254780969

254780969

hypothetical protein CLIBASIA_04350

GeneID in NCBI database:8209991Locus tag:CLIBASIA_04350
Protein GI in NCBI database:254780969Protein Accession:YP_003065382.1
Gene range:-(965637, 965876)Protein Length:79aa
Gene description:hypothetical protein
COG prediction:[T] Stress-induced morphogen (activity unknown)
KEGG prediction:hypothetical protein
SEED prediction:YrbA protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Broadly distributed proteins not in subsystems
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------8
MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ
ccccHHHHHHHHHHHccccEEEEEEccccccEEEEEEEcHHHccccHHHHHHHHHHHHHHHHcccEEEEEEEEEccccc
ccccHHHHHHHHHHHccccEEEEEEccccccEEEEEEEcHHHccccHHHHHHHHHHHHHHHHcccHHEEEEEccccccc
MSMNPHEIEKMIKKGIPQSIVTIHDlagdgnhyAAEIISEefrgknriqQHQMVYDSLGNKMGNALHALSIktsvpdsq
MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALsiktsvpdsq
MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ
****PHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSI*TSV****
MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ
*SMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSV****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ
MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ
MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target79 hypothetical protein CLIBASIA_04350 [Candidatus Liberib
254780586101 BolA family protein [Candidatus Liberibacter asiat 6e-05
>gi|254780586|ref|YP_003064999.1| BolA family protein [Candidatus Liberibacter asiaticus str. psy62] Length = 101 Back     alignment
 Score = 37.0 bits (84), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 28/49 (57%)

Query: 31 NHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDSQ 79
           H   +I+S  F G ++  +H+ +YD L  ++   LHALSI+   PD +
Sbjct: 47 THIRIKIVSPTFTGISKTFRHRKIYDLLHKEIKEELHALSIEAFSPDEK 95

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target79 hypothetical protein CLIBASIA_04350 [Candidatus Liberib
31512261381 hypothetical protein CKC_04325 [Candidatus Liberibacter 1 5e-27
31940864178 conserved hypothetical protein [Bartonella schoenbuchen 1 1e-25
1347036877 hypothetical protein msl0055 [Mesorhizobium loti MAFF30 1 2e-25
26046083277 BolA family protein [Mesorhizobium opportunistum WSM207 1 2e-25
15300971877 BolA family protein [Ochrobactrum anthropi ATCC 49188] 1 3e-25
25469357277 hypothetical protein Babob3T_02689 [Brucella abortus bv 1 4e-25
30684406978 BolA family protein [Brucella sp. BO1] Length = 78 1 6e-25
1798741177 morphology/transcription regulator BolA family protein 1 6e-25
225627328101 morphology/transcription regulator BolA family protein 1 7e-25
12160184577 BolA family protein [Bartonella bacilliformis KC583] Le 1 2e-24
>gi|315122613|ref|YP_004063102.1| hypothetical protein CKC_04325 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 81 Back     alignment and organism information
 Score =  124 bits (311), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 59/76 (77%), Positives = 66/76 (86%)

Query: 3  MNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKM 62
          MN HEIE+MI KGIP S+V I DLAGDGNHYAAEIISEEFRGKNRIQQH+MVY +L  KM
Sbjct: 1  MNIHEIEEMITKGIPNSVVRIQDLAGDGNHYAAEIISEEFRGKNRIQQHKMVYAALEGKM 60

Query: 63 GNALHALSIKTSVPDS 78
          G+ LHALSIKT +P+S
Sbjct: 61 GDTLHALSIKTVIPNS 76


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|319408641|emb|CBI82296.1| conserved hypothetical protein [Bartonella schoenbuchensis R1] Length = 78 Back     alignment and organism information
>gi|13470368|ref|NP_101936.1| hypothetical protein msl0055 [Mesorhizobium loti MAFF303099] Length = 77 Back     alignment and organism information
>gi|260460832|ref|ZP_05809082.1| BolA family protein [Mesorhizobium opportunistum WSM2075] Length = 77 Back     alignment and organism information
>gi|153009718|ref|YP_001370933.1| BolA family protein [Ochrobactrum anthropi ATCC 49188] Length = 77 Back     alignment and organism information
>gi|254693572|ref|ZP_05155400.1| hypothetical protein Babob3T_02689 [Brucella abortus bv. 3 str. Tulya] Length = 77 Back     alignment and organism information
>gi|306844069|ref|ZP_07476664.1| BolA family protein [Brucella sp. BO1] Length = 78 Back     alignment and organism information
>gi|17987411|ref|NP_540045.1| morphology/transcription regulator BolA family protein [Brucella melitensis bv. 1 str. 16M] Length = 77 Back     alignment and organism information
>gi|225627328|ref|ZP_03785365.1| morphology/transcription regulator BolA family protein [Brucella ceti str. Cudo] Length = 101 Back     alignment and organism information
>gi|121601845|ref|YP_989151.1| BolA family protein [Bartonella bacilliformis KC583] Length = 77 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target79 hypothetical protein CLIBASIA_04350 [Candidatus Liberib
COG027190 COG0271, BolA, Stress-induced morphogen (activity unkno 2e-14
COG500780 COG5007, COG5007, Predicted transcriptional regulator, 5e-14
KOG334885 KOG3348, KOG3348, KOG3348, BolA (bacterial stress-induc 3e-08
KOG2313100 KOG2313, KOG2313, KOG2313, Stress-induced protein UVI31 9e-07
PRK11628105 PRK11628, PRK11628, transcriptional regulator BolA; Pro 7e-04
pfam0172272 pfam01722, BolA, BolA-like protein 6e-16
>gnl|CDD|30620 COG0271, BolA, Stress-induced morphogen (activity unknown) [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|34612 COG5007, COG5007, Predicted transcriptional regulator, BolA superfamily [Transcription] Back     alignment and domain information
>gnl|CDD|38558 KOG3348, KOG3348, KOG3348, BolA (bacterial stress-induced morphogen)-related protein [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|37524 KOG2313, KOG2313, KOG2313, Stress-induced protein UVI31+ [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183243 PRK11628, PRK11628, transcriptional regulator BolA; Provisional Back     alignment and domain information
>gnl|CDD|145069 pfam01722, BolA, BolA-like protein Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 79 hypothetical protein CLIBASIA_04350 [Candidatus Liberib
PRK11628105 transcriptional regulator BolA; Provisional 99.93
COG027190 BolA Stress-induced morphogen (activity unknown) [Signa 99.93
pfam0172272 BolA BolA-like protein. This family consist of the morp 99.9
COG500780 Predicted transcriptional regulator, BolA superfamily [ 99.89
KOG334885 consensus 99.88
KOG2313100 consensus 99.83
>PRK11628 transcriptional regulator BolA; Provisional Back     alignment and domain information
>COG0271 BolA Stress-induced morphogen (activity unknown) [Signal transduction mechanisms] Back     alignment and domain information
>pfam01722 BolA BolA-like protein Back     alignment and domain information
>COG5007 Predicted transcriptional regulator, BolA superfamily [Transcription] Back     alignment and domain information
>KOG3348 consensus Back     alignment and domain information
>KOG2313 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target79 hypothetical protein CLIBASIA_04350 [Candidatus Liberib
1xs3_A80 Solution Structure Analysis Of The Xc975 Protein Le 7e-20
2dhm_A107 Solution Structure Of The Bola Protein From Escheri 4e-19
1v60_A123 Solution Structure Of Bola1 Protein From Mus Muscul 2e-18
1v9j_A113 Solution Structure Of A Bola-Like Protein From Mus 1e-16
2kdn_A108 Solution Structure Of Pfe0790c, A Putative Bola-Lik 2e-14
2kz0_A76 Solution Structure Of A Bola Protein (Ech_0303) Fro 3e-14
3o2e_A105 Crystal Structure Of A Bol-Like Protein From Babesi 8e-14
1ny8_A97 Solution Structure Of Protein Yrba From Escherichia 9e-14
>gi|62738509|pdb|1XS3|A Chain A, Solution Structure Analysis Of The Xc975 Protein Length = 80 Back     alignment and structure
 Score =  100 bits (250), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 30/77 (38%), Positives = 47/77 (61%), Gaps = 2/77 (2%)

Query: 2  SMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNK 61
           ++   I K+I+ G+P++ V +     DG H+ A ++S  F GK  + +H+MVY +LG  
Sbjct: 5  PLDAETIRKLIESGLPEARVDVQGE--DGVHFEATVVSPAFVGKAPLARHRMVYATLGEL 62

Query: 62 MGNALHALSIKTSVPDS 78
          MG A+HAL +KT  PD 
Sbjct: 63 MGGAIHALQLKTLTPDE 79


>gi|159164108|pdb|2DHM|A Chain A, Solution Structure Of The Bola Protein From Escherichia Coli Length = 107 Back     alignment and structure
>gi|159163196|pdb|1V60|A Chain A, Solution Structure Of Bola1 Protein From Mus Musculus Length = 123 Back     alignment and structure
>gi|46016011|pdb|1V9J|A Chain A, Solution Structure Of A Bola-Like Protein From Mus Musculus Length = 113 Back     alignment and structure
>gi|221046468|pdb|2KDN|A Chain A, Solution Structure Of Pfe0790c, A Putative Bola-Like Protein From The Protozoan Parasite Plasmodium Falciparum Length = 108 Back     alignment and structure
>gi|299688705|pdb|2KZ0|A Chain A, Solution Structure Of A Bola Protein (Ech_0303) From Ehrlichia Chaffeensis. Seattle Structural Genomics Center For Infectious Disease Target Ehcha.10365.A Length = 76 Back     alignment and structure
>gi|308387908|pdb|3O2E|A Chain A, Crystal Structure Of A Bol-Like Protein From Babesia Bovis Length = 105 Back     alignment and structure
>gi|50513260|pdb|1NY8|A Chain A, Solution Structure Of Protein Yrba From Escherichia Coli: Northeast Structural Genomics Consortium Target Er115 Length = 97 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target79 hypothetical protein CLIBASIA_04350 [Candidatus Liberib
2kz0_A76 BOLA family protein; BOLA protein family, human monocyt 4e-21
1xs3_A80 Hypothetical protein XC975; BOLA-like, structural genom 3e-20
1ny8_A97 Protein YRBA; structure, autoassign, autostructure, NES 3e-16
3o2e_A105 BOLA-like protein; ssgcid, iodide, SAD, seattle structu 3e-14
1v9j_A113 BOLA-like protein riken cDNA 1110025L05; stationary pha 2e-13
2kdn_A108 Putative uncharacterized protein PFE0790C; solution str 8e-13
1v60_A123 BOLA1, riken cDNA 1810037G04; stationary phase morphoge 9e-13
2dhm_A107 Protein BOLA; stationary-phase, stress-induced, morphog 2e-12
>2kz0_A BOLA family protein; BOLA protein family, human monocytotropic ehrlichiosis, STRE response, structural genomics; NMR {Ehrlichia chaffeensis} Length = 76 Back     alignment and structure
 Score = 95.1 bits (237), Expect = 4e-21
 Identities = 25/75 (33%), Positives = 49/75 (65%), Gaps = 3/75 (4%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
          M++   ++E +I+   P++ +T+  L GD NHY+ ++IS +F+GK++++QH+M+Y  L  
Sbjct: 4  MTVTQSQLELLIRNAFPEAEITVTSLVGDNNHYSIKVISSQFQGKSKLEQHRMIYKVLDG 63

Query: 61 KMGNALHALSIKTSV 75
               +HA+ I+T  
Sbjct: 64 LN---IHAIQIQTGC 75


>1xs3_A Hypothetical protein XC975; BOLA-like, structural genomics, AN integrated structural and functional genomic project, unknown function; NMR {Synthetic} Length = 80 Back     alignment and structure
>1ny8_A Protein YRBA; structure, autoassign, autostructure, NESG, structural genomics, PSI, protein structure initiative; NMR {Escherichia coli} SCOP: d.52.6.1 Length = 97 Back     alignment and structure
>3o2e_A BOLA-like protein; ssgcid, iodide, SAD, seattle structural genom center for infectious disease, BOL like protein, unknown FU; 1.95A {Babesia bovis} Length = 105 Back     alignment and structure
>1v9j_A BOLA-like protein riken cDNA 1110025L05; stationary phase morphogene, stress-induced morphogene, structural genomics; NMR {Mus musculus} SCOP: d.52.6.1 Length = 113 Back     alignment and structure
>2kdn_A Putative uncharacterized protein PFE0790C; solution structure, ssgcid, seattle structural genomics center for infectious disease; NMR {Plasmodium falciparum} Length = 108 Back     alignment and structure
>1v60_A BOLA1, riken cDNA 1810037G04; stationary phase morphogene, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 123 Back     alignment and structure
>2dhm_A Protein BOLA; stationary-phase, stress-induced, morphogene, structural genomics, NPPSFA; NMR {Escherichia coli str} Length = 107 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target79 hypothetical protein CLIBASIA_04350 [Candidatus Liberib
1xs3_A80 Hypothetical protein XC975; BOLA-like, structural genom 99.93
1v9j_A113 BOLA-like protein riken cDNA 1110025L05; stationary pha 99.93
3o2e_A105 BOLA-like protein; ssgcid, iodide, SAD, seattle structu 99.93
2dhm_A107 Protein BOLA; stationary-phase, stress-induced, morphog 99.92
1v60_A123 BOLA1, riken cDNA 1810037G04; stationary phase morphoge 99.92
2kdn_A108 Putative uncharacterized protein PFE0790C; solution str 99.92
2kz0_A76 BOLA family protein; BOLA protein family, human monocyt 99.91
1ny8_A97 Protein YRBA; structure, autoassign, autostructure, NES 99.9
>1xs3_A Hypothetical protein XC975; BOLA-like, structural genomics, AN integrated structural and functional genomic project, unknown function; NMR {Synthetic} Back     alignment and structure
Probab=99.93  E-value=4.7e-27  Score=168.72  Aligned_cols=76  Identities=39%  Similarity=0.764  Sum_probs=72.8

Q ss_pred             CCCCHHHHHHHHHHCCCCCEEEEEECCCCCCEEEEEEECHHHCCCCHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCC
Q ss_conf             977889999999821996679999748999669999970466899978999999999998727972688988206788
Q gi|254780969|r    1 MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDS   78 (79)
Q Consensus         1 M~m~~~~I~~~i~~~l~~~~v~V~d~sg~~~Hf~i~VvS~~F~g~s~i~rhr~Vy~~L~~~i~~~IHAlsikt~tpee   78 (79)
                      ++|+.++|+++|+++||++.++|.|  +||+||.|+|||+.|+|+|+|+|||+||++|+++|+++||||+|+|+||+|
T Consensus         4 ~~M~~~~I~~~l~~~l~~~~i~V~d--~~g~hf~v~IvS~~F~g~~~v~Rhr~Vy~~L~~~~~~~iHAlsi~t~tp~E   79 (80)
T 1xs3_A            4 RPLDAETIRKLIESGLPEARVDVQG--EDGVHFEATVVSPAFVGKAPLARHRMVYATLGELMGGAIHALQLKTLTPDE   79 (80)
T ss_dssp             SCCHHHHHHHHHHHHSSSCEEEEES--CTTSCCEEEEECGGGCSSCCHHHHHHHHHHTTSTTTTCCSCCEEEEECGGG
T ss_pred             CCCCHHHHHHHHHHHCCCCEEEEEC--CCCCEEEEEEECHHHCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCC
T ss_conf             9989999999998349998899983--999889999963675999889999999999999976997247878078655



>1v9j_A BOLA-like protein riken cDNA 1110025L05; stationary phase morphogene, stress-induced morphogene, structural genomics; NMR {Mus musculus} SCOP: d.52.6.1 Back     alignment and structure
>3o2e_A BOLA-like protein; ssgcid, iodide, SAD, seattle structural genom center for infectious disease, BOL like protein, unknown FU; 1.95A {Babesia bovis} Back     alignment and structure
>2dhm_A Protein BOLA; stationary-phase, stress-induced, morphogene, structural genomics, NPPSFA; NMR {Escherichia coli str} Back     alignment and structure
>1v60_A BOLA1, riken cDNA 1810037G04; stationary phase morphogene, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>2kdn_A Putative uncharacterized protein PFE0790C; solution structure, ssgcid, seattle structural genomics center for infectious disease; NMR {Plasmodium falciparum} Back     alignment and structure
>2kz0_A BOLA family protein; BOLA protein family, human monocytotropic ehrlichiosis, STRE response, structural genomics; NMR {Ehrlichia chaffeensis} Back     alignment and structure
>1ny8_A Protein YRBA; structure, autoassign, autostructure, NESG, structural genomics, PSI, protein structure initiative; NMR {Escherichia coli} SCOP: d.52.6.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 79 hypothetical protein CLIBASIA_04350 [Candidatus Liberib
d1ny8a_97 d.52.6.1 (A:) Hypothetical protein YrbA {Escherichia co 7e-16
d1v9ja_113 d.52.6.1 (A:) BolA-like protein {Mouse (Mus musculus) [ 5e-13
>d1ny8a_ d.52.6.1 (A:) Hypothetical protein YrbA {Escherichia coli [TaxId: 562]} Length = 97 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Alpha-lytic protease prodomain-like
superfamily: BolA-like
family: BolA-like
domain: Hypothetical protein YrbA
species: Escherichia coli [TaxId: 562]
 Score = 76.0 bits (187), Expect = 7e-16
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
            M  +EI+ ++   +    V +    GDG+H+    + E F G +R+++ Q VY  L  
Sbjct: 4  DPMENNEIQSVLMNALSLQEVHVS---GDGSHFQVIAVGELFDGMSRVKKQQTVYGPLME 60

Query: 61 KMG-NALHALSIKTSVPD 77
           +  N +HA+SIK   P 
Sbjct: 61 YIADNRIHAVSIKAYTPA 78


>d1v9ja_ d.52.6.1 (A:) BolA-like protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 113 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target79 hypothetical protein CLIBASIA_04350 [Candidatus Liberib
d1v9ja_113 BolA-like protein {Mouse (Mus musculus) [TaxId: 10090]} 99.93
d1ny8a_97 Hypothetical protein YrbA {Escherichia coli [TaxId: 562 99.9
d1ylqa190 Putative nucleotidyltransferase AF0614 {Archaeon Archae 92.7
>d1v9ja_ d.52.6.1 (A:) BolA-like protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Alpha-lytic protease prodomain-like
superfamily: BolA-like
family: BolA-like
domain: BolA-like protein
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.93  E-value=7.7e-27  Score=166.24  Aligned_cols=77  Identities=21%  Similarity=0.451  Sum_probs=74.3

Q ss_pred             CCCCHHHHHHHHHHCCCCCEEEEEECC--CCCCEEEEEEECHHHCCCCHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCC
Q ss_conf             977889999999821996679999748--999669999970466899978999999999998727972688988206788
Q gi|254780969|r    1 MSMNPHEIEKMIKKGIPQSIVTIHDLA--GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDS   78 (79)
Q Consensus         1 M~m~~~~I~~~i~~~l~~~~v~V~d~s--g~~~Hf~i~VvS~~F~g~s~i~rhr~Vy~~L~~~i~~~IHAlsikt~tpee   78 (79)
                      |++++++|+++|++.|++.+++|.|+|  |+|+||+|+|||+.|.|+|+|+|||+||++|+++|+ +||||+|+|+||+|
T Consensus        28 m~~~~e~I~~kL~~~~~~~~leV~D~S~~h~G~Hf~i~IvS~~F~g~s~v~rHr~Vy~~L~~ei~-~iHAlsi~t~Tp~E  106 (113)
T d1v9ja_          28 MELSADYLREKLRQDLEAEHVEVEDTTLNRCATSFRVLVVSAKFEGKPLLQRHRLVNECLAEELP-HIHAFEQKTLTPEQ  106 (113)
T ss_dssp             SSSCHHHHHHHHHHHHTCSEEEEEECCSSSSCCCEEEEEECSHHHHSCHHHHHHHHHHHTTTTGG-GCSSEEEEEECHHH
T ss_pred             CCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHH-CCEEEEEEECCHHH
T ss_conf             76369999999984489837999966789987059999986021477440788947999999972-04204878189999



>d1ny8a_ d.52.6.1 (A:) Hypothetical protein YrbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ylqa1 d.218.1.5 (A:1-90) Putative nucleotidyltransferase AF0614 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 79 hypothetical protein CLIBASIA_04350 [Candidatus Li
1xs3_A_80 (A:) Hypothetical protein XC975; BOLA-like, struct 3e-17
1v60_A_123 (A:) BOLA1, riken cDNA 1810037G04; stationary phas 3e-16
2dhm_A_107 (A:) Protein BOLA; stationary-phase, stress-induce 3e-16
2kdn_A_108 (A:) Putative uncharacterized protein PFE0790C; so 9e-16
1ny8_A_97 (A:) Protein YRBA; structure, autoassign, autostru 2e-15
1v9j_A_113 (A:) BOLA-like protein riken cDNA 1110025L05; stat 2e-15
>1xs3_A (A:) Hypothetical protein XC975; BOLA-like, structural genomics, AN integrated structural and functional genomic project, unknown function; NMR {Synthetic}Length = 80 Back     alignment and structure
 Score = 81.7 bits (202), Expect = 3e-17
 Identities = 30/77 (38%), Positives = 47/77 (61%), Gaps = 2/77 (2%)

Query: 1  MSMNPHEIEKMIKKGIPQSIVTIHDLAGDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGN 60
            ++   I K+I+ G+P++ V +     DG H+ A ++S  F GK  + +H+MVY +LG 
Sbjct: 4  RPLDAETIRKLIESGLPEARVDVQG--EDGVHFEATVVSPAFVGKAPLARHRMVYATLGE 61

Query: 61 KMGNALHALSIKTSVPD 77
           MG A+HAL +KT  PD
Sbjct: 62 LMGGAIHALQLKTLTPD 78


>1v60_A (A:) BOLA1, riken cDNA 1810037G04; stationary phase morphogene, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus}Length = 123 Back     alignment and structure
>2dhm_A (A:) Protein BOLA; stationary-phase, stress-induced, morphogene, structural genomics, NPPSFA; NMR {Escherichia coli str}Length = 107 Back     alignment and structure
>2kdn_A (A:) Putative uncharacterized protein PFE0790C; solution structure, ssgcid, seattle structural genomics center for infectious disease; NMR {Plasmodium falciparum}Length = 108 Back     alignment and structure
>1ny8_A (A:) Protein YRBA; structure, autoassign, autostructure, NESG, structural genomics, PSI, protein structure initiative; NMR {Escherichia coli}Length = 97 Back     alignment and structure
>1v9j_A (A:) BOLA-like protein riken cDNA 1110025L05; stationary phase morphogene, stress-induced morphogene, structural genomics; NMR {Mus musculus}Length = 113 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target79 hypothetical protein CLIBASIA_04350 [Candidatus Liberib
2kdn_A_108 Putative uncharacterized protein PFE0790C; solutio 99.94
1v60_A_123 BOLA1, riken cDNA 1810037G04; stationary phase mor 99.94
1v9j_A_113 BOLA-like protein riken cDNA 1110025L05; stationar 99.93
2dhm_A_107 Protein BOLA; stationary-phase, stress-induced, mo 99.93
1xs3_A_80 Hypothetical protein XC975; BOLA-like, structural 99.93
1ny8_A_97 Protein YRBA; structure, autoassign, autostructure 99.92
>2kdn_A (A:) Putative uncharacterized protein PFE0790C; solution structure, ssgcid, seattle structural genomics center for infectious disease; NMR {Plasmodium falciparum} Back     alignment and structure
Probab=99.94  E-value=1.6e-27  Score=172.18  Aligned_cols=77  Identities=23%  Similarity=0.414  Sum_probs=73.4

Q ss_pred             CCCCHHHHHHHHHHCCCCCEEEEEECC-CCCCEEEEEEECHHHCCCCHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCC
Q ss_conf             977889999999821996679999748-999669999970466899978999999999998727972688988206788
Q gi|254780969|r    1 MSMNPHEIEKMIKKGIPQSIVTIHDLA-GDGNHYAAEIISEEFRGKNRIQQHQMVYDSLGNKMGNALHALSIKTSVPDS   78 (79)
Q Consensus         1 M~m~~~~I~~~i~~~l~~~~v~V~d~s-g~~~Hf~i~VvS~~F~g~s~i~rhr~Vy~~L~~~i~~~IHAlsikt~tpee   78 (79)
                      |.|..++|+++|+.+|++++++|.|+| |||+||+|.|||+.|+|+|+|+|||+||++|+++|+ +||||+|+|+||+|
T Consensus        22 ~~~~~~~I~~~L~~~l~~~~i~V~d~S~g~g~hf~v~VVS~~F~G~s~v~RHr~V~~~L~e~i~-~iHAlsi~t~tp~E   99 (108)
T 2kdn_A           22 HMCIQKVIEDKLSSALKPTFLELVDKSCGCGTSFDAVIVSNNFEDKKLLDRHRLVNTILKEELQ-NIHAFSMKCHTPLE   99 (108)
T ss_dssp             SCSHHHHHHHHHHHHHCCSEEEEEECCCSSSCCEEEEEECGGGTTCCHHHHHHHHHHHHHHHGG-GCSCEEEEEECHHH
T ss_pred             CCCHHHHHHHHHHHHCCCCEEEEEECCCCCCCEEEEEEECHHHCCCCHHHHHHHHHHHHHHHHH-CCCCEEEEECCHHH
T ss_conf             6539999999998558997689997899987679999982787799689999999999999971-24104878089999



>1v60_A (A:) BOLA1, riken cDNA 1810037G04; stationary phase morphogene, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>1v9j_A (A:) BOLA-like protein riken cDNA 1110025L05; stationary phase morphogene, stress-induced morphogene, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2dhm_A (A:) Protein BOLA; stationary-phase, stress-induced, morphogene, structural genomics, NPPSFA; NMR {Escherichia coli str} Back     alignment and structure
>1xs3_A (A:) Hypothetical protein XC975; BOLA-like, structural genomics, AN integrated structural and functional genomic project, unknown function; NMR {Synthetic} Back     alignment and structure
>1ny8_A (A:) Protein YRBA; structure, autoassign, autostructure, NESG, structural genomics, PSI, protein structure initiative; NMR {Escherichia coli} Back     alignment and structure