254780963

254780963

hypothetical protein CLIBASIA_04320

GeneID in NCBI database:8209985Locus tag:CLIBASIA_04320
Protein GI in NCBI database:254780963Protein Accession:YP_003065376.1
Gene range:-(960671, 961318)Protein Length:215aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNyes
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-----
MVRVFCAIIFVLITFIGEFSQALEHEDELKVNFGLMRRVMIDLWSREISSYRTPLSLDLDYKHRVYLDTYKSFSINLGFETFNEIVNPTTMRVLVLPVLSMHKTWNNNFDDSYFFKKIGVGVVASTGFNTGDKWLGAEMGMSFYVYPTPWLILQSDFAIRHASSDVVVCMRYQAKFLITDSIGILYRNVSAVSAAVDKNIGLGVTKIGLDYVYKF
cHHHHHHHHHHHHHHHHHHHHHHccHHcEEEcHHHHHHHHHHHHHHHHHHccccEEEEEcccEEEEEEEEEEEEEEEcHHHHHHHcccccHHHHHHHHHHHHHHHcccccHHHHHHHHcEEEEEEcccccccHHHHHHHccEEEEEcccEEEEEccEEEEEccccEEEEEEEEEEEEEEccHHEEEEcHHHHHHHHHccccccEEEEEHHHEEcc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEccccccEEEEEcccEEEEEcccccccHccccccEEEEEEHHHHHccccccccccHHHHHEEccEEEEcccccccccHHcHHcccEEEEccccHHHEHcHHHHHcccccHEEEHHHHHHHHHHHHHHHHEHcHHHHHHHHHccccccEEEEcccEEEEc
MVRVFCAIIFVLITFIGEFSQALEHEDELKVNFGLMRRVMIDLWSREIssyrtplsldldykhrvyLDTYKSFSINLGFEtfneivnpttMRVLVLPVLSMhktwnnnfddsyffkKIGVGVVastgfntgdkwlgaemgmsfyvyptpwlilqSDFAIRHASSDVVVCMRYQAKFLITDSIGILYRNVSAVSAAVDkniglgvtkigldyvykf
MVRVFCAIIFVLITFIGEFSQALEHEDELKVNFGLMRRVMIDLWSREISsyrtplsldldyKHRVYLDTYKSFSINLGFETFNEIVNPTTMRVLVLPVLSMHKTWNNNFDDSYFFKKIGVGVVASTGFNTGDKWLGAEMGMSFYVYPTPWLILQSDFAIRHASSDVVVCMRYQAKFLITDSIGILYRNVSAVSaavdkniglgvtkigldyvykf
MVRVFCAIIFVLITFIGEFSQALEHEDELKVNFGLMRRVMIDLWSREISSYRTPLSLDLDYKHRVYLDTYKSFSINLGFETFNEIVNPTTMRVLVLPVLSMHKTWNNNFDDSYFFKKIGVGVVASTGFNTGDKWLGAEMGMSFYVYPTPWLILQSDFAIRHASSDVVVCMRYQAKFLITDSIGILYRNVSAVSAAVDKNIGLGVTKIGLDYVYKF
*VRVFCAIIFVLITFIGEFSQALEHEDELKVNFGLMRRVMIDLWSREISSYRTPLSLDLDYKHRVYLDTYKSFSINLGFETFNEIVNPTTMRVLVLPVLSMHKTWNNNFDDSYFFKKIGVGVVASTGFNTGDKWLGAEMGMSFYVYPTPWLILQSDFAIRHASSDVVVCMRYQAKFLITDSIGILYRNVSAVSAAVDKNIGLGVTKIGLDYVYKF
MVRVFCAIIFVLITFIGEFSQALEHEDELKVNFGLMRRVMIDLWSREISSYRTPLSLDLDYKHRVYLDTYKSFSINLGFETFNEIVNPTTMRVLVLPVLSMHKTWNNNFDDSYFFKKIGVGVVASTGFNTGDKWLGAEMGMSFYVYPTPWLILQSDFAIRHASSDVVVCMRYQAKFLITDSIGILYRNVSAVSAAVDKNIGLGVTKIGLDYVYKF
*VRVFCAIIFVLITFIGEFSQALEHEDELKVNFGLMRRVMIDLWSREISSYRTPLSLDLDYKHRVYLDTYKSFSINLGFETFNEIVNPTTMRVLVLPVLSMHKTWNNNFDDSYFFKKIGVGVVASTGFNTGDKWLGAEMGMSFYVYPTPWLILQSDFAIRHASSDVVVCMRYQAKFLITDSIGILYRNVSAVSAAVDKNIGLGVTKIGLDYVYKF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
HHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MVRVFCAIIFVLITFIGEFSQALEHEDELKVNFGLMRRVMIDLWSREISSYRTPLSLDLDYKHRVYLDTYKSFSINLGFETFNEIVNPTTMRVLVLPVLSMHKTWNNNFDDSYFFKKIGVGVVASTGFNTGDKWLGAEMGMSFYVYPTPWLILQSDFAIRHASSDVVVCMRYQAKFLITDSIGILYRNVSAVSAAVDKNIGLGVTKIGLDYVYKF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target215 hypothetical protein CLIBASIA_04320 [Candidatus Liberib
25478115465 hypothetical protein CLIBASIA_05305 [Candidatus Li 4e-04
>gi|254781154|ref|YP_003065567.1| hypothetical protein CLIBASIA_05305 [Candidatus Liberibacter asiaticus str. psy62] Length = 65 Back     alignment
 Score = 36.6 bits (83), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 35/72 (48%), Gaps = 12/72 (16%)

Query: 148 TPWLILQSDFAIRHASSDVVVCMRYQAKFLITDSIGILYRNVSAVSAAVDKNI----GLG 203
           T WL LQ DF +           R Q + LITD       N+SA+ ++ DKNI      G
Sbjct: 2   TSWLKLQRDFGVVLIGDKAFNTYRSQLRILITD-------NLSALISS-DKNITESGKEG 53

Query: 204 VTKIGLDYVYKF 215
           + K+ L YVY F
Sbjct: 54  IVKMDLSYVYTF 65

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

No hits with e-value below 0.005 within the first 2 iteration


Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00