254780953

254780953

OmpA/MotB

GeneID in NCBI database:8209975Locus tag:CLIBASIA_04260
Protein GI in NCBI database:254780953Protein Accession:YP_003065366.1
Gene range:+(949458, 950030)Protein Length:190aa
Gene description:OmpA/MotB
COG prediction:[M] Outer membrane protein and related peptidoglycan-associated (lipo)proteins
KEGG prediction:OmpA/MotB
SEED prediction:OmpA/MotB domain protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190
MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK
cccccccHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccEEEEEEccEEEccccccccHHHHHHHHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccHHHEEEEEEccccccccccccHHHHHccccEEEEEEcHHHHcc
cccccccEEEEEEccccccHccHccccccccccHEHHEccHHHccHHHHHHHHHHHHHccccEEEEEcccEEEEEcccccEEcccccccccHHHHHHHHHHHHHHccccEEEEEEEccccccHHHHHHccHHHHHHHHHHHHHcccccccEEEEEcccccccccccccHcccccccEEEEEEcccHHHcc
MIKELGLSMFIMTTIsgcglasreKKKVFLHksndtdivnkrfgssldKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQrgvssnrfisvrgfaykypidtndtkvgrqnnqrieiqifprgnikk
MIKELGLSMFIMTTISGCGLASREKKKVFlhksndtdivnKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLiqrgvssnrfisVRGFAYkypidtndtkvgrqnnqrieiqifprgnikk
MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK
**KELGLSMFIMTTIS****************SNDTDIVNKRFGSSLDKAEDEFQMQLQD*GIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGN***
MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK
MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRG****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK
MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK
MIKELGLSMFIMTTISGCGLASREKKKVFLHKSNDTDIVNKRFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNIKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target190 OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62
254780529343 flagellar motor protein MotB [Candidatus Liberibac 0.001
254780547160 OmpA/MotB [Candidatus Liberibacter asiaticus str. 0.010
>gi|254780529|ref|YP_003064942.1| flagellar motor protein MotB [Candidatus Liberibacter asiaticus str. psy62] Length = 343 Back     alignment
 Score = 34.7 bits (78), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 37/68 (54%), Gaps = 4/68 (5%)

Query: 95  MLQLIATILNKFPSTVIAIQSHTDSI---GTLKNNLLISQERADVIKSYLIQRGVSSNRF 151
           +LQ I  +L    + VI+I+ HTD+       ++N  +S +RA      L++ GVS +R 
Sbjct: 251 VLQKIGEVL-AHSTEVISIRGHTDASPFRNIARDNWRLSLDRAYSAYQVLMKSGVSEDRI 309

Query: 152 ISVRGFAY 159
             + GFA+
Sbjct: 310 SKISGFAH 317

>gi|254780547|ref|YP_003064960.1| OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62] Length = 160 Back     alignment
 Score = 31.6 bits (70), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 11/38 (28%), Positives = 24/38 (63%)

Query: 113 IQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNR 150
           I+ H D +G+  +++ +   RA  + +Y + RG+S++R
Sbjct: 85  IEGHADELGSRNSSIALGLRRAYAVFNYFVARGISASR 122

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target190 OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62
315122505190 OmpA/MotB [Candidatus Liberibacter solanacearum CLso-ZC 1 3e-52
85711329188 Outer membrane protein and related peptidoglycan-associ 1 2e-24
109900555215 OmpA/MotB [Pseudoalteromonas atlantica T6c] Length = 21 1 2e-24
332308557215 OmpA/MotB domain protein [Glaciecola agarilytica 4H-3-7 1 3e-24
317060136193 outer membrane protein [Fusobacterium sp. D12] Length = 1 2e-23
317059511204 outer membrane protein [Fusobacterium sp. 3_1_5R] Lengt 1 3e-23
257462480217 Outer membrane protein [Fusobacterium sp. D12] Length = 1 3e-23
257452971217 Outer membrane protein [Fusobacterium sp. 3_1_5R] Lengt 1 3e-23
153009315221 OmpA/MotB domain-containing protein [Ochrobactrum anthr 1 4e-23
56476024232 outer membrane lipoprotein [Aromatoleum aromaticum EbN1 1 4e-23
>gi|315122505|ref|YP_004062994.1| OmpA/MotB [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 190 Back     alignment and organism information
 Score =  208 bits (530), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 104/187 (55%), Positives = 133/187 (71%), Gaps = 5/187 (2%)

Query: 1   MIKELGLSMFIMTTISGCGLASREKKKVF---LHKSNDTDIVNKRFGSSLDKAEDEFQMQ 57
           MIK  G  M +MT +SGC  +++   K+F   L+  N+  ++   FGS LDKAEDE +MQ
Sbjct: 1   MIKRTGALMVVMTALSGC--SNKGNHKLFSKKLNNENNIILIKPNFGSHLDKAEDELRMQ 58

Query: 58  LQDTGIVVSRIGDMITCYIPVHVSFVSEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHT 117
           LQD  + + R  D ITC+IPVH++F S   L K  +P+L  IAT LNKFPST IAI  HT
Sbjct: 59  LQDVDVSIIRKYDQITCHIPVHIAFSSGSILHKDIVPVLNSIATTLNKFPSTKIAITGHT 118

Query: 118 DSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQR 177
           DSIGTL+ NLLISQ+R+ +I  YLI++GVS +RF   +GFAYK PIDTNDT+ GR+NNQR
Sbjct: 119 DSIGTLEYNLLISQQRSQIITDYLIEKGVSPDRFAPPQGFAYKRPIDTNDTQEGRKNNQR 178

Query: 178 IEIQIFP 184
           +EI IFP
Sbjct: 179 VEINIFP 185


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|85711329|ref|ZP_01042388.1| Outer membrane protein and related peptidoglycan-associated(lipo)proteins [Idiomarina baltica OS145] Length = 188 Back     alignment and organism information
>gi|109900555|ref|YP_663810.1| OmpA/MotB [Pseudoalteromonas atlantica T6c] Length = 215 Back     alignment and organism information
>gi|332308557|ref|YP_004436408.1| OmpA/MotB domain protein [Glaciecola agarilytica 4H-3-7+YE-5] Length = 215 Back     alignment and organism information
>gi|317060136|ref|ZP_07924621.1| outer membrane protein [Fusobacterium sp. D12] Length = 193 Back     alignment and organism information
>gi|317059511|ref|ZP_07923996.1| outer membrane protein [Fusobacterium sp. 3_1_5R] Length = 204 Back     alignment and organism information
>gi|257462480|ref|ZP_05626892.1| Outer membrane protein [Fusobacterium sp. D12] Length = 217 Back     alignment and organism information
>gi|257452971|ref|ZP_05618270.1| Outer membrane protein [Fusobacterium sp. 3_1_5R] Length = 217 Back     alignment and organism information
>gi|153009315|ref|YP_001370530.1| OmpA/MotB domain-containing protein [Ochrobactrum anthropi ATCC 49188] Length = 221 Back     alignment and organism information
>gi|56476024|ref|YP_157613.1| outer membrane lipoprotein [Aromatoleum aromaticum EbN1] Length = 232 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target190 OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62
cd07185106 cd07185, OmpA_C-like, Peptidoglycan binding domains sim 3e-24
pfam0069197 pfam00691, OmpA, OmpA family 2e-13
PRK08457257 PRK08457, motB, flagellar motor protein MotB; Reviewed 2e-09
TIGR02802104 TIGR02802, Pal_lipo, peptidoglycan-associated lipoprote 7e-09
PRK07033427 PRK07033, PRK07033, hypothetical protein; Provisional 7e-09
TIGR03350137 TIGR03350, type_VI_ompA, type VI secretion system OmpA/ 1e-08
PRK09039343 PRK09039, PRK09039, hypothetical protein; Validated 5e-08
TIGR03789239 TIGR03789, pdsO, proteobacterial sortase system OmpA fa 7e-08
PRK08126432 PRK08126, PRK08126, hypothetical protein; Provisional 4e-07
PRK10808351 PRK10808, PRK10808, outer membrane protein A; Reviewed 2e-06
PRK09967160 PRK09967, PRK09967, putative outer membrane lipoprotein 8e-06
PRK06667252 PRK06667, motB, flagellar motor protein MotB; Validated 9e-06
PRK06925230 PRK06925, PRK06925, flagellar motor protein MotS; Revie 1e-05
PRK09038281 PRK09038, PRK09038, flagellar motor protein MotD; Revie 2e-05
PRK07734259 PRK07734, motB, flagellar motor protein MotB; Reviewed 6e-05
PRK10802173 PRK10802, PRK10802, peptidoglycan-associated outer memb 6e-05
PRK07034536 PRK07034, PRK07034, hypothetical protein; Provisional 0.002
PRK10510219 PRK10510, PRK10510, putative outer membrane lipoprotein 1e-18
PRK08944302 PRK08944, motB, flagellar motor protein MotB; Reviewed 2e-13
COG1360244 COG1360, MotB, Flagellar motor protein [Cell motility a 9e-13
COG2885190 COG2885, OmpA, Outer membrane protein and related pepti 3e-25
PRK09040214 PRK09040, PRK09040, hypothetical protein; Provisional 0.004
>gnl|CDD|143586 cd07185, OmpA_C-like, Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA Back     alignment and domain information
>gnl|CDD|144333 pfam00691, OmpA, OmpA family Back     alignment and domain information
>gnl|CDD|181435 PRK08457, motB, flagellar motor protein MotB; Reviewed Back     alignment and domain information
>gnl|CDD|131849 TIGR02802, Pal_lipo, peptidoglycan-associated lipoprotein Back     alignment and domain information
>gnl|CDD|180801 PRK07033, PRK07033, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|132393 TIGR03350, type_VI_ompA, type VI secretion system OmpA/MotB family protein Back     alignment and domain information
>gnl|CDD|181619 PRK09039, PRK09039, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|163501 TIGR03789, pdsO, proteobacterial sortase system OmpA family protein Back     alignment and domain information
>gnl|CDD|181240 PRK08126, PRK08126, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|182748 PRK10808, PRK10808, outer membrane protein A; Reviewed Back     alignment and domain information
>gnl|CDD|182172 PRK09967, PRK09967, putative outer membrane lipoprotein; Provisional Back     alignment and domain information
>gnl|CDD|180652 PRK06667, motB, flagellar motor protein MotB; Validated Back     alignment and domain information
>gnl|CDD|180754 PRK06925, PRK06925, flagellar motor protein MotS; Reviewed Back     alignment and domain information
>gnl|CDD|181618 PRK09038, PRK09038, flagellar motor protein MotD; Reviewed Back     alignment and domain information
>gnl|CDD|181095 PRK07734, motB, flagellar motor protein MotB; Reviewed Back     alignment and domain information
>gnl|CDD|182744 PRK10802, PRK10802, peptidoglycan-associated outer membrane lipoprotein; Provisional Back     alignment and domain information
>gnl|CDD|168775 PRK07034, PRK07034, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|182507 PRK10510, PRK10510, putative outer membrane lipoprotein; Provisional Back     alignment and domain information
>gnl|CDD|181590 PRK08944, motB, flagellar motor protein MotB; Reviewed Back     alignment and domain information
>gnl|CDD|31551 COG1360, MotB, Flagellar motor protein [Cell motility and secretion] Back     alignment and domain information
>gnl|CDD|32711 COG2885, OmpA, Outer membrane protein and related peptidoglycan-associated (lipo)proteins [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|181620 PRK09040, PRK09040, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 190 OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62
PRK10510219 putative outer membrane lipoprotein; Provisional 100.0
PRK09967160 putative outer membrane lipoprotein; Provisional 100.0
COG2885190 OmpA Outer membrane protein and related peptidoglycan-a 100.0
PRK09038285 flagellar motor protein MotD; Reviewed 100.0
PRK10802173 peptidoglycan-associated outer membrane lipoprotein; Pr 100.0
PRK07734259 motB flagellar motor protein MotB; Reviewed 100.0
PRK06925230 flagellar motor protein MotS; Reviewed 100.0
PRK06667254 motB flagellar motor protein MotB; Validated 100.0
PRK06742225 flagellar motor protein MotS; Reviewed 100.0
TIGR03350137 type_VI_ompA type VI secretion system OmpA/MotB family 100.0
PRK08944305 motB flagellar motor protein MotB; Reviewed 100.0
PRK08126428 hypothetical protein; Provisional 100.0
PRK07033429 hypothetical protein; Provisional 100.0
PRK08457251 motB flagellar motor protein MotB; Reviewed 100.0
PRK09040215 hypothetical protein; Provisional 100.0
COG1360244 MotB Flagellar motor protein [Cell motility and secreti 99.98
PRK10808347 outer membrane protein A; Reviewed 99.97
PRK09039343 hypothetical protein; Validated 99.97
PRK09041317 motB flagellar motor protein MotB; Validated 99.97
cd07185106 OmpA_C-like Peptidoglycan binding domains similar to th 99.96
PRK06778289 hypothetical protein; Validated 99.96
PRK05996431 motB flagellar motor protein MotB; Validated 99.92
PRK12799 424 motB flagellar motor protein MotB; Reviewed 99.91
PRK07034565 hypothetical protein; Provisional 99.84
TIGR02802104 Pal_lipo peptidoglycan-associated lipoprotein; InterPro 100.0
pfam0069197 OmpA OmpA family. The Pfam entry also includes MotB and 99.91
PRK11627192 hypothetical protein; Provisional 94.76
PRK12696238 flgH flagellar basal body L-ring protein; Reviewed 94.12
>PRK10510 putative outer membrane lipoprotein; Provisional Back     alignment and domain information
>PRK09967 putative outer membrane lipoprotein; Provisional Back     alignment and domain information
>COG2885 OmpA Outer membrane protein and related peptidoglycan-associated (lipo)proteins [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09038 flagellar motor protein MotD; Reviewed Back     alignment and domain information
>PRK10802 peptidoglycan-associated outer membrane lipoprotein; Provisional Back     alignment and domain information
>PRK07734 motB flagellar motor protein MotB; Reviewed Back     alignment and domain information
>PRK06925 flagellar motor protein MotS; Reviewed Back     alignment and domain information
>PRK06667 motB flagellar motor protein MotB; Validated Back     alignment and domain information
>PRK06742 flagellar motor protein MotS; Reviewed Back     alignment and domain information
>TIGR03350 type_VI_ompA type VI secretion system OmpA/MotB family protein Back     alignment and domain information
>PRK08944 motB flagellar motor protein MotB; Reviewed Back     alignment and domain information
>PRK08126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07033 hypothetical protein; Provisional Back     alignment and domain information
>PRK08457 motB flagellar motor protein MotB; Reviewed Back     alignment and domain information
>PRK09040 hypothetical protein; Provisional Back     alignment and domain information
>COG1360 MotB Flagellar motor protein [Cell motility and secretion] Back     alignment and domain information
>PRK10808 outer membrane protein A; Reviewed Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PRK09041 motB flagellar motor protein MotB; Validated Back     alignment and domain information
>cd07185 OmpA_C-like Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA Back     alignment and domain information
>PRK06778 hypothetical protein; Validated Back     alignment and domain information
>PRK05996 motB flagellar motor protein MotB; Validated Back     alignment and domain information
>PRK12799 motB flagellar motor protein MotB; Reviewed Back     alignment and domain information
>PRK07034 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02802 Pal_lipo peptidoglycan-associated lipoprotein; InterPro: IPR014169 Members in this entry represent the peptidoglycan-associated lipoprotein (Pal or OprL) protein of the Tol-Pal system Back     alignment and domain information
>pfam00691 OmpA OmpA family Back     alignment and domain information
>PRK11627 hypothetical protein; Provisional Back     alignment and domain information
>PRK12696 flgH flagellar basal body L-ring protein; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target190 OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62
2k1s_A149 Solution Nmr Structure Of The Folded C-Terminal Fra 4e-26
3ldt_A169 Crystal Structure Of An Outer Membrane Protein(Ompa 1e-13
2aiz_P134 Solution Structure Of Peptidoglycan Associated Lipo 1e-10
3oon_A123 The Structure Of An Outer Membrance Protein From Bo 9e-10
3khn_A174 Crystal Structure Of Putative Motb Like Protein Dvu 2e-09
2zvy_A183 Structure Of The Periplasmic Domain Of Motb From Sa 1e-05
2zov_A210 Structure Of The Periplasmic Domain Of Motb From Sa 4e-05
2kgw_A129 Solution Structure Of The Carboxy-Terminal Domain O 6e-17
1oap_A109 Mad Structure Of The Periplasmique Domain Of The Es 1e-12
2hqs_H118 Crystal Structure Of TolbPAL COMPLEX Length = 118 1e-12
3nb3_A346 The Host Outer Membrane Proteins Ompa And Ompc Are 2e-10
2zf8_A278 Crystal Structure Of Moty Length = 278 3e-10
3cyp_B138 The Crystal Structure Of The C-Terminal Domain Of H 2e-07
1r1m_A164 Structure Of The Ompa-Like Domain Of Rmpm From Neis 4e-04
>gi|188036026|pdb|2K1S|A Chain A, Solution Nmr Structure Of The Folded C-Terminal Fragment Of Yiad From Escherichia Coli. Northeast Structural Genomics Consortium Target Er553 Length = 149 Back     alignment and structure
 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 47/141 (33%), Positives = 79/141 (56%), Gaps = 2/141 (1%)

Query: 45  SSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEV-FLEKKFLPMLQLIATIL 103
             +D  E + + +++ TG+ V+R GD I   +P +V+F S    L+      L  +A +L
Sbjct: 1   YYMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVL 60

Query: 104 NKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPI 163
            ++P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI
Sbjct: 61  KEYPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPI 119

Query: 164 DTNDTKVGRQNNQRIEIQIFP 184
            +N T  G+  N+R+EI + P
Sbjct: 120 ASNSTAEGKAQNRRVEITLSP 140


>gi|285803774|pdb|3LDT|A Chain A, Crystal Structure Of An Outer Membrane Protein(Ompa)from Legionella Pneumophila Length = 169 Back     alignment and structure
>gi|159163741|pdb|2AIZ|P Chain P, Solution Structure Of Peptidoglycan Associated Lipoprotein From Haemophilus Influenza Bound To Udp-N-Acetylmuramoyl-L- Alanyl-D-Glutamyl-Meso-2,6-Diaminopimeloyl-D-Alanyl-D- Alanine Length = 134 Back     alignment and structure
>gi|307568444|pdb|3OON|A Chain A, The Structure Of An Outer Membrance Protein From Borrelia Burgdorferi B31 Length = 123 Back     alignment and structure
>gi|270047795|pdb|3KHN|A Chain A, Crystal Structure Of Putative Motb Like Protein Dvu_2228 From Desulfovibrio Vulgaris. Length = 174 Back     alignment and structure
>gi|257097127|pdb|2ZVY|A Chain A, Structure Of The Periplasmic Domain Of Motb From Salmonella (Crystal Form Ii) Length = 183 Back     alignment and structure
>gi|239781764|pdb|2ZOV|A Chain A, Structure Of The Periplasmic Domain Of Motb From Salmonella (Crystal Form I) Length = 210 Back     alignment and structure
>gi|290559940|pdb|2KGW|A Chain A, Solution Structure Of The Carboxy-Terminal Domain Of Ompatb, A Pore Forming Protein From Mycobacterium Tuberculosis Length = 129 Back     alignment and structure
>gi|46015011|pdb|1OAP|A Chain A, Mad Structure Of The Periplasmique Domain Of The Escherichia Coli Pal Protein Length = 109 Back     alignment and structure
>gi|145579534|pdb|2HQS|H Chain H, Crystal Structure Of TolbPAL COMPLEX Length = 118 Back     alignment and structure
>gi|323462898|pdb|3NB3|A Chain A, The Host Outer Membrane Proteins Ompa And Ompc Are Packed At Specific Sites In The Shigella Phage Sf6 Virion As Structural Components Length = 346 Back     alignment and structure
>gi|193885262|pdb|2ZF8|A Chain A, Crystal Structure Of Moty Length = 278 Back     alignment and structure
>gi|193885364|pdb|3CYP|B Chain B, The Crystal Structure Of The C-Terminal Domain Of Helicobacter Pylori Motb (Residues 125-256). Length = 138 Back     alignment and structure
>gi|49258621|pdb|1R1M|A Chain A, Structure Of The Ompa-Like Domain Of Rmpm From Neisseria Meningitidis Length = 164 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target190 OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62
3ldt_A169 Outer membrane protein, OMPA family protein; OMPA-like 9e-27
3oon_A123 Outer membrane protein (TPN50); protein structure initi 2e-20
2k1s_A149 Inner membrane lipoprotein YIAD; abbababab, OMPA, alpha 1e-17
2zov_A210 Chemotaxis protein MOTB; 2-layer sandwich, bacterial fl 7e-15
2zvy_A183 Chemotaxis protein MOTB; 2-layer sandwich, bacterial fl 2e-09
3khn_A174 MOTB protein, putative; structural genomics, OMPA-like 4e-08
2kgw_A129 Outer membrane protein A; OMPA- like, cell membrane, tr 7e-22
2zf8_A278 MOTY, component of sodium-driven polar flagellar motor; 3e-21
3cyp_B138 Chemotaxis protein MOTB; bacterial flagellar motor, pep 3e-18
1r1m_A164 Outer membrane protein class 4; 1.90A {Neisseria mening 6e-17
2hqs_H118 Peptidoglycan-associated lipoprotein; TOLB, PAL, TOL, t 1e-07
2aiz_P134 Outer membrane protein P6; alpha-beta sandwich; HET: UD 2e-06
>3ldt_A Outer membrane protein, OMPA family protein; OMPA-like domain, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Legionella pneumophila} Length = 169 Back     alignment and structure
 Score =  115 bits (288), Expect = 9e-27
 Identities = 38/142 (26%), Positives = 62/142 (43%), Gaps = 3/142 (2%)

Query: 44  GSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVSEVF-LEKKFLPMLQLIATI 102
               D      +  LQ   I     GD  T  IP    F+     L +   P L  +  +
Sbjct: 21  SIYRDSKRKIIR-DLQKQDIQYVEYGDTRTLIIPTDKYFMFSSPRLNEICYPGLNNVIRL 79

Query: 103 LNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYP 162
           LN +P + I +   TD++G+  +   +SQ +A+ + ++L   G+++ R +   G+  K  
Sbjct: 80  LNFYPQSTIYVAGFTDNVGSRSHKRKLSQAQAETMMTFLWANGIAAKR-LKAEGYGDKNA 138

Query: 163 IDTNDTKVGRQNNQRIEIQIFP 184
           I  N    G   N+RIEIQ F 
Sbjct: 139 ISDNAIIHGSAQNRRIEIQWFT 160


>3oon_A Outer membrane protein (TPN50); protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG; 1.79A {Borrelia burgdorferi} Length = 123 Back     alignment and structure
>2k1s_A Inner membrane lipoprotein YIAD; abbababab, OMPA, alpha beta, palmitate, transmembrane, structural genomics, PSI-2; NMR {Escherichia coli K12} Length = 149 Back     alignment and structure
>2zov_A Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell projection, flagellar rotation, inner membrane, membrane; 2.00A {Salmonella typhimurium} Length = 210 Back     alignment and structure
>2zvy_A Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell inner membrane, cell membrane, flagellar rotation, membrane; 1.75A {Salmonella typhimurium} PDB: 2zvz_A Length = 183 Back     alignment and structure
>3khn_A MOTB protein, putative; structural genomics, OMPA-like domain, PSI-2, protein structure initiative; 2.03A {Desulfovibrio vulgaris str} Length = 174 Back     alignment and structure
>2kgw_A Outer membrane protein A; OMPA- like, cell membrane, transmembrane; NMR {Mycobacterium tuberculosis} Length = 129 Back     alignment and structure
>2zf8_A MOTY, component of sodium-driven polar flagellar motor; beta barrel, 2-layer sandwich, flagellum, structural protein; 2.85A {Vibrio alginolyticus} Length = 278 Back     alignment and structure
>3cyp_B Chemotaxis protein MOTB; bacterial flagellar motor, peptidoglycan binding, bacterial flagellum, flagellar rotation, inner membrane, membrane; 1.60A {Helicobacter pylori} PDB: 3cyq_B* Length = 138 Back     alignment and structure
>1r1m_A Outer membrane protein class 4; 1.90A {Neisseria meningitidis} SCOP: d.79.7.1 Length = 164 Back     alignment and structure
>2hqs_H Peptidoglycan-associated lipoprotein; TOLB, PAL, TOL, transport protein/lipoprotein complex; 1.50A {Escherichia coli} SCOP: d.79.7.1 PDB: 2w8b_C 1oap_A Length = 118 Back     alignment and structure
>2aiz_P Outer membrane protein P6; alpha-beta sandwich; HET: UDP AMU DGL 6CL DAL; NMR {Haemophilus influenzae} SCOP: d.79.7.1 Length = 134 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target190 OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62
3ldt_A169 Outer membrane protein, OMPA family protein; OMPA-like 100.0
2k1s_A149 Inner membrane lipoprotein YIAD; abbababab, OMPA, alpha 100.0
3khn_A174 MOTB protein, putative; structural genomics, OMPA-like 100.0
2zov_A210 Chemotaxis protein MOTB; 2-layer sandwich, bacterial fl 99.97
2zvy_A183 Chemotaxis protein MOTB; 2-layer sandwich, bacterial fl 99.97
3oon_A123 Outer membrane protein (TPN50); protein structure initi 99.96
1r1m_A164 Outer membrane protein class 4; 1.90A {Neisseria mening 99.97
2kgw_A129 Outer membrane protein A; OMPA- like, cell membrane, tr 99.97
2hqs_H118 Peptidoglycan-associated lipoprotein; TOLB, PAL, TOL, t 99.96
2aiz_P134 Outer membrane protein P6; alpha-beta sandwich; HET: UD 99.96
3cyp_B138 Chemotaxis protein MOTB; bacterial flagellar motor, pep 99.96
2zf8_A278 MOTY, component of sodium-driven polar flagellar motor; 99.96
>3ldt_A Outer membrane protein, OMPA family protein; OMPA-like domain, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Legionella pneumophila} Back     alignment and structure
Probab=100.00  E-value=1.3e-36  Score=223.02  Aligned_cols=144  Identities=28%  Similarity=0.421  Sum_probs=128.9

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCEEEEECCEEEEEECCCEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCC
Q ss_conf             012337888999999720178358860875899852211128-8131099999999999999985899489999803778
Q gi|254780953|r   42 RFGSSLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSI  120 (190)
Q Consensus        42 ~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~  120 (190)
                      ....+++.. .++...+...++.+...++.+.+.++..++|+ +++.|+++++..|++|+.+|+++|+..|.|+||||+.
T Consensus        19 ~~~~~~d~~-~~~~~~l~~~~v~v~~~~~~~~v~l~~~v~F~~~s~~l~~~~~~~L~~ia~~L~~~p~~~i~I~GhTD~~   97 (169)
T 3ldt_A           19 VASIYRDSK-RKIIRDLQKQDIQYVEYGDTRTLIIPTDKYFMFSSPRLNEICYPGLNNVIRLLNFYPQSTIYVAGFTDNV   97 (169)
T ss_dssp             TTHHHHHHH-HHHHHHHHHTTCEEEEETTEEEEEEETTTCCC-CCHHHHHHHCHHHHHHHHHHTTCTTSCEEEEEECTTS
T ss_pred             HHHHHHHHH-HHHHHHHHCCCCEEEEECCEEEEEECCCCEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCC
T ss_conf             764329999-9999998539937999699899990688347299642698899999999999997899579999973898


Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEEC-CHH
Q ss_conf             7200111225899999999888523874516999970345888997697798529916999930-101
Q gi|254780953|r  121 GTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFP-RGN  187 (190)
Q Consensus       121 g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~-~~~  187 (190)
                      |++.|||.||++||.+|++||+.+|+++.| |.+.|||+++|+++|+++++|++||||||.|++ +|+
T Consensus        98 g~~~~N~~LS~~RA~~V~~~L~~~Gv~~~r-i~~~G~G~~~Pv~~n~t~egra~NRRVei~i~~~~g~  164 (169)
T 3ldt_A           98 GSRSHKRKLSQAQAETMMTFLWANGIAAKR-LKAEGYGDKNAISDNAIIHGSAQNRRIEIQWFTSEGH  164 (169)
T ss_dssp             CCC--CHHHHHHHHHHHHHHHHHTTCCTTT-EEECCTTCTTSCCCTTTSCGGGGTSEEEEEEECCCC-
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHCCCCHHH-EEEEEECCCCCCCCCCCHHHHHHCCCEEEEEEECCCC
T ss_conf             976675779999999999999985999799-8999975668679993988998549889999958987



>2k1s_A Inner membrane lipoprotein YIAD; abbababab, OMPA, alpha beta, palmitate, transmembrane, structural genomics, PSI-2; NMR {Escherichia coli K12} Back     alignment and structure
>3khn_A MOTB protein, putative; structural genomics, OMPA-like domain, PSI-2, protein structure initiative; 2.03A {Desulfovibrio vulgaris str} Back     alignment and structure
>2zov_A Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell projection, flagellar rotation, inner membrane, membrane; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2zvy_A Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell inner membrane, cell membrane, flagellar rotation, membrane; 1.75A {Salmonella typhimurium} PDB: 2zvz_A Back     alignment and structure
>3oon_A Outer membrane protein (TPN50); protein structure initiative, PSI-2, structural genomics, MI center for structural genomics, MCSG; 1.79A {Borrelia burgdorferi} Back     alignment and structure
>1r1m_A Outer membrane protein class 4; 1.90A {Neisseria meningitidis} SCOP: d.79.7.1 Back     alignment and structure
>2kgw_A Outer membrane protein A; OMPA- like, cell membrane, transmembrane; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2hqs_H Peptidoglycan-associated lipoprotein; TOLB, PAL, TOL, transport protein/lipoprotein complex; 1.50A {Escherichia coli} SCOP: d.79.7.1 PDB: 2w8b_C 1oap_A Back     alignment and structure
>2aiz_P Outer membrane protein P6; alpha-beta sandwich; HET: UDP AMU DGL 6CL DAL; NMR {Haemophilus influenzae} SCOP: d.79.7.1 Back     alignment and structure
>3cyp_B Chemotaxis protein MOTB; bacterial flagellar motor, peptidoglycan binding, bacterial flagellum, flagellar rotation, inner membrane, membrane; 1.60A {Helicobacter pylori} PDB: 3cyq_B* 3imp_B Back     alignment and structure
>2zf8_A MOTY, component of sodium-driven polar flagellar motor; beta barrel, 2-layer sandwich, flagellum, structural protein; 2.85A {Vibrio alginolyticus} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 190 OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62
d1r1ma_140 d.79.7.1 (A:) Outer membrane protein class 4, RmpM, C-t 8e-11
d2hqsc1106 d.79.7.1 (C:68-173) Peptidoglycan-associated lipoprotei 8e-10
d2aizp1134 d.79.7.1 (P:1-134) Peptidoglycan-associated lipoprotein 5e-09
>d1r1ma_ d.79.7.1 (A:) Outer membrane protein class 4, RmpM, C-terminal domain {Neisseria meningitidis [TaxId: 487]} Length = 140 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: OmpA-like
family: OmpA-like
domain: Outer membrane protein class 4, RmpM, C-terminal domain
species: Neisseria meningitidis [TaxId: 487]
 Score = 60.6 bits (146), Expect = 8e-11
 Identities = 26/137 (18%), Positives = 55/137 (40%), Gaps = 28/137 (20%)

Query: 75  YIPVHVSFVSEVF-------LEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNL 127
           Y+   +S  ++         L  +    L+++A  L++     + ++ HTD +G+ K N 
Sbjct: 3   YVDETISLSAKTLFGFDKDSLRAEAQDNLKVLAQRLSRTNIQSVRVEGHTDFMGSDKYNQ 62

Query: 128 LISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGR--------------- 172
            +S+ RA V+ + L+  GV  +R IS  G        T   +                  
Sbjct: 63  ALSERRAYVVANNLVSNGVPVSR-ISAVGLGESQAQMTQVCEAEVAKLGAKVSKAKKREA 121

Query: 173 -----QNNQRIEIQIFP 184
                + ++R++++I  
Sbjct: 122 LIACIEPDRRVDVKIRS 138


>d2hqsc1 d.79.7.1 (C:68-173) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Escherichia coli [TaxId: 562]} Length = 106 Back     information, alignment and structure
>d2aizp1 d.79.7.1 (P:1-134) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Haemophilus influenzae [TaxId: 727]} Length = 134 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target190 OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62
d2aizp1134 Peptidoglycan-associated lipoprotein, PAL, periplasmic 99.96
d1r1ma_140 Outer membrane protein class 4, RmpM, C-terminal domain 99.96
d2hqsc1106 Peptidoglycan-associated lipoprotein, PAL, periplasmic 99.96
>d2aizp1 d.79.7.1 (P:1-134) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: OmpA-like
family: OmpA-like
domain: Peptidoglycan-associated lipoprotein, PAL, periplasmic domain
species: Haemophilus influenzae [TaxId: 727]
Probab=99.96  E-value=2e-29  Score=181.54  Aligned_cols=103  Identities=23%  Similarity=0.404  Sum_probs=97.5

Q ss_pred             CEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEE
Q ss_conf             11128-81310999999999999999858994899998037787200111225899999999888523874516999970
Q gi|254780953|r   79 HVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGF  157 (190)
Q Consensus        79 ~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~  157 (190)
                      .+||+ +++.|+++++..|++++.+|+.+|+.+|.|.||||..|+..|||.||++||.+|++||+..|+++.| |.+.||
T Consensus        31 ~I~F~~~s~~L~~~~~~~L~~la~~l~~~~~~~i~I~GhtD~~g~~~~N~~LS~~RA~~V~~~L~~~Gi~~~r-i~~~g~  109 (134)
T d2aizp1          31 TVYFGFDKYDITGEYVQILDAHAAYLNATPAAKVLVEGNTDERGTPEYNIALGQRRADAVKGYLAGKGVDAGK-LGTVSY  109 (134)
T ss_dssp             EEECCTTCCCCCHHHHHHHHHHHHHHHHSTTCCEEEEEECCSSSCHHHHHHHHHHHHHHHHHHHHHTTCCGGG-EEEEEC
T ss_pred             EEECCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCC-CEEEEC
T ss_conf             1883799812498899999999999986999689996043433221110137899999999899771875345-513775


Q ss_pred             CCCCCCCCCCCHHHHHCCCCEEEEE
Q ss_conf             3458889976977985299169999
Q gi|254780953|r  158 AYKYPIDTNDTKVGRQNNQRIEIQI  182 (190)
Q Consensus       158 G~~~p~~~n~~~~~ra~NRRVei~i  182 (190)
                      |+++|+.++.++++|++||||||+.
T Consensus       110 G~~~P~~~~~~~~~~~~NRRVeiv~  134 (134)
T d2aizp1         110 GEEKPAVLGHDEAAYSKNRRAVLAY  134 (134)
T ss_dssp             TTTSCSSCSCSHHHHHHHSEEEEEC
T ss_pred             CCCCCCCCCCCHHHHHCCCCEEEEC
T ss_conf             4337578891977986239899959



>d1r1ma_ d.79.7.1 (A:) Outer membrane protein class 4, RmpM, C-terminal domain {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2hqsc1 d.79.7.1 (C:68-173) Peptidoglycan-associated lipoprotein, PAL, periplasmic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 190 OmpA/MotB [Candidatus Liberibacter asiaticus str.
2k1s_A_149 (A:) Inner membrane lipoprotein YIAD; abbababab, O 6e-20
3ldt_A_169 (A:) Outer membrane protein, OMPA family protein; 1e-17
3khn_A_174 (A:) MOTB protein, putative; structural genomics, 5e-17
2aiz_P_134 (P:) Outer membrane protein P6; alpha-beta sandwic 1e-15
2zvy_A_183 (A:) Chemotaxis protein MOTB; 2-layer sandwich, ba 4e-15
2zov_A_210 (A:) Chemotaxis protein MOTB; 2-layer sandwich, ba 5e-15
1r1m_A_164 (A:) Outer membrane protein class 4; 1.90A {Neisse 6e-15
2hqs_H_118 (H:) Peptidoglycan-associated lipoprotein; TOLB, P 4e-15
3cyp_B_138 (B:) Chemotaxis protein MOTB; bacterial flagellar 1e-14
2zf8_A_155-278124 (A:155-278) MOTY, component of sodium-driven polar 3e-13
>2k1s_A (A:) Inner membrane lipoprotein YIAD; abbababab, OMPA, alpha beta, palmitate, transmembrane, structural genomics, PSI-2; NMR {Escherichia coli K12}Length = 149 Back     alignment and structure
 Score = 91.7 bits (227), Expect = 6e-20
 Identities = 47/140 (33%), Positives = 79/140 (56%), Gaps = 2/140 (1%)

Query: 47  LDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFVS-EVFLEKKFLPMLQLIATILNK 105
           +D  E + + +++ TG+ V+R GD I   +P +V+F S    L+      L  +A +L +
Sbjct: 3   MDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKE 62

Query: 106 FPSTVIAIQSHTDSIGTLKNNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDT 165
           +P T + +  +TDS G    N+ +SQ+RAD + S LI +GV ++R I  +G     PI +
Sbjct: 63  YPKTAVNVIGYTDSTGGHDLNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIAS 121

Query: 166 NDTKVGRQNNQRIEIQIFPR 185
           N T  G+  N+R+EI + P 
Sbjct: 122 NSTAEGKAQNRRVEITLSPL 141


>3ldt_A (A:) Outer membrane protein, OMPA family protein; OMPA-like domain, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Legionella pneumophila}Length = 169 Back     alignment and structure
>3khn_A (A:) MOTB protein, putative; structural genomics, OMPA-like domain, PSI-2, protein structure initiative; 2.03A {Desulfovibrio vulgaris str}Length = 174 Back     alignment and structure
>2aiz_P (P:) Outer membrane protein P6; alpha-beta sandwich; HET: UDP AMU DGL 6CL DAL; NMR {Haemophilus influenzae}Length = 134 Back     alignment and structure
>2zvy_A (A:) Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell inner membrane, cell membrane, flagellar rotation, membrane; 1.75A {Salmonella typhimurium} PDB: 2zvz_ALength = 183 Back     alignment and structure
>2zov_A (A:) Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell projection, flagellar rotation, inner membrane, membrane; 2.00A {Salmonella typhimurium}Length = 210 Back     alignment and structure
>1r1m_A (A:) Outer membrane protein class 4; 1.90A {Neisseria meningitidis}Length = 164 Back     alignment and structure
>2hqs_H (H:) Peptidoglycan-associated lipoprotein; TOLB, PAL, TOL, transport protein/lipoprotein complex; 1.50A {Escherichia coli}Length = 118 Back     alignment and structure
>3cyp_B (B:) Chemotaxis protein MOTB; bacterial flagellar motor, peptidoglycan binding, bacterial flagellum, flagellar rotation, inner membrane, membrane; 1.60A {Helicobacter pylori} PDB: 3cyq_B*Length = 138 Back     alignment and structure
>2zf8_A (A:155-278) MOTY, component of sodium-driven polar flagellar motor; beta barrel, 2-layer sandwich, flagellum, structural protein; 2.85A {Vibrio alginolyticus}Length = 124 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target190 OmpA/MotB [Candidatus Liberibacter asiaticus str. psy62
2k1s_A_149 Inner membrane lipoprotein YIAD; abbababab, OMPA, 100.0
3ldt_A_169 Outer membrane protein, OMPA family protein; OMPA- 100.0
3khn_A_174 MOTB protein, putative; structural genomics, OMPA- 100.0
1r1m_A_164 Outer membrane protein class 4; 1.90A {Neisseria m 99.96
2aiz_P_134 Outer membrane protein P6; alpha-beta sandwich; HE 99.96
2zov_A_210 Chemotaxis protein MOTB; 2-layer sandwich, bacteri 99.96
2zvy_A_183 Chemotaxis protein MOTB; 2-layer sandwich, bacteri 99.96
2hqs_H_118 Peptidoglycan-associated lipoprotein; TOLB, PAL, T 99.97
2zf8_A_155-278124 MOTY, component of sodium-driven polar flagellar m 99.96
3cyp_B_138 Chemotaxis protein MOTB; bacterial flagellar motor 99.96
>2k1s_A (A:) Inner membrane lipoprotein YIAD; abbababab, OMPA, alpha beta, palmitate, transmembrane, structural genomics, PSI-2; NMR {Escherichia coli K12} Back     alignment and structure
Probab=100.00  E-value=5.5e-34  Score=209.19  Aligned_cols=142  Identities=33%  Similarity=0.494  Sum_probs=134.5

Q ss_pred             HHHHHHHHHHHHHCCCCCEEEEECCEEEEEECCCEECC-CHHHCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCHH
Q ss_conf             37888999999720178358860875899852211128-81310999999999999999858994899998037787200
Q gi|254780953|r   46 SLDKAEDEFQMQLQDTGIVVSRIGDMITCYIPVHVSFV-SEVFLEKKFLPMLQLIATILNKFPSTVIAIQSHTDSIGTLK  124 (190)
Q Consensus        46 ~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~f~-~~a~l~~~~~~~L~~ia~~l~~~~~~~i~I~GHTD~~g~~~  124 (190)
                      +++.+...+...+..+++.+...++...+.++..++|+ +++.|++++++.|+.++.+|+.+|+..|.|+||||..|++.
T Consensus         2 ~~~~~~~~l~~~~~~~~~~v~~~~~~~~i~~~~~v~F~~~s~~l~~~~~~~L~~ia~~L~~~p~~~i~I~Ghtd~~g~~~   81 (149)
T 2k1s_A            2 YMDVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVIGYTDSTGGHD   81 (149)
T ss_dssp             CSHHHHHHHHHHTTTTSCEEEEETTEEEEEEEHHHHBSSSSSCBCHHHHHHHHHHHHHHHHCTTEEEEEEEECCCTTCHH
T ss_pred             CHHHHHHHHHHHHCCCCCEEEEECCEEEEECCCCEEECCCCCCCCHHHHHHHHHHHHHHHCCCCCCEEECCCCCCCCCCC
T ss_conf             78899999999871599779997999999847860665997336989999999887777318875201022413544543


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCHHHHHCCCCEEEEEECCHHH
Q ss_conf             1112258999999998885238745169999703458889976977985299169999301011
Q gi|254780953|r  125 NNLLISQERADVIKSYLIQRGVSSNRFISVRGFAYKYPIDTNDTKVGRQNNQRIEIQIFPRGNI  188 (190)
Q Consensus       125 ~N~~LS~~RA~~V~~~L~~~g~~~~r~i~v~g~G~~~p~~~n~~~~~ra~NRRVei~i~~~~~~  188 (190)
                      +||.||.+||.+|++||...|+++.| |.+.|||+.+|+++|+++++|++||||||+|.++...
T Consensus        82 ~N~~LS~~RA~aV~~~l~~~gv~~~r-i~~~g~G~~~p~~~~~~~~~~~~NRRVei~i~~~~~~  144 (149)
T 2k1s_A           82 LNMRLSQQRADSVASALITQGVDASR-IRTQGLGPANPIASNSTAEGKAQNRRVEITLSPLLEH  144 (149)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTCCGGG-EEEEECTTTCCSSCSSSHHHHHHHSEEEEEEEECSSC
T ss_pred             CCCHHHHHHHHHHHHHHHHCCCCCCC-CEEEEECCCCCCCCCCCHHHHHHCCCEEEEEEECCHH
T ss_conf             32017889999999999981997663-3589965657668993977897449699999615140



>3ldt_A (A:) Outer membrane protein, OMPA family protein; OMPA-like domain, PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Legionella pneumophila} Back     alignment and structure
>3khn_A (A:) MOTB protein, putative; structural genomics, OMPA-like domain, PSI-2, protein structure initiative; 2.03A {Desulfovibrio vulgaris str} Back     alignment and structure
>1r1m_A (A:) Outer membrane protein class 4; 1.90A {Neisseria meningitidis} Back     alignment and structure
>2aiz_P (P:) Outer membrane protein P6; alpha-beta sandwich; HET: UDP AMU DGL 6CL DAL; NMR {Haemophilus influenzae} Back     alignment and structure
>2zov_A (A:) Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell projection, flagellar rotation, inner membrane, membrane; 2.00A {Salmonella typhimurium} Back     alignment and structure
>2zvy_A (A:) Chemotaxis protein MOTB; 2-layer sandwich, bacterial flagellum, cell inner membrane, cell membrane, flagellar rotation, membrane; 1.75A {Salmonella typhimurium} PDB: 2zvz_A Back     alignment and structure
>2hqs_H (H:) Peptidoglycan-associated lipoprotein; TOLB, PAL, TOL, transport protein/lipoprotein complex; 1.50A {Escherichia coli} Back     alignment and structure
>2zf8_A (A:155-278) MOTY, component of sodium-driven polar flagellar motor; beta barrel, 2-layer sandwich, flagellum, structural protein; 2.85A {Vibrio alginolyticus} Back     alignment and structure
>3cyp_B (B:) Chemotaxis protein MOTB; bacterial flagellar motor, peptidoglycan binding, bacterial flagellum, flagellar rotation, inner membrane, membrane; 1.60A {Helicobacter pylori} PDB: 3cyq_B* Back     alignment and structure