpA Phage terminase large subunit (GpA). This 95.06
PRK13341726 recombination factor protein RarA/unknown domain fusion 94.97
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 94.94
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA replicat 94.91
PRK06067241 flagellar accessory protein FlaH; Validated 94.88
TIGR02760 2193 TraI_TIGR conjugative transfer relaxase protein TraI; I 94.74
PRK04328250 hypothetical protein; Provisional 94.72
KOG0951 1674 consensus 94.67
KOG0920924 consensus 94.47
COG0714329 MoxR-like ATPases [General function prediction only] 94.28
PRK06696227 uridine kinase; Validated 94.21
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 94.17
PRK08084235 DNA replication initiation factor; Provisional 94.17
KOG0354746 consensus 94.1
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polymerase 94.05
KOG0345567 consensus 93.86
PRK08533230 flagellar accessory protein FlaH; Reviewed 93.83
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 93.65
COG0529197 CysC Adenylylsulfate kinase and related kinases [Inorga 93.61
TIGR01967 1320 DEAH_box_HrpA ATP-dependent helicase HrpA; InterPro: IP 93.43
TIGR02881261 spore_V_K stage V sporulation protein K; InterPro: IPR0 93.43
PRK09401 1176 reverse gyrase; Reviewed 93.25
COG4581 1041 Superfamily II RNA helicase [DNA replication, recombina 93.24
TIGR01241505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 93.23
KOG0340442 consensus 93.13
PRK13342417 recombination factor protein RarA; Reviewed 92.98
KOG0343758 consensus 92.91
KOG0922674 consensus 92.57
PRK07667190 uridine kinase; Provisional 92.41
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 92.12
pfam01580202 FtsK_SpoIIIE FtsK/SpoIIIE family. FtsK has extensive se 91.97
KOG0923902 consensus 91.85
PRK00300208 gmk guanylate kinase; Provisional 91.75
pfam05872504 DUF853 Bacterial protein of unknown function (DUF853). 91.74
TIGR00073225 hypB hydrogenase accessory protein HypB; InterPro: IPR0 91.73
KOG1131755 consensus 91.67
PRK13705388 plasmid-partitioning protein SopA; Provisional 91.6
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4. 91.48
pfam02534468 TraG TraG/TraD family. These proteins contain a P-loop 91.02
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanisms] 90.91
TIGR02880284 cbbX_cfxQ CbbX protein; InterPro: IPR000470 Proteins in 90.85
KOG0342543 consensus 90.51
TIGR03453387 partition_RepA plasmid partitioning protein RepA. Membe 90.49
pfam01935218 DUF87 Domain of unknown function DUF87. The function of 90.4
KOG4284 980 consensus 90.06
KOG2108853 consensus 99.74
COG1112767 Superfamily I DNA and RNA helicases and helicase subuni 97.42
pfam04257 1008 Exonuc_V_gamma Exodeoxyribonuclease V, gamma subunit. T 99.54
PRK11069 1122 recC exonuclease V subunit gamma; Provisional 99.53
COG1330 1078 RecC Exonuclease V gamma subunit [DNA replication, reco 99.3
COG3893697 Inactivated superfamily I helicase [DNA replication, re 98.59
PRK13889 992 conjugal transfer relaxase TraA; Provisional 98.16
TIGR02768888 TraA_Ti Ti-type conjugative transfer relaxase TraA; Int 97.04
PRK13826 1102 Dtr system oriT relaxase; Provisional 97.0
pfam01443226 Viral_helicase1 Viral (Superfamily 1) RNA helicase. Hel 96.97
KOG1803649 consensus 95.88
KOG18051100 consensus 95.41
pfam05970418 DUF889 PIF1 helicase. The PIF1 helicase inhibits telome 95.24
COG0507696 RecD ATP-dependent exoDNAse (exonuclease V), alpha subu 93.96
COG1875436 NYN ribonuclease and ATPase of PhoH family domains [Gen 93.87
pfam09848348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 93.1
COG1112767 Superfamily I DNA and RNA helicases and helicase subuni 92.58
TIGR02786 1096 addB_alphas double-strand break repair protein AddB; In 98.04
pfam09848348 DUF2075 Uncharacterized conserved protein (DUF2075). Th 97.46
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 97.13
COG1702348 PhoH Phosphate starvation-inducible protein PhoH, predi 96.73
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 96.07
PRK00149447 dnaA chromosomal replication initiation protein; Review 94.29
PRK02496185 adk adenylate kinase; Provisional 93.51
PRK06835330 DNA replication protein DnaC; Validated 93.26
PRK12422455 chromosomal replication initiation protein; Provisional 92.21
pfam01443226 Viral_helicase1 Viral (Superfamily 1) RNA helicase. Hel 90.98
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombinatio 97.09
COG4096875 HsdR Type I site-specific restriction-modification syst 96.49
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 95.5
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 92.62
KOG0925699 consensus 92.14
pfam02689 801 Herpes_Helicase Helicase. This family consists of Helic 90.82
TIGR02768888 TraA_Ti Ti-type conjugative transfer relaxase TraA; Int 97.03
PRK10436461 hypothetical protein; Provisional 96.13
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 96.12
cd03115173 SRP The signal recognition particle (SRP) mediates the 96.07
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 95.88
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 95.82
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 95.68
cd01124187 KaiC KaiC is a circadian clock protein primarily found 95.53
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 95.48
PRK13407334 bchI magnesium chelatase subunit I; Provisional 95.46
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 95.25
PRK12377248 putative replication protein; Provisional 95.18
PRK03846198 adenylylsulfate kinase; Provisional 95.09
PRK06921265 hypothetical protein; Provisional 94.97
TIGR02538577 type_IV_pilB type IV-A pilus assembly ATPase PilB; Inte 94.85
pfam03266168 DUF265 Protein of unknown function, DUF265. 94.53
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 94.46
cd01126384 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial con 94.43
PRK13768253 GTPase; Provisional 94.34
PRK07952242 DNA replication protein DnaC; Validated 94.32
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 94.32
cd01127410 TrwB Bacterial conjugation protein TrwB, ATP binding do 94.31
CHL00181287 cbbX CbbX; Provisional 94.3
pfam01078207 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesi 94.08
PRK09270230 frcK putative fructose transport system kinase; Reviewe 94.04
COG1484254 DnaC DNA replication protein [DNA replication, recombin 94.04
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 94.0
smart00382148 AAA ATPases associated with a variety of cellular activ 93.86
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 93.83
PRK13695174 putative NTPase; Provisional 93.81
pfam03215490 Rad17 Rad17 cell cycle checkpoint protein. 93.77
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 93.72
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 93.51
PRK08116262 hypothetical protein; Validated 93.28
COG5635824 Predicted NTPase (NACHT family) [Signal transduction me 93.07
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 92.91
pfam02492174 cobW CobW/HypB/UreG, nucleotide-binding domain. This do 92.71
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 92.65
PRK09183258 transposase/IS protein; Provisional 92.58
PTZ00301210 uridine kinase; Provisional 92.47
pfam07726131 AAA_3 ATPase family associated with various cellular ac 92.22
pfam00004131 AAA ATPase family associated with various cellular acti 92.21
CHL00081347 chlI Mg-protoporyphyrin IX chelatase 92.13
) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) . The MobB domain is similar to that of the urease accessory protein UreG and the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocentres of their respective target enzymes. It is involved in the final step of molybdenum-cofactor biosynthesis. While its precise function has not been identified it is thought to be involved in the transfer of a guanine dinucleotide moiety to molybdopterin, as it shows GTP-binding and weak GTPase activity . The MobB protein (P32125 from SWISSPROT) from Escherichia coli, which is comprised of this domain, is a homodimer . Each molecule is composed of two distinct regions - an outer region comprised of 6 beta-strands and three alpha helices, and an inner region comprised of a two-strand beta hairpin followed by an alpha helix. These regions require interaction with the second monomer to allow proper folding to occur. The two monomers are intertwined and form an extensive 16-stranded beta-sheet. While the active site could not be positively identified, the presence of highly conserved residues suggests the substrate binding site occurs in the central solvent channel.; GO: 0005525 GTP binding, 0006777 Mo-molybdopterin cofactor biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00176">TIGR00176165 mobB molybdopterin-guanine dinucleotide biosynthesis pr 92.13
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 92.08
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transport an 92.01
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 91.9
PRK06526254 transposase; Provisional 91.86
PRK04841 903 transcriptional regulator MalT; Provisional 91.66
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversible pho 91.57
PRK05201442 hslU ATP-dependent protease ATP-binding subunit; Provis 91.56
cd03114148 ArgK-like The function of this protein family is unkown 91.29
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 91.08
TIGR01082491 murC UDP-N-acetylmuramate--alanine ligase; InterPro: IP 91.08
COG4088261 Predicted nucleotide kinase [Nucleotide transport and m 90.9
cd01128249 rho_factor Transcription termination factor rho is a ba 90.88
TIGR00929 931 VirB4_CagE type IV secretion/conjugal transfer ATPase, 90.78
PRK00279215 adk adenylate kinase; Reviewed 90.72
PRK04040189 adenylate kinase; Provisional 90.66
cd01133274 F1-ATPase_beta F1 ATP synthase beta subunit, nucleotide 90.52
PRK13869405 plasmid-partitioning protein RepA; Provisional 90.41
PRK06761281 hypothetical protein; Provisional 90.26
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 90.25
PRK05480209 uridine kinase; Provisional 90.22
TIGR01450 1207 recC exodeoxyribonuclease V, gamma subunit; InterPro: I 96.9
KOG18061320 consensus 96.87
CHL00176631 ftsH cell division protein; Validated 94.08
PRK05748448 replicative DNA helicase; Provisional 93.55
PRK08694468 consensus 92.75
PRK08006471 replicative DNA helicase; Provisional 92.67
PRK06904472 replicative DNA helicase; Validated 92.24
PRK08082453 consensus 92.21
PRK08760476 replicative DNA helicase; Provisional 92.11
PRK07263453 consensus 91.77
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 91.37
PRK05636507 replicative DNA helicase; Provisional 90.39
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse family 96.86
pfam05970418 DUF889 PIF1 helicase. The PIF1 helicase inhibits telome 96.51
KOG1804775 consensus 95.44
PRK07261171 topology modulation protein; Provisional 94.94
TIGR01587424 cas3_core CRISPR-associated helicase Cas3; InterPro: IP 94.92
pfam07652146 Flavi_DEAD Flavivirus DEAD domain. 94.78
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 94.45
PRK08118167 topology modulation protein; Reviewed 94.4
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 94.33
PRK10463290 hydrogenase nickel incorporation protein HypB; Provisio 94.27
PRK01184183 hypothetical protein; Provisional 93.81
PRK00771433 signal recognition particle protein Srp54; Provisional 93.51
PRK10867453 signal recognition particle protein; Provisional 92.58
PRK10865857 protein disaggregation chaperone; Provisional 92.57
pfam03237380 Terminase_6 Terminase-like family. This family represen 92.48
pfam04466387 Terminase_3 Phage terminase large subunit. Initiation o 92.3
CHL00095823 clpC Clp protease ATP binding subunit 92.04
KOG09241042 consensus 91.44
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 91.39
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 91.09
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 90.79
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 96.77
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.53
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.47
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 96.01
PRK09302501 circadian clock protein KaiC; Reviewed 94.64
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 94.13
COG0606490 Predicted ATPase with chaperone activity [Posttranslati 93.99
PRK09862506 putative ATP-dependent protease; Provisional 93.3
PTZ00112650 origin recognition complex 1 protein; Provisional 92.14
PRK00411394 cdc6 cell division control protein 6; Reviewed 96.69
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 95.82
COG2805353 PilT Tfp pilus assembly protein, pilus retraction ATPas 95.41
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 93.76
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 93.28
KOG0991333 consensus 92.91
PRK04195403 replication factor C large subunit; Provisional 92.9
PRK00440318 rfc replication factor C small subunit; Reviewed 91.57
TIGR00602670 rad24 checkpoint protein rad24; InterPro: IPR004582 To 91.54
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 91.37
PRK12898673 secA preprotein translocase subunit SecA; Reviewed 96.47
KOG0738491 consensus 95.88
CHL00122 891 secA preprotein translocase subunit SecA; Validated 95.43
PRK12904833 preprotein translocase subunit SecA; Reviewed 95.0
KOG0731 774 consensus 94.72
PRK05298657 excinuclease ABC subunit B; Provisional 94.23
PRK05595444 replicative DNA helicase; Provisional 93.76
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 93.59
TIGR00643721 recG ATP-dependent DNA helicase RecG; InterPro: IPR0046 93.49
PRK09200799 preprotein translocase subunit SecA; Reviewed 93.08
PRK08506473 replicative DNA helicase; Provisional 92.26
PRK07004460 replicative DNA helicase; Provisional 91.77
PRK06749428 replicative DNA helicase; Provisional 90.87
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 96.09
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intracell 93.97
TIGR00368505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 95.58
PRK13833323 conjugal transfer protein TrbB; Provisional 95.56
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 95.11
TIGR00955671 3a01204 Pigment precourser permease; InterPro: IPR00528 94.4
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 94.24
PRK05506613 bifunctional sulfate adenylyltransferase subunit 1/aden 93.56
PRK08840464 replicative DNA helicase; Provisional 93.34
TIGR00631667 uvrb excinuclease ABC, B subunit; InterPro: IPR004807 A 93.33
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 92.69
PRK08181269 transposase; Validated 91.75
PRK06321472 replicative DNA helicase; Provisional 91.43
COG1875436 NYN ribonuclease and ATPase of PhoH family domains [Gen 91.2
PRK12608379 transcription termination factor Rho; Provisional 91.53
PRK13853789 type IV secretion system protein VirB4; Provisional 91.14
PRK05342411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 91.1
PRK13764605 ATPase; Provisional 90.95
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA; InterPro: IPR005751 The DNA helicase PcrA is found mainly in Gram-positive bacteria and belongs to a superfamily of helicases, together with Rep and UvrD helicases from Escherichia coli Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep; InterPro: IPR005752 RepA hexameric DNA helicase contain ATP-binding domains similar to those seen in monomeric helicases but which are arranged in a ring Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II; InterPro: IPR005753 The SOS response is required for efficient nucleotide excision repair (NER) of the major ultraviolet light (UV) induced DNA lesions Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02773 addB_Gpos ATP-dependent nuclease subunit B; InterPro: IPR014140 DNA repair is accomplished by several different systems in prokaryotes Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA; InterPro: IPR014152 AddAB, also called RexAB, substitutes for RecBCD in several bacterial lineages Back     alignment and domain information
>TIGR02784 addA_alphas double-strand break repair helicase AddA; InterPro: IPR014151 AddAB, also called RexAB, substitutes for RecBCD in several bacterial lineages Back     alignment and domain information
>PRK13909 putative recombination protein RecB; Provisional Back     alignment and domain information
>PRK10876 recB exonuclease V subunit beta; Provisional Back     alignment and domain information
>TIGR00609 recB exodeoxyribonuclease V, beta subunit; InterPro: IPR004586 Exodeoxyribonuclease V, or RecBCD holoenzyme, (3 Back     alignment and domain information
>COG3857 AddB ATP-dependent nuclease, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam00580 UvrD-helicase UvrD/REP helicase Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>COG3972 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>KOG1803 consensus Back     alignment and domain information
>TIGR01448 recD_rel helicase, RecD/TraA family; InterPro: IPR006345 These sequences represent a family similar to RecD, the exodeoxyribonuclease V alpha chain of IPR006344 from INTERPRO Back     alignment and domain information
>KOG1805 consensus Back     alignment and domain information
>KOG2108 consensus Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>KOG1802 consensus Back     alignment and domain information
>TIGR03623 probable DNA repair protein Back     alignment and domain information
>TIGR02774 rexB_recomb ATP-dependent nuclease subunit B; InterPro: IPR014141 DNA repair is accomplished by several different systems in prokaryotes Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit; InterPro: IPR006344 This family describes the exodeoxyribonuclease V alpha subunit, RecD Back     alignment and domain information
>KOG1807 consensus Back     alignment and domain information
>pfam02562 PhoH PhoH-like protein Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>COG0507 RecD ATP-dependent exoDNAse (exonuclease V), alpha subunit - helicase superfamily I member [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00376 TIGR00376 DNA helicase, putative; InterPro: IPR004483 Eukaryotic members of this family have been characterised as binding certain single-stranded G-rich DNA sequences (GGGGT and GGGCT) Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>pfam00270 DEAD DEAD/DEAH box helicase Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>pfam04851 ResIII Type III restriction enzyme, res subunit Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>TIGR01420 pilT_fam twitching motility protein; InterPro: IPR006321 These represent the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway) Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>PRK09694 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB; InterPro: IPR010225 This entry represents HrpB, one of two related predicted DEAH-box ATP-dependent helicases of unknown function found in many proteobacteria, but also in a few species of other lineages Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0952 consensus Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY; InterPro: IPR004390 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0926 consensus Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>KOG0330 consensus Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>pfam06745 KaiC KaiC Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>pfam02399 Herpes_ori_bp Origin of replication binding protein Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>pfam10412 TrwB_AAD_bind Type IV secretion-system coupling protein DNA-binding domain Back     alignment and domain information
>pfam03796 DnaB_C DnaB-like helicase C terminal domain Back     alignment and domain information
>pfam05876 Terminase_GpA Phage terminase large subunit (GpA) Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI; InterPro: IPR014129 This entry represents TraI, which is a component of the relaxosome complex Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>KOG0951 consensus Back     alignment and domain information
>KOG0920 consensus Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>KOG0354 consensus Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0345 consensus Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>COG0529 CysC Adenylylsulfate kinase and related kinases [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA; InterPro: IPR010222 This entry represents HrpA, one of two related but uncharacterised DEAH-box ATP-dependent helicases in many Proteobacteria and a few high-GC Gram-positive bacteria Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K; InterPro: IPR014232 Proteins in this entry include the stage V sporulation protein K (SpoVK), a close homologue of the Rubisco expression protein CbbX (IPR000470 from INTERPRO), and are members of an ATPase family associated with various cellular activities Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: IPR005936 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>KOG0340 consensus Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG0343 consensus Back     alignment and domain information
>KOG0922 consensus Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>pfam01695 IstB IstB-like ATP binding protein Back     alignment and domain information
>pfam01580 FtsK_SpoIIIE FtsK/SpoIIIE family Back     alignment and domain information
>KOG0923 consensus Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>pfam05872 DUF853 Bacterial protein of unknown function (DUF853) Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB; InterPro: IPR004392 The hydrogenase accessory protein HypB is a GTP hydrolase for assembly of nickel metallocentre of hydrogenase Back     alignment and domain information
>KOG1131 consensus Back     alignment and domain information
>PRK13705 plasmid-partitioning protein SopA; Provisional Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information