254780970

254780970

phosphoribosylformylglycinamidine synthase II

GeneID in NCBI database:8209992Locus tag:CLIBASIA_04355
Protein GI in NCBI database:254780970Protein Accession:YP_003065383.1
Gene range:-(965900, 968113)Protein Length:737aa
Gene description:phosphoribosylformylglycinamidine synthase II
COG prediction:[F] Phosphoribosylformylglycinamidine (FGAM) synthase, synthetase domain
KEGG prediction:purL; phosphoribosylformylglycinamidine synthase II (EC:6.3.5.3); K01952 phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
SEED prediction:Phosphoribosylformylglycinamidine synthase, synthetase subunit (EC 6.3.5.3)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
Subsystem involved in SEED:De Novo Purine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------
MSKPSPILEILTAHGLTKDECDQIIHILKRQPTLTEIGIISAMWNEHCSYKSSKKWLRTLPTTGKHVIQGPGENAGVVDIGGGDCVVFKMESHNHPSYIEPYQGAATGVGGILRDIFTMGARPVAAMNSLRFGAIHHPKTKHLLSGVVAGIAGYSNSFGVPTVGGEVEFLPCYNNNIIVNTFAAGIAKTNAIFSSKARGIGLPLVYLGAKTGRDGIGGASMASEEFGENIAKKRPTVQVGDPFTGKCLLEACLELMNTDAVIAIQDMGAAGLTCSAIEMGNQGNLGITLDLDKVPTCEEGMTAYEMMLSESQERMLMILNPEKQHKAQEILNKWGLHFSIIGITTNDKLFRVIHRGEEVANLPIKALSDEAPEYDRAWCEPITIPPSNPQLLCSDEDCTKSLLKLLSSPNLSSRRWVYEQYDTMIQSNSIQLPGGDAGVIRVEGHETKALAFSSDVTPRYVKADPFEGTKQAVAECWRNIIATGAKPLAITDNLNFGNPEKEEIMGQFVHSVKGIREACQILDFPIVSGNVSFYNETNGQSIFPTPTIAGVGILPDYSLMTRIDSAHEGDLILMIGNDGCHLDCSMYSLECASSNIGPPPKVDCHLEKNHGFFVLSMINAKKITACHDISTGGLIITLAEMTISSAKGMDIILPIEIEKDPKPFLFGEDQGRYVVCISPENQDLVMSEANNKNIPLRYLGKVSGSTLSIHNILNIPVATLQTKYESWFPEFISESTV
ccccHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccHHHHHHcccccccEEEcccccEEEEEccccEEEEEEEcccccccccccccccccccccEEEHHHccccEEEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHcccEEcccEEEEEEcccccEEEEEEEEEEEEHHHHHcccccccccEEEEEccccccccccHHHHHHHHHccccHHccccHHcccHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHccccEEEEHHHcccccccccHHHHHHcccccEEEEEEccccHHHHHHHHHHccccEEEEEEEEcccEEEEEEcccEEEEEEHHHHcccccEEEEcccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHcccccccccEEcccccEEEEEccccccEEEEEEEccccccEEccHHHHHHHHHHHHHHHHHHHccHHHHEEHHHHcccccccHHHHHHHHHHHHHHHHHHHcccEEEccccccccccccccccccEEEEEEEEEcccccEEcccccccccEEEEEccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHcccccEEEEccccccccHHHHHHccccccEEEEEcHHHHHHHHHHHHHccccEEEEEEEcccEEEEEccccccHHHHHHHHHHHHHHHHHcccc
cccccccHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHccccccccHHHHHcccccccEEEEccccccEEEEcccccEEEEEEEcccccccccccccccccHHHHHHHHHHHcccHHHHHHHHccccccccccEEEEccEEEccccccccccccccccEEEEcccccccccHHEEEEEEEccHHHHHHHcccccccEEEEEcccccccccccEEccccccHHHHHccccEEcccHHHHHHHHHHHHHHHHcccEEEEEccccccccccHHHHHHccccEEEEEccccccccccccHHHHHHcccHHHHEEEEccccHHHHHHHHHHccccEEEEEEEccccEEEEEEccEEEEEccHHHHHHccccccccccccccHHHHccccccccccHHHHHHHHHcccccccHHHHHHHHcHHccccEEEcccccEEEEEEEcccccEEEEEEccccEEEEcccHHHHHHHHHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHccccEEcccEEEEEcccccEEccccEEEEEEEHccHHHHccccccccccEEEEEEcccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHcccHHEHccccHHHHHHHHHHHHHHccccEEEEEccccccccHHHHEcccccEEEEEEcHHHHHHHHHHHHHccccEEEEEEEcccEEEEEccEEccHHHHHHHHHHHHHHHcccccc
MSKPSPILEILtahgltkdeCDQIIHILKRQPTLTEIGIISAMWNEhcsyksskkwlrtlpttgkhviqgpgenagvvdigGGDCVVFKMeshnhpsyiepyqgaatgvggiLRDIFTMGARPVAAMNslrfgaihhpktkhLLSGVVAGIAgysnsfgvptvggeveflpcynnniIVNTFAAGIAKtnaifsskargiglplvylgaktgrdgiggasmaseefgeniakkrptvqvgdpftgKCLLEACLELMNTDAVIAIQDMGaagltcsaiemgnqgnlgitldldkvptceegMTAYEMMLSESQERMLMILNPEKQHKAQEILNKWGLHFSIIGITTNDKLFRVIHRGeevanlpikalsdeapeydrawcepitippsnpqllcsdedCTKSLLKLlsspnlssrrWVYEQYDTmiqsnsiqlpggdagvirveghetkalafssdvtpryvkadpfegtKQAVAECWRNIIatgakplaitdnlnfgnpekeeIMGQFVHSVKGIREACqildfpivsgnvsfynetngqsifptptiagvgilpdyslmtridsahegdLILMIgndgchldcsmyslecassnigpppkvdchleknhGFFVLSMINakkitachdistgGLIITLAEMTissakgmdiilpieiekdpkpflfgedqgryvvcispenqdlvmseannkniplrylgkvsgstlsihnilnipvatlqtkyeswfpefisestv
MSKPSPILEILTAHGLTKDECDQIIHILKRQPTLTEIGIISAMWNEHCSYKSSKKWLRTLPTTGkhviqgpgenagvVDIGGGDCVVFKMESHNHPSYIEPYQGAATGVGGILRDIFTMGARPVAAMNSLRFGAIHHPKTKHLLSGVVAGIAGYSNSFGVPTVGGEVEFLPCYNNNIIVNTFAAGIAKTNAIFSSKARGIGLPLVYLGAKTGRDGIGGASMASEEFGeniakkrptvqvgdPFTGKCLLEACLELMNTDAVIAIQDMGAAGLTCSAIEMGNQGNLGITLDLDKVPTCEEGMTAYEMMLSESQERMLMILNPEKQHKAQEILNKWGLHFSIIGITTNDKLFRVIHRGEevanlpikalSDEAPEYDRAWCEPITIPPSNPQLLCSDEDCTKSLLKllsspnlssrRWVYEQYDTMIQSNSIQLPGGDAGVIRVEGHETKalafssdvtpryVKADPFEGTKQAVAECWRNIIATGAKPLAITDNLNFGNPEKEEIMGQFVHSVKGIREACQILDFPIVSGNVSFYNETNGQSIFPTPTIAGVGILPDYSLMTRIDSAHEGDLILMIGNDGCHLDCSMYSLECASSNIGPPPKVDCHLEKNHGFFVLSMINAKKITACHDISTGGLIITLAEMTISSAKGMDIILPIEIEKDPKPFLFGEDQGRYVVCISPENQDLVMSEANNKNIPLRYLGKVSGSTLSIHNILNIPVATLQTKYEswfpefisestv
MSKPSPILEILTAHGLTKDECDQIIHILKRQPTLTEIGIISAMWNEHCSYKSSKKWLRTLPTTGKHVIQGPGENAgvvdigggdcvvFKMESHNHPSYIEPYQGAATGVGGILRDIFTMGARPVAAMNSLRFGAIHHPKTKHLLSGVVAGIAGYSNSFGVPTVGGEVEFLPCYNNNIIVNTFAAGIAKTNAIFSSKARGIGLPLVYLGAKTGRDGIGGASMASEEFGENIAKKRPTVQVGDPFTGKCLLEACLELMNTDAVIAIQDMGAAGLTCSAIEMGNQGNLGITLDLDKVPTCEEGMTAYEMMLSESQERMLMILNPEKQHKAQEILNKWGLHFSIIGITTNDKLFRVIHRGEEVANLPIKALSDEAPEYDRAWCEPITIPPSNPQLLCSDEDCTKsllkllsspnlssRRWVYEQYDTMIQSNSIQLPGGDAGVIRVEGHETKALAFSSDVTPRYVKADPFEGTKQAVAECWRNIIATGAKPLAITDNLNFGNPEKEEIMGQFVHSVKGIREACQILDFPIVSGNVSFYNETNGQSIFPTPTIAGVGILPDYSLMTRIDSAHEGDLILMIGNDGCHLDCSMYSLECASSNIGPPPKVDCHLEKNHGFFVLSMINAKKITACHDISTGGLIITLAEMTISSAKGMDIILPIEIEKDPKPFLFGEDQGRYVVCISPENQDLVMSEANNKNIPLRYLGKVSGSTLSIHNILNIPVATLQTKYESWFPEFISESTV
******I***LTAHGLTKDECDQIIHILKRQPTLTEIGIISAMWNEHCSYKSSKKWLRTLPTTGKHVIQGPGENAGVVDIGGGDCVVFKMESHNHPSYIEPYQGAATGVGGILRDIFTMGARPVAAMNSLRFGAIHHPKTKHLLSGVVAGIAGYSNSFGVPTVGGEVEFLPCYNNNIIVNTFAAGIAKTNAIFSSKARGIGLPLVYLGAKTGRDGIGGASM****************QVGDPFTGKCLLEACLELMNTDAVIAIQDMGAAGLTCSAIEMGNQGNLGITLDLDKVPTCEEGMTAYEMMLSESQERMLMILNPEKQHKAQEILNKWGLHFSIIGITTNDKLFRVIHRGEEVANLPIKALSDEAPEYDRAWCEPITIP*******CSDEDCTKSLLKLLSSPNLSSRRWVYEQYDTMIQSNSIQLPGGDAGVIRVEGHETKALAFSSDVTPRYVKADPFEGTKQAVAECWRNIIATGAKPLAITDNLNFGNPEKEEIMGQFVHSVKGIREACQILDFPIVSGNVSFYNETNGQSIFPTPTIAGVGILPDYSLMTRIDSAHEGDLILMIGNDGCHLDCSMYSLECASSNIGPPPKVDCHLEKNHGFFVLSMINAKKITACHDISTGGLIITLAEMTISSAKGMDIILPIEIEKDPKPFLFGEDQGRYVVCISPENQDLVMSEANNKNIPLRYLGKVSGSTLSIHNILNIPVATLQTKYESWFPEFISES**
MSKPSPILEILTAHGLTKDECDQIIHILKRQPTLTEIGIISAMWNEHCSYKSSKKWLRTLPTTGKHVIQGPGENAGVVDIGGGDCVVFKMESHNHPSYIEPYQGAATGVGGILRDIFTMGARPVAAMNSLRFGAIHHPKTKHLLSGVVAGIAGYSNSFGVPTVGGEVEFLPCYNNNIIVNTFAAGIAKTNAIFSSKARGIGLPLVYLGAKTGRDGIGGASMASEEFGENIAKKRPTVQVGDPFTGKCLLEACLELMNTDAVIAIQDMGAAGLTCSAIEMGNQGNLGITLDLDKVPTCEEGMTAYEMMLSESQERMLMILNPEKQHKAQEILNKWGLHFSIIGITTNDKLFRVIHRGEEVANLPIKALSDEAPEYDRAWCEPITIPPSNPQLLCSDEDCTKSLLKLLSSPNLSSRRWVYEQYDTMIQSNSIQLPGGDAGVIRVEGHETKALAFSSDVTPRYVKADPFEGTKQAVAECWRNIIATGAKPLAITDNLNFGNPEKEEIMGQFVHSVKGIREACQILDFPIVSGNVSFYNETNGQSIFPTPTIAGVGILPDYSLMTRIDSAHEGDLILMIGNDGCHLDCSMYSLECASSNIGPPPKVDCHLEKNHGFFVLSMINAKKITACHDISTGGLIITLAEMTISSAKGMDIILPIEIEKDPKPFLFGEDQGRYVVCISPENQDLVMSEANNKNIPLRYLGKVSGSTLSIHNILNIPVATLQTKYESWFPEFISESTV
****SPILEILTAHGLTKDECDQIIHILKRQPTLTEIGIISAMWNEHCSYKSSKKWLRTLPTTGKHVIQGPGENAGVVDIGGGDCVVFKMESHNHPSYIEPYQGAATGVGGILRDIFTMGARPVAAMNSLRFGAIHHPKTKHLLSGVVAGIAGYSNSFGVPTVGGEVEFLPCYNNNIIVNTFAAGIAKTNAIFSSKARGIGLPLVYLGAKTGRDGIGGASMASEEFGENIAKKRPTVQVGDPFTGKCLLEACLELMNTDAVIAIQDMGAAGLTCSAIEMGNQGNLGITLDLDKVPTCEEGMTAYEMMLSESQERMLMILNPEKQHKAQEILNKWGLHFSIIGITTNDKLFRVIHRGEEVANLPIKALSDEAPEYDRAWCEPITIPPSNPQLLCSDEDCTKSLLKLLSSPNLSSRRWVYEQYDTMIQSNSIQLPGGDAGVIRVEGHETKALAFSSDVTPRYVKADPFEGTKQAVAECWRNIIATGAKPLAITDNLNFGNPEKEEIMGQFVHSVKGIREACQILDFPIVSGNVSFYNETNGQSIFPTPTIAGVGILPDYSLMTRIDSAHEGDLILMIGNDGCHLDCSMYSLECASSNIGPPPKVDCHLEKNHGFFVLSMINAKKITACHDISTGGLIITLAEMTISSAKGMDIILPIEIEKDPKPFLFGEDQGRYVVCISPENQDLVMSEANNKNIPLRYLGKVSGSTLSIHNILNIPVATLQTKYESWFPEFIS****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKPSPILEILTAHGLTKDECDQIIHILKRQPTLTEIGIISAMWNEHCSYKSSKKWLRTLPTTGKHVIQGPGENAGVVDIGGGDCVVFKMESHNHPSYIEPYQGAATGVGGILRDIFTMGARPVAAMNSLRFGAIHHPKTKHLLSGVVAGIAGYSNSFGVPTVGGEVEFLPCYNNNIIVNTFAAGIAKTNAIFSSKARGIGLPLVYLGAKTGRDGIGGASMASEEFGENIAKKRPTVQVGDPFTGKCLLEACLELMNTDAVIAIQDMGAAGLTCSAIEMGNQGNLGITLDLDKVPTCEEGMTAYEMMLSESQERMLMILNPEKQHKAQEILNKWGLHFSIIGITTNDKLFRVIHRGEEVANLPIKALSDEAPEYDRAWCEPITIPPSNPQLLCSDEDCTKSLLKLLSSPNLSSRRWVYEQYDTMIQSNSIQLPGGDAGVIRVEGHETKALAFSSDVTPRYVKADPFEGTKQAVAECWRNIIATGAKPLAITDNLNFGNPEKEEIMGQFVHSVKGIREACQILDFPIVSGNVSFYNETNGQSIFPTPTIAGVGILPDYSLMTRIDSAHEGDLILMIGNDGCHLDCSMYSLECASSNIGPPPKVDCHLEKNHGFFVLSMINAKKITACHDISTGGLIITLAEMTISSAKGMDIILPIEIEKDPKPFLFGEDQGRYVVCISPENQDLVMSEANNKNIPLRYLGKVSGSTLSIHNILNIPVATLQTKYESWFPEFISESTV
MSKPSPILEILTAHGLTKDECDQIIHILKRQPTLTEIGIISAMWNEHCSYKSSKKWLRTLPTTGKHVIQGPGENAGVVDIGGGDCVVFKMESHNHPSYIEPYQGAATGVGGILRDIFTMGARPVAAMNSLRFGAIHHPKTKHLLSGVVAGIAGYSNSFGVPTVGGEVEFLPCYNNNIIVNTFAAGIAKTNAIFSSKARGIGLPLVYLGAKTGRDGIGGASMASEEFGENIAKKRPTVQVGDPFTGKCLLEACLELMNTDAVIAIQDMGAAGLTCSAIEMGNQGNLGITLDLDKVPTCEEGMTAYEMMLSESQERMLMILNPEKQHKAQEILNKWGLHFSIIGITTNDKLFRVIHRGEEVANLPIKALSDEAPEYDRAWCEPITIPPSNPQLLCSDEDCTKSLLKLLSSPNLSSRRWVYEQYDTMIQSNSIQLPGGDAGVIRVEGHETKALAFSSDVTPRYVKADPFEGTKQAVAECWRNIIATGAKPLAITDNLNFGNPEKEEIMGQFVHSVKGIREACQILDFPIVSGNVSFYNETNGQSIFPTPTIAGVGILPDYSLMTRIDSAHEGDLILMIGNDGCHLDCSMYSLECASSNIGPPPKVDCHLEKNHGFFVLSMINAKKITACHDISTGGLIITLAEMTISSAKGMDIILPIEIEKDPKPFLFGEDQGRYVVCISPENQDLVMSEANNKNIPLRYLGKVSGSTLSIHNILNIPVATLQTKYESWFPEFISESTV
MSKPSPILEILTAHGLTKDECDQIIHILKRQPTLTEIGIISAMWNEHCSYKSSKKWLRTLPTTGKHVIQGPGENAGVVDIGGGDCVVFKMESHNHPSYIEPYQGAATGVGGILRDIFTMGARPVAAMNSLRFGAIHHPKTKHLLSGVVAGIAGYSNSFGVPTVGGEVEFLPCYNNNIIVNTFAAGIAKTNAIFSSKARGIGLPLVYLGAKTGRDGIGGASMASEEFGENIAKKRPTVQVGDPFTGKCLLEACLELMNTDAVIAIQDMGAAGLTCSAIEMGNQGNLGITLDLDKVPTCEEGMTAYEMMLSESQERMLMILNPEKQHKAQEILNKWGLHFSIIGITTNDKLFRVIHRGEEVANLPIKALSDEAPEYDRAWCEPITIPPSNPQLLCSDEDCTKSLLKLLSSPNLSSRRWVYEQYDTMIQSNSIQLPGGDAGVIRVEGHETKALAFSSDVTPRYVKADPFEGTKQAVAECWRNIIATGAKPLAITDNLNFGNPEKEEIMGQFVHSVKGIREACQILDFPIVSGNVSFYNETNGQSIFPTPTIAGVGILPDYSLMTRIDSAHEGDLILMIGNDGCHLDCSMYSLECASSNIGPPPKVDCHLEKNHGFFVLSMINAKKITACHDISTGGLIITLAEMTISSAKGMDIILPIEIEKDPKPFLFGEDQGRYVVCISPENQDLVMSEANNKNIPLRYLGKVSGSTLSIHNILNIPVATLQTKYESWFPEFISESTV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target737 phosphoribosylformylglycinamidine synthase II [Candidat
315122612730 phosphoribosylformylglycinamidine synthase II [Candidat 1 0.0
116252358744 phosphoribosylformylglycinamidine synthase II [Rhizobiu 1 0.0
190891986743 phosphoribosylformylglycinamidine synthase, synthetase 1 0.0
327190542743 phosphoribosylformylglycinamidine synthase protein, syn 1 0.0
209549528743 phosphoribosylformylglycinamidine synthase II [Rhizobiu 1 0.0
241204864744 phosphoribosylformylglycinamidine synthase II [Rhizobiu 1 0.0
86357901743 phosphoribosylformylglycinamidine synthase II [Rhizobiu 1 0.0
222086139743 phosphoribosylformylglycinamidine synthase II [Agrobact 1 0.0
153009717740 phosphoribosylformylglycinamidine synthase II [Ochrobac 1 0.0
254704149740 phosphoribosylformylglycinamidine synthase II [Brucella 1 0.0
>gi|315122612|ref|YP_004063101.1| phosphoribosylformylglycinamidine synthase II [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 730 Back     alignment and organism information
 Score = 1281 bits (3314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 617/733 (84%), Positives = 671/733 (91%), Gaps = 3/733 (0%)

Query: 1   MSKPSPILEILTAHGLTKDECDQIIHILKRQPTLTEIGIISAMWNEHCSYKSSKKWLRTL 60
           MSK    +EI   HGLT +E DQI+ I++RQPTLTEIGIISAMWNEHCSYKSSKKWL+TL
Sbjct: 1   MSKSLSTIEICAMHGLTHNEYDQILKIIQRQPTLTEIGIISAMWNEHCSYKSSKKWLKTL 60

Query: 61  PTTGKHVIQGPGENAGVVDIGGGDCVVFKMESHNHPSYIEPYQGAATGVGGILRDIFTMG 120
           PTTGKH+IQGPGENAGVVDIG GDCVVFKMESHNHPSYIEPYQGAATGVGGILRDIFTMG
Sbjct: 61  PTTGKHIIQGPGENAGVVDIGDGDCVVFKMESHNHPSYIEPYQGAATGVGGILRDIFTMG 120

Query: 121 ARPVAAMNSLRFGAIHHPKTKHLLSGVVAGIAGYSNSFGVPTVGGEVEFLPCYNNNIIVN 180
           ARPVA MNSLRFG+++HPKTKHLLSGVVAGIAGYSNSFGVPTVGGEVEFLPCYN+NIIVN
Sbjct: 121 ARPVAVMNSLRFGSVNHPKTKHLLSGVVAGIAGYSNSFGVPTVGGEVEFLPCYNDNIIVN 180

Query: 181 TFAAGIAKTNAIFSSKARGIGLPLVYLGAKTGRDGIGGASMASEEFGENIAKKRPTVQVG 240
            FAAG+AKT+AIFSSKA+G+GLP+VYLGAKTGRDGIGGASMASEEFGEN  +KRPTVQVG
Sbjct: 181 AFAAGLAKTDAIFSSKAKGVGLPIVYLGAKTGRDGIGGASMASEEFGENTLEKRPTVQVG 240

Query: 241 DPFTGKCLLEACLELMNTDAVIAIQDMGAAGLTCSAIEMGNQGNLGITLDLDKVPTCEEG 300
           DPFTGKCLLEAC+ELM T+AVIAIQDMGAAGLTCSA+EMGNQG+LGI L+LD+VP+ EEG
Sbjct: 241 DPFTGKCLLEACMELMQTNAVIAIQDMGAAGLTCSAVEMGNQGDLGIQLNLDQVPS-EEG 299

Query: 301 MTAYEMMLSESQERMLMILNPEKQHKAQEILNKWGLHFSIIGITTNDKLFRVIHRGEEVA 360
           MTAYEMMLSESQERMLMILNPE Q KAQ+I NKWGLHFSIIGITT+D  FRVIHRGEEVA
Sbjct: 300 MTAYEMMLSESQERMLMILNPENQKKAQDIFNKWGLHFSIIGITTDDMRFRVIHRGEEVA 359

Query: 361 NLPIKALSDEAPEYDRAWCEPITIPPSNPQLLCSDEDCTKSLLKLLSSPNLSSRRWVYEQ 420
           NLPIK LSD+APEYDRAWC+P+ +P SNP+LL S E     LLKLLSSPNLSSRRWVYEQ
Sbjct: 360 NLPIKDLSDKAPEYDRAWCKPVILPSSNPELLRSHEGYACILLKLLSSPNLSSRRWVYEQ 419

Query: 421 YDTMIQSNSIQLPGGDAGVIRVEGHETKALAFSSDVTPRYVKADPFEGTKQAVAECWRNI 480
           YDT+IQ NSIQLPGGDAGVIRVEGH+TKALAFSSDVTPRYVKADPFEG KQAVAECWRNI
Sbjct: 420 YDTIIQGNSIQLPGGDAGVIRVEGHKTKALAFSSDVTPRYVKADPFEGAKQAVAECWRNI 479

Query: 481 IATGAKPLAITDNLNFGNPEKEEIMGQFVHSVKGIREACQILDFPIVSGNVSFYNETNGQ 540
           IATGAKPLAITDNLNFGNPEKEE MGQFVHS+KGIREACQILDFPIVSGNVSFYNETNGQ
Sbjct: 480 IATGAKPLAITDNLNFGNPEKEETMGQFVHSIKGIREACQILDFPIVSGNVSFYNETNGQ 539

Query: 541 SIFPTPTIAGVGILPDYSLMTRIDSAHEGDLILMIGNDGCHLDCSMYSLECASSNIGPPP 600
           SIFPTPTIAGVGI+PD+S MTRI SA EG+LILM+GNDGCHLDCS+YSLECAS++IGPPP
Sbjct: 540 SIFPTPTIAGVGIIPDWSTMTRIGSACEGNLILMVGNDGCHLDCSIYSLECASADIGPPP 599

Query: 601 KVDCHLEKNHGFFVLSMINAKKITACHDISTGGLIITLAEMTISSAKGMDIILPIEIEKD 660
           KVDCHLEK HG F+LSMIN K ITACHDISTGGLIITLAEM +SS KGMDIILP   EKD
Sbjct: 600 KVDCHLEKCHGDFILSMINDKHITACHDISTGGLIITLAEMALSSGKGMDIILP--EEKD 657

Query: 661 PKPFLFGEDQGRYVVCISPENQDLVMSEANNKNIPLRYLGKVSGSTLSIHNILNIPVATL 720
           P PFLFGEDQGRYV+CI PE +D ++ +A NKNIP+R LG VSG TL I NIL+IP+  L
Sbjct: 658 PTPFLFGEDQGRYVICIPPEIRDSIILQAYNKNIPMRCLGVVSGHTLCIRNILDIPLPIL 717

Query: 721 QTKYESWFPEFIS 733
           Q KYESWFPE+++
Sbjct: 718 QEKYESWFPEYMN 730


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|116252358|ref|YP_768196.1| phosphoribosylformylglycinamidine synthase II [Rhizobium leguminosarum bv. viciae 3841] Length = 744 Back     alignment and organism information
>gi|190891986|ref|YP_001978528.1| phosphoribosylformylglycinamidine synthase, synthetase domain [Rhizobium etli CIAT 652] Length = 743 Back     alignment and organism information
>gi|327190542|gb|EGE57636.1| phosphoribosylformylglycinamidine synthase protein, synthetase domain-containing protein [Rhizobium etli CNPAF512] Length = 743 Back     alignment and organism information
>gi|209549528|ref|YP_002281445.1| phosphoribosylformylglycinamidine synthase II [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 743 Back     alignment and organism information
>gi|241204864|ref|YP_002975960.1| phosphoribosylformylglycinamidine synthase II [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 744 Back     alignment and organism information
>gi|86357901|ref|YP_469793.1| phosphoribosylformylglycinamidine synthase II [Rhizobium etli CFN 42] Length = 743 Back     alignment and organism information
>gi|222086139|ref|YP_002544671.1| phosphoribosylformylglycinamidine synthase II [Agrobacterium radiobacter K84] Length = 743 Back     alignment and organism information
>gi|153009717|ref|YP_001370932.1| phosphoribosylformylglycinamidine synthase II [Ochrobactrum anthropi ATCC 49188] Length = 740 Back     alignment and organism information
>gi|254704149|ref|ZP_05165977.1| phosphoribosylformylglycinamidine synthase II [Brucella suis bv. 3 str. 686] Length = 740 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target737 phosphoribosylformylglycinamidine synthase II [Candidat
PRK01213724 PRK01213, PRK01213, phosphoribosylformylglycinamidine s 0.0
TIGR01736715 TIGR01736, FGAM_synth_II, phosphoribosylformylglycinami 0.0
COG0046743 COG0046, PurL, Phosphoribosylformylglycinamidine (FGAM) 0.0
cd02203313 cd02203, PurL_repeat1, PurL subunit of the formylglycin 1e-129
cd06061298 cd06061, PurM-like1, AIR synthase (PurM) related protei 4e-09
TIGR03267323 TIGR03267, methan_mark_2, putative methanogenesis marke 8e-09
COG2144324 COG2144, COG2144, Selenophosphate synthetase-related pr 2e-08
COG0611317 COG0611, ThiL, Thiamine monophosphate kinase [Coenzyme 2e-08
cd02194291 cd02194, ThiL, ThiL (Thiamine-monophosphate kinase) pla 0.001
COG1973449 COG1973, HypE, Hydrogenase maturation factor [Posttrans 0.002
cd02691346 cd02691, PurM-like2, AIR synthase (PurM) related protei 0.003
PRK14090601 PRK14090, PRK14090, phosphoribosylformylglycinamidine s 1e-109
cd02204264 cd02204, PurL_repeat2, PurL subunit of the formylglycin 6e-82
cd00396222 cd00396, PurM-like, AIR (aminoimidazole ribonucleotide) 2e-17
PHA03366 1304 PHA03366, PHA03366, FGAM-synthase; Provisional 3e-16
COG2144324 COG2144, COG2144, Selenophosphate synthetase-related pr 6e-14
cd02193272 cd02193, PurL, Formylglycinamide ribonucleotide amidotr 5e-13
cd02194291 cd02194, ThiL, ThiL (Thiamine-monophosphate kinase) pla 1e-09
COG0309339 COG0309, HypE, Hydrogenase maturation factor [Posttrans 9e-08
TIGR02124320 TIGR02124, hypE, hydrogenase expression/formation prote 4e-06
KOG1907 1320 KOG1907, KOG1907, KOG1907, Phosphoribosylformylglycinam 1e-44
TIGR01857 1239 TIGR01857, FGAM-synthase, phosphoribosylformylglycinami 3e-34
cd02193272 cd02193, PurL, Formylglycinamide ribonucleotide amidotr 2e-41
cd00396222 cd00396, PurM-like, AIR (aminoimidazole ribonucleotide) 2e-24
cd02204264 cd02204, PurL_repeat2, PurL subunit of the formylglycin 1e-13
COG0309339 COG0309, HypE, Hydrogenase maturation factor [Posttrans 1e-11
cd02195287 cd02195, SelD, Selenophosphate synthetase (SelD) cataly 4e-04
TIGR01735 1310 TIGR01735, FGAM_synt, phosphoribosylformylglycinamidine 2e-36
pfam02769150 pfam02769, AIRS_C, AIR synthase related protein, C-term 8e-26
TIGR017391202 TIGR01739, tegu_FGAM_synt, herpesvirus tegument protein 4e-04
PLN032061307 PLN03206, PLN03206, phosphoribosylformylglycinamidine s 0.001
TIGR017351310 TIGR01735, FGAM_synt, phosphoribosylformylglycinamidine 0.003
pfam0058695 pfam00586, AIRS, AIR synthase related protein, N-termin 3e-22
pfam0058695 pfam00586, AIRS, AIR synthase related protein, N-termin 2e-19
PRK05297 1290 PRK05297, PRK05297, phosphoribosylformylglycinamidine s 2e-19
PLN03206 1307 PLN03206, PLN03206, phosphoribosylformylglycinamidine s 4e-12
pfam02769150 pfam02769, AIRS_C, AIR synthase related protein, C-term 5e-18
cd02203313 cd02203, PurL_repeat1, PurL subunit of the formylglycin 2e-12
TIGR01739 1202 TIGR01739, tegu_FGAM_synt, herpesvirus tegument protein 4e-11
COG0150345 COG0150, PurM, Phosphoribosylaminoimidazole (AIR) synth 2e-06
PLN03206 1307 PLN03206, PLN03206, phosphoribosylformylglycinamidine s 2e-10
PRK05297 1290 PRK05297, PRK05297, phosphoribosylformylglycinamidine s 3e-08
TIGR03267323 TIGR03267, methan_mark_2, putative methanogenesis marke 1e-08
cd02192283 cd02192, PurM-like3, AIR synthase (PurM) related protei 4e-07
cd06061298 cd06061, PurM-like1, AIR synthase (PurM) related protei 1e-06
PHA033661304 PHA03366, PHA03366, FGAM-synthase; Provisional 2e-06
PRK052971290 PRK05297, PRK05297, phosphoribosylformylglycinamidine s 0.002
PRK14090 601 PRK14090, PRK14090, phosphoribosylformylglycinamidine s 2e-05
cd02192283 cd02192, PurM-like3, AIR synthase (PurM) related protei 3e-05
TIGR00878332 TIGR00878, purM, phosphoribosylaminoimidazole synthetas 0.001
>gnl|CDD|179249 PRK01213, PRK01213, phosphoribosylformylglycinamidine synthase II; Provisional Back     alignment and domain information
>gnl|CDD|162510 TIGR01736, FGAM_synth_II, phosphoribosylformylglycinamidine synthase II Back     alignment and domain information
>gnl|CDD|30395 COG0046, PurL, Phosphoribosylformylglycinamidine (FGAM) synthase, synthetase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|100034 cd02203, PurL_repeat1, PurL subunit of the formylglycinamide ribonucleotide amidotransferase (FGAR-AT), first repeat Back     alignment and domain information
>gnl|CDD|100037 cd06061, PurM-like1, AIR synthase (PurM) related protein, subgroup 1 of unknown function Back     alignment and domain information
>gnl|CDD|132311 TIGR03267, methan_mark_2, putative methanogenesis marker protein 2 Back     alignment and domain information
>gnl|CDD|32327 COG2144, COG2144, Selenophosphate synthetase-related proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|30956 COG0611, ThiL, Thiamine monophosphate kinase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|100030 cd02194, ThiL, ThiL (Thiamine-monophosphate kinase) plays a dual role in de novo biosynthesis and in salvage of exogenous thiamine Back     alignment and domain information
>gnl|CDD|32156 COG1973, HypE, Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|100036 cd02691, PurM-like2, AIR synthase (PurM) related protein, archaeal subgroup 2 of unknown function Back     alignment and domain information
>gnl|CDD|184499 PRK14090, PRK14090, phosphoribosylformylglycinamidine synthase II; Provisional Back     alignment and domain information
>gnl|CDD|100035 cd02204, PurL_repeat2, PurL subunit of the formylglycinamide ribonucleotide amidotransferase (FGAR-AT), second repeat Back     alignment and domain information
>gnl|CDD|100027 cd00396, PurM-like, AIR (aminoimidazole ribonucleotide) synthase related protein Back     alignment and domain information
>gnl|CDD|177603 PHA03366, PHA03366, FGAM-synthase; Provisional Back     alignment and domain information
>gnl|CDD|32327 COG2144, COG2144, Selenophosphate synthetase-related proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|100029 cd02193, PurL, Formylglycinamide ribonucleotide amidotransferase (FGAR-AT) catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to formylglycinamidine ribonucleotide (FGAM), ADP, phosphate, and glutamate in the fourth step of the purine biosynthetic pathway Back     alignment and domain information
>gnl|CDD|100030 cd02194, ThiL, ThiL (Thiamine-monophosphate kinase) plays a dual role in de novo biosynthesis and in salvage of exogenous thiamine Back     alignment and domain information
>gnl|CDD|30657 COG0309, HypE, Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|162715 TIGR02124, hypE, hydrogenase expression/formation protein HypE Back     alignment and domain information
>gnl|CDD|37118 KOG1907, KOG1907, KOG1907, Phosphoribosylformylglycinamidine synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|130916 TIGR01857, FGAM-synthase, phosphoribosylformylglycinamidine synthase, clade II Back     alignment and domain information
>gnl|CDD|100029 cd02193, PurL, Formylglycinamide ribonucleotide amidotransferase (FGAR-AT) catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to formylglycinamidine ribonucleotide (FGAM), ADP, phosphate, and glutamate in the fourth step of the purine biosynthetic pathway Back     alignment and domain information
>gnl|CDD|100027 cd00396, PurM-like, AIR (aminoimidazole ribonucleotide) synthase related protein Back     alignment and domain information
>gnl|CDD|100035 cd02204, PurL_repeat2, PurL subunit of the formylglycinamide ribonucleotide amidotransferase (FGAR-AT), second repeat Back     alignment and domain information
>gnl|CDD|30657 COG0309, HypE, Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|100031 cd02195, SelD, Selenophosphate synthetase (SelD) catalyzes the conversion of selenium to selenophosphate which is required by a number of bacterial, archaeal and eukaryotic organisms for synthesis of Secys-tRNA, the precursor of selenocysteine in selenoenzymes Back     alignment and domain information
>gnl|CDD|130796 TIGR01735, FGAM_synt, phosphoribosylformylglycinamidine synthase, single chain form Back     alignment and domain information
>gnl|CDD|145754 pfam02769, AIRS_C, AIR synthase related protein, C-terminal domain Back     alignment and domain information
>gnl|CDD|162512 TIGR01739, tegu_FGAM_synt, herpesvirus tegument protein/v-FGAM-synthase Back     alignment and domain information
>gnl|CDD|178745 PLN03206, PLN03206, phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>gnl|CDD|130796 TIGR01735, FGAM_synt, phosphoribosylformylglycinamidine synthase, single chain form Back     alignment and domain information
>gnl|CDD|144251 pfam00586, AIRS, AIR synthase related protein, N-terminal domain Back     alignment and domain information
>gnl|CDD|144251 pfam00586, AIRS, AIR synthase related protein, N-terminal domain Back     alignment and domain information
>gnl|CDD|179999 PRK05297, PRK05297, phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>gnl|CDD|178745 PLN03206, PLN03206, phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>gnl|CDD|145754 pfam02769, AIRS_C, AIR synthase related protein, C-terminal domain Back     alignment and domain information
>gnl|CDD|100034 cd02203, PurL_repeat1, PurL subunit of the formylglycinamide ribonucleotide amidotransferase (FGAR-AT), first repeat Back     alignment and domain information
>gnl|CDD|162512 TIGR01739, tegu_FGAM_synt, herpesvirus tegument protein/v-FGAM-synthase Back     alignment and domain information
>gnl|CDD|30499 COG0150, PurM, Phosphoribosylaminoimidazole (AIR) synthetase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|178745 PLN03206, PLN03206, phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>gnl|CDD|179999 PRK05297, PRK05297, phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>gnl|CDD|132311 TIGR03267, methan_mark_2, putative methanogenesis marker protein 2 Back     alignment and domain information
>gnl|CDD|100028 cd02192, PurM-like3, AIR synthase (PurM) related protein, subgroup 3 of unknown function Back     alignment and domain information
>gnl|CDD|100037 cd06061, PurM-like1, AIR synthase (PurM) related protein, subgroup 1 of unknown function Back     alignment and domain information
>gnl|CDD|177603 PHA03366, PHA03366, FGAM-synthase; Provisional Back     alignment and domain information
>gnl|CDD|179999 PRK05297, PRK05297, phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>gnl|CDD|184499 PRK14090, PRK14090, phosphoribosylformylglycinamidine synthase II; Provisional Back     alignment and domain information
>gnl|CDD|100028 cd02192, PurM-like3, AIR synthase (PurM) related protein, subgroup 3 of unknown function Back     alignment and domain information
>gnl|CDD|162083 TIGR00878, purM, phosphoribosylaminoimidazole synthetase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 737 phosphoribosylformylglycinamidine synthase II [Candidat
TIGR01736763 FGAM_synth_II phosphoribosylformylglycinamidine synthas 100.0
PRK01213736 phosphoribosylformylglycinamidine synthase II; Provisio 100.0
COG0046743 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, 100.0
PRK05297 1294 phosphoribosylformylglycinamidine synthase; Provisional 100.0
TIGR01735 1401 FGAM_synt phosphoribosylformylglycinamidine synthase; I 100.0
KOG1907 1320 consensus 100.0
TIGR01857 1279 FGAM-synthase phosphoribosylformylglycinamidine synthas 100.0
cd02203313 PurL_repeat1 PurL subunit of the formylglycinamide ribo 100.0
TIGR03267323 methan_mark_2 putative methanogenesis marker protein 2. 100.0
TIGR01736763 FGAM_synth_II phosphoribosylformylglycinamidine synthas 100.0
cd02192283 PurM-like3 AIR synthase (PurM) related protein, subgrou 100.0
cd06061298 PurM-like1 AIR synthase (PurM) related protein, subgrou 100.0
cd02197293 HypE HypE (Hydrogenase expression/formation protein). H 100.0
cd02195287 SelD Selenophosphate synthetase (SelD) catalyzes the co 100.0
cd02691346 PurM-like2 AIR synthase (PurM) related protein, archaea 100.0
TIGR02124345 hypE hydrogenase expression/formation protein HypE; Int 99.97
COG2144324 Selenophosphate synthetase-related proteins [General fu 99.97
PRK00943347 selenophosphate synthetase; Provisional 99.94
TIGR01379336 thiL thiamine-monophosphate kinase; InterPro: IPR006283 99.92
TIGR00878338 purM phosphoribosylformylglycinamidine cyclo-ligase; In 99.76
COG0709346 SelD Selenophosphate synthase [Amino acid transport and 99.55
cd02204264 PurL_repeat2 PurL subunit of the formylglycinamide ribo 100.0
cd02193272 PurL Formylglycinamide ribonucleotide amidotransferase 100.0
cd02203313 PurL_repeat1 PurL subunit of the formylglycinamide ribo 100.0
cd02192283 PurM-like3 AIR synthase (PurM) related protein, subgrou 100.0
COG0046 743 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, 100.0
cd00396222 PurM-like AIR (aminoimidazole ribonucleotide) synthase 100.0
cd06061298 PurM-like1 AIR synthase (PurM) related protein, subgrou 100.0
cd02195287 SelD Selenophosphate synthetase (SelD) catalyzes the co 100.0
PRK05731320 thiamine monophosphate kinase; Provisional 100.0
cd02194291 ThiL ThiL (Thiamine-monophosphate kinase) plays a dual 100.0
cd02197293 HypE HypE (Hydrogenase expression/formation protein). H 99.98
TIGR01379336 thiL thiamine-monophosphate kinase; InterPro: IPR006283 99.97
PRK00943347 selenophosphate synthetase; Provisional 99.97
COG2144324 Selenophosphate synthetase-related proteins [General fu 99.97
TIGR02124345 hypE hydrogenase expression/formation protein HypE; Int 99.95
COG0611317 ThiL Thiamine monophosphate kinase [Coenzyme metabolism 99.94
COG0309339 HypE Hydrogenase maturation factor [Posttranslational m 99.93
cd02196297 PurM PurM (Aminoimidazole Ribonucleotide [AIR] syntheta 99.83
TIGR00476372 selD selenide, water dikinase; InterPro: IPR004536 In p 99.82
TIGR00878338 purM phosphoribosylformylglycinamidine cyclo-ligase; In 99.76
PRK05385338 phosphoribosylaminoimidazole synthetase; Provisional 99.73
COG0709346 SelD Selenophosphate synthase [Amino acid transport and 99.72
COG0150345 PurM Phosphoribosylaminoimidazole (AIR) synthetase [Nuc 99.64
COG1973449 HypE Hydrogenase maturation factor [Posttranslational m 99.57
KOG0237788 consensus 99.45
KOG3939312 consensus 99.31
TIGR01739 1313 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synt 100.0
cd02193272 PurL Formylglycinamide ribonucleotide amidotransferase 100.0
cd02204264 PurL_repeat2 PurL subunit of the formylglycinamide ribo 100.0
PRK01213736 phosphoribosylformylglycinamidine synthase II; Provisio 100.0
cd00396222 PurM-like AIR (aminoimidazole ribonucleotide) synthase 100.0
PRK05731320 thiamine monophosphate kinase; Provisional 100.0
cd02194291 ThiL ThiL (Thiamine-monophosphate kinase) plays a dual 100.0
COG0309339 HypE Hydrogenase maturation factor [Posttranslational m 100.0
PRK052971294 phosphoribosylformylglycinamidine synthase; Provisional 99.94
COG0611317 ThiL Thiamine monophosphate kinase [Coenzyme metabolism 99.86
PRK05385338 phosphoribosylaminoimidazole synthetase; Provisional 99.79
COG1973449 HypE Hydrogenase maturation factor [Posttranslational m 99.74
TIGR017391313 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synt 99.71
COG0150345 PurM Phosphoribosylaminoimidazole (AIR) synthetase [Nuc 99.59
TIGR00476372 selD selenide, water dikinase; InterPro: IPR004536 In p 99.49
KOG3939312 consensus 96.88
TIGR03267323 methan_mark_2 putative methanogenesis marker protein 2. 100.0
cd02691346 PurM-like2 AIR synthase (PurM) related protein, archaea 99.95
pfam02769150 AIRS_C AIR synthase related protein, C-terminal domain. 99.93
KOG19071320 consensus 99.55
cd02196297 PurM PurM (Aminoimidazole Ribonucleotide [AIR] syntheta 99.86
KOG0237788 consensus 99.38
pfam02769150 AIRS_C AIR synthase related protein, C-terminal domain. 99.85
TIGR01735 1401 FGAM_synt phosphoribosylformylglycinamidine synthase; I 99.76
pfam0058695 AIRS AIR synthase related protein, N-terminal domain. T 99.39
pfam0058695 AIRS AIR synthase related protein, N-terminal domain. T 99.37
TIGR01857 1279 FGAM-synthase phosphoribosylformylglycinamidine synthas 99.09
>TIGR01736 FGAM_synth_II phosphoribosylformylglycinamidine synthase II; InterPro: IPR010074 Phosphoribosylformylglycinamidine synthase is a single, long polypeptide in most bacteria Back     alignment and domain information
>PRK01213 phosphoribosylformylglycinamidine synthase II; Provisional Back     alignment and domain information
>COG0046 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, synthetase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05297 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase; InterPro: IPR010073 This entry represents a single-molecule form of phosphoribosylformylglycinamidine synthase, also called FGAM synthase, an enzyme of purine de novo biosynthesis Back     alignment and domain information
>KOG1907 consensus Back     alignment and domain information
>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase; InterPro: IPR010141 This entry represents a single-molecule form of phosphoribosylformylglycinamidine synthase, also called FGAM synthase, an enzyme of purine de novo biosynthesis, which represent a second clade of the enzymes found in Clostridia, Bifidobacteria and Streptococcus species Back     alignment and domain information
>cd02203 PurL_repeat1 PurL subunit of the formylglycinamide ribonucleotide amidotransferase (FGAR-AT), first repeat Back     alignment and domain information
>TIGR03267 methan_mark_2 putative methanogenesis marker protein 2 Back     alignment and domain information
>TIGR01736 FGAM_synth_II phosphoribosylformylglycinamidine synthase II; InterPro: IPR010074 Phosphoribosylformylglycinamidine synthase is a single, long polypeptide in most bacteria Back     alignment and domain information
>cd02192 PurM-like3 AIR synthase (PurM) related protein, subgroup 3 of unknown function Back     alignment and domain information
>cd06061 PurM-like1 AIR synthase (PurM) related protein, subgroup 1 of unknown function Back     alignment and domain information
>cd02197 HypE HypE (Hydrogenase expression/formation protein) Back     alignment and domain information
>cd02195 SelD Selenophosphate synthetase (SelD) catalyzes the conversion of selenium to selenophosphate which is required by a number of bacterial, archaeal and eukaryotic organisms for synthesis of Secys-tRNA, the precursor of selenocysteine in selenoenzymes Back     alignment and domain information
>cd02691 PurM-like2 AIR synthase (PurM) related protein, archaeal subgroup 2 of unknown function Back     alignment and domain information
>TIGR02124 hypE hydrogenase expression/formation protein HypE; InterPro: IPR011854 This family contains HypE (or HupE), a protein required for expression of catalytically active hydrogenase in many systems Back     alignment and domain information
>COG2144 Selenophosphate synthetase-related proteins [General function prediction only] Back     alignment and domain information
>PRK00943 selenophosphate synthetase; Provisional Back     alignment and domain information
>TIGR01379 thiL thiamine-monophosphate kinase; InterPro: IPR006283 This family represents thiamine-monophosphate kinase, an enzyme that converts thiamine monophosphate into thiamine pyrophosphate (TPP, coenzyme B1), an enzyme cofactor Back     alignment and domain information
>TIGR00878 purM phosphoribosylformylglycinamidine cyclo-ligase; InterPro: IPR004733 The purine biosynthetic pathway in procaryotes enlists eleven enzymes, six of which use ATP Back     alignment and domain information
>COG0709 SelD Selenophosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd02204 PurL_repeat2 PurL subunit of the formylglycinamide ribonucleotide amidotransferase (FGAR-AT), second repeat Back     alignment and domain information
>cd02193 PurL Formylglycinamide ribonucleotide amidotransferase (FGAR-AT) catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to formylglycinamidine ribonucleotide (FGAM), ADP, phosphate, and glutamate in the fourth step of the purine biosynthetic pathway Back     alignment and domain information
>cd02203 PurL_repeat1 PurL subunit of the formylglycinamide ribonucleotide amidotransferase (FGAR-AT), first repeat Back     alignment and domain information
>cd02192 PurM-like3 AIR synthase (PurM) related protein, subgroup 3 of unknown function Back     alignment and domain information
>COG0046 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, synthetase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00396 PurM-like AIR (aminoimidazole ribonucleotide) synthase related protein Back     alignment and domain information
>cd06061 PurM-like1 AIR synthase (PurM) related protein, subgroup 1 of unknown function Back     alignment and domain information
>cd02195 SelD Selenophosphate synthetase (SelD) catalyzes the conversion of selenium to selenophosphate which is required by a number of bacterial, archaeal and eukaryotic organisms for synthesis of Secys-tRNA, the precursor of selenocysteine in selenoenzymes Back     alignment and domain information
>PRK05731 thiamine monophosphate kinase; Provisional Back     alignment and domain information
>cd02194 ThiL ThiL (Thiamine-monophosphate kinase) plays a dual role in de novo biosynthesis and in salvage of exogenous thiamine Back     alignment and domain information
>cd02197 HypE HypE (Hydrogenase expression/formation protein) Back     alignment and domain information
>TIGR01379 thiL thiamine-monophosphate kinase; InterPro: IPR006283 This family represents thiamine-monophosphate kinase, an enzyme that converts thiamine monophosphate into thiamine pyrophosphate (TPP, coenzyme B1), an enzyme cofactor Back     alignment and domain information
>PRK00943 selenophosphate synthetase; Provisional Back     alignment and domain information
>COG2144 Selenophosphate synthetase-related proteins [General function prediction only] Back     alignment and domain information
>TIGR02124 hypE hydrogenase expression/formation protein HypE; InterPro: IPR011854 This family contains HypE (or HupE), a protein required for expression of catalytically active hydrogenase in many systems Back     alignment and domain information
>COG0611 ThiL Thiamine monophosphate kinase [Coenzyme metabolism] Back     alignment and domain information
>COG0309 HypE Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02196 PurM PurM (Aminoimidazole Ribonucleotide [AIR] synthetase), one of eleven enzymes required for purine biosynthesis, catalyzes the conversion of formylglycinamide ribonucleotide (FGAM) and ATP to AIR, ADP, and Pi, the fifth step in de novo purine biosynthesis Back     alignment and domain information
>TIGR00476 selD selenide, water dikinase; InterPro: IPR004536 In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor Back     alignment and domain information
>TIGR00878 purM phosphoribosylformylglycinamidine cyclo-ligase; InterPro: IPR004733 The purine biosynthetic pathway in procaryotes enlists eleven enzymes, six of which use ATP Back     alignment and domain information
>PRK05385 phosphoribosylaminoimidazole synthetase; Provisional Back     alignment and domain information
>COG0709 SelD Selenophosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0150 PurM Phosphoribosylaminoimidazole (AIR) synthetase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1973 HypE Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0237 consensus Back     alignment and domain information
>KOG3939 consensus Back     alignment and domain information
>TIGR01739 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synthase; InterPro: IPR010077 This entry describes a family of large proteins of herpes virus Back     alignment and domain information
>cd02193 PurL Formylglycinamide ribonucleotide amidotransferase (FGAR-AT) catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to formylglycinamidine ribonucleotide (FGAM), ADP, phosphate, and glutamate in the fourth step of the purine biosynthetic pathway Back     alignment and domain information
>cd02204 PurL_repeat2 PurL subunit of the formylglycinamide ribonucleotide amidotransferase (FGAR-AT), second repeat Back     alignment and domain information
>PRK01213 phosphoribosylformylglycinamidine synthase II; Provisional Back     alignment and domain information
>cd00396 PurM-like AIR (aminoimidazole ribonucleotide) synthase related protein Back     alignment and domain information
>PRK05731 thiamine monophosphate kinase; Provisional Back     alignment and domain information
>cd02194 ThiL ThiL (Thiamine-monophosphate kinase) plays a dual role in de novo biosynthesis and in salvage of exogenous thiamine Back     alignment and domain information
>COG0309 HypE Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05297 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>COG0611 ThiL Thiamine monophosphate kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK05385 phosphoribosylaminoimidazole synthetase; Provisional Back     alignment and domain information
>COG1973 HypE Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01739 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synthase; InterPro: IPR010077 This entry describes a family of large proteins of herpes virus Back     alignment and domain information
>COG0150 PurM Phosphoribosylaminoimidazole (AIR) synthetase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00476 selD selenide, water dikinase; InterPro: IPR004536 In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor Back     alignment and domain information
>KOG3939 consensus Back     alignment and domain information
>TIGR03267 methan_mark_2 putative methanogenesis marker protein 2 Back     alignment and domain information
>cd02691 PurM-like2 AIR synthase (PurM) related protein, archaeal subgroup 2 of unknown function Back     alignment and domain information
>pfam02769 AIRS_C AIR synthase related protein, C-terminal domain Back     alignment and domain information
>KOG1907 consensus Back     alignment and domain information
>cd02196 PurM PurM (Aminoimidazole Ribonucleotide [AIR] synthetase), one of eleven enzymes required for purine biosynthesis, catalyzes the conversion of formylglycinamide ribonucleotide (FGAM) and ATP to AIR, ADP, and Pi, the fifth step in de novo purine biosynthesis Back     alignment and domain information
>KOG0237 consensus Back     alignment and domain information
>pfam02769 AIRS_C AIR synthase related protein, C-terminal domain Back     alignment and domain information
>TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase; InterPro: IPR010073 This entry represents a single-molecule form of phosphoribosylformylglycinamidine synthase, also called FGAM synthase, an enzyme of purine de novo biosynthesis Back     alignment and domain information
>pfam00586 AIRS AIR synthase related protein, N-terminal domain Back     alignment and domain information
>pfam00586 AIRS AIR synthase related protein, N-terminal domain Back     alignment and domain information
>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase; InterPro: IPR010141 This entry represents a single-molecule form of phosphoribosylformylglycinamidine synthase, also called FGAM synthase, an enzyme of purine de novo biosynthesis, which represent a second clade of the enzymes found in Clostridia, Bifidobacteria and Streptococcus species Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target737 phosphoribosylformylglycinamidine synthase II [Candidat
3ac6_A725 Crystal Structure Of Purl From Thermus Thermophilus 1e-149
1t3t_A 1303 Structure Of Formylglycinamide Synthetase Length = 1e-139
3d54_A629 Stucture Of Purlqs From Thermotoga Maritima Length 1e-90
2hs0_A603 T. Maritima Purl Complexed With Atp Length = 603 1e-90
2hru_A603 T. Maritima Purl Complexed With Adp Length = 603 9e-89
1vk3_A615 Crystal Structure Of Phosphoribosylformylglycinamid 1e-84
3d54_A 629 Stucture Of Purlqs From Thermotoga Maritima Length 2e-19
2hs0_A 603 T. Maritima Purl Complexed With Atp Length = 603 2e-19
2hru_A 603 T. Maritima Purl Complexed With Adp Length = 603 5e-19
1vk3_A 615 Crystal Structure Of Phosphoribosylformylglycinamid 1e-17
2z1e_A338 Crystal Structure Of Hype From Thermococcus Kodakar 4e-10
3mcq_A319 Crystal Structure Of Thiamine-Monophosphate Kinase 7e-08
2z1t_A343 Crystal Structure Of Hydrogenase Maturation Protein 9e-05
2z1e_A338 Crystal Structure Of Hype From Thermococcus Kodakar 1e-12
2i6r_A334 Crystal Structure Of E. Coli Hype, A Hydrogenase Ma 5e-06
2btu_A346 Crystal Structure Of Phosphoribosylformylglycinamid 3e-04
2yye_A345 Crystal Structure Of Selenophosphate Synthetase Fro 0.001
2zau_A311 Crystal Structure Of An N-Terminally Truncated Sele 0.001
>gi|313754162|pdb|3AC6|A Chain A, Crystal Structure Of Purl From Thermus Thermophilus Length = 725 Back     alignment and structure
 Score =  533 bits (1373), Expect = e-149,   Method: Composition-based stats.
 Identities = 280/730 (38%), Positives = 403/730 (55%), Gaps = 9/730 (1%)

Query: 8   LEILTAHGLTKDECDQIIHILKRQPTLTEIGIISAMWNEHCSYKSSKKWLRTLPTTGKHV 67
             +    G+ + E  +I+  L R+P   E+ +    W+EHC+YK+S+  L+ LP  G+ V
Sbjct: 2   EALAKEIGIPEGEYREIVQRLGREPNRVELLLFKVXWSEHCAYKNSRPLLKALPKEGEAV 61

Query: 68  IQGPGENAGVVDIGGGDCVVFKMESHNHPSYIEPYQGAATGVGGILRDIFTMGARPVAAM 127
           +QGPGENAGVV +G G  V FK+ESHNHPS +EP+QGAATGVGGILRDI + GARP+A +
Sbjct: 62  LQGPGENAGVVRVGEGWAVAFKIESHNHPSAVEPFQGAATGVGGILRDIXSXGARPIALL 121

Query: 128 NSLRFGAIHHPKTKHLLSGVVAGIAGYSNSFGVPTVGGEVEFLPCYNNNIIVNTFAAGIA 187
           +SLRFG     ++++LL GVV+GIA Y N+ GVPTVGG++ F   Y  N +VN    G+ 
Sbjct: 122 DSLRFGPPEEARSRYLLKGVVSGIAFYGNAIGVPTVGGDLYFHEGYRENPLVNAXCLGLL 181

Query: 188 KTNAIFSSKARGIGLPLVYLGAKTGRDGIGGASMASEEFGENIAKKRPTVQVGDPFTGKC 247
           +   +  S    +G P+ Y GAKTGRDGIGGA+ AS E  E  A+ RP VQVGDPF GK 
Sbjct: 182 REEHLKRS-RASLGRPIYYAGAKTGRDGIGGAAFASRELKEEKAEDRPAVQVGDPFLGKL 240

Query: 248 LLEACLELMNTDAVIAIQDMGAAGLTCSAIEMGNQGNLGITLDLDKVPTCEEGMTAYEMM 307
           L EA LE +  D V  +QD GAAGLT S  E+ ++  LG+ L LD VPT EEG T  E++
Sbjct: 241 LXEATLEAIELDLVEGVQDXGAAGLTSSLSELAHKSGLGVELHLDLVPTREEGXTPEELL 300

Query: 308 LSESQERMLMILNPEKQHKAQEILNKWGLHFSIIGITTNDKLFRVIHRGEEVANLPIKAL 367
           LSESQER +++    K+   +E+  +WGL    +  T  +++FRV+ RGE VA +P +AL
Sbjct: 301 LSESQERXVLVPKEGKEKALEEVFGRWGLDCVPVARTIPERVFRVLFRGEVVAEVPTEAL 360

Query: 368 SDEAPEYDRAWCEPITIPPSNPQLLCSDEDCTKSLLKLLSSPNLSSRRWVYEQYDTMIQS 427
           ++          +P         +   + D  + L +LL+SPNL+SR  VYE+YD  + +
Sbjct: 361 AEAPTYVRVGREDPEVRRLRETPIPPLEADPQEVLRRLLASPNLASREAVYERYDHQVGT 420

Query: 428 NSIQLPGGDAGVIRVEGHETKALAFSSDVTPRYVKADPFEGTKQAVAECWRNIIATGAKP 487
            +  LPG     +         +A   D  PRY +  P  G   A+AE  RN+   GAKP
Sbjct: 421 RTALLPGKGDAAVLWIKGTRLGVAAKVDQNPRYSRLHPRLGAXHALAEACRNVSVVGAKP 480

Query: 488 LAITDNLNFGNPEKEEIMGQFVHSVKGIREACQILDFPIVSGNVSFYNETNGQSIFPTPT 547
           LA TD LN G+PE  E   +   ++ G++EA + L  P+VSGNVS YNE+ G+ I PT  
Sbjct: 481 LAYTDGLNLGSPETPEGYHELAETIAGLKEASEALGVPVVSGNVSLYNESGGKRIPPTAX 540

Query: 548 IAGVGILPDYSLMTRIDSAHEGDLILMIGNDGCHLDCSMYSLECASSNIGPPPKVDCHLE 607
           +  VG+L              G+++L+IG +   L  S           G PP++D   E
Sbjct: 541 VGVVGVLE-VDKRAEXGFRRPGEVLLLIGEERGELGASEVLYLLTGKEFGHPPRLDLGRE 599

Query: 608 KNHGFFVLSMINAKKITACHDISTGGLIITLAEMTISSAKGMDIILPIEIEKDPKPFLFG 667
           K     +  +I        HD++ GGL++ LAE T     G  +    E+ ++    LFG
Sbjct: 600 KAVQEAIRDLIQRGLTRTAHDVAEGGLLLALAEXTFPYGVGATV----EVREEGLEALFG 655

Query: 668 EDQGRYVVCISPENQDLVMSEANNKNIPLRYLGKVSGSTLSI---HNILNIPVATLQTKY 724
           E   R +  +              + +P R LG+  G +L++     +L   +  L + +
Sbjct: 656 EAPSRVLFTVEKTRLQEATLLLEERGLPYRVLGETGGKSLTVLTPGGVLEWSLEELLSAW 715

Query: 725 ESWFPEFISE 734
           ++   E +  
Sbjct: 716 KAPLREVLDG 725


>gi|55669841|pdb|1T3T|A Chain A, Structure Of Formylglycinamide Synthetase Length = 1303 Back     alignment and structure
>gi|194368756|pdb|3D54|A Chain A, Stucture Of Purlqs From Thermotoga Maritima Length = 629 Back     alignment and structure
gi|126030643|pdb|2HS0|A Chain A, T. Maritima Purl Complexed With Atp Length = 603 Back     alignment and structure
>gi|126030641|pdb|2HRU|A Chain A, T. Maritima Purl Complexed With Adp Length = 603 Back     alignment and structure
>gi|49259562|pdb|1VK3|A Chain A, Crystal Structure Of Phosphoribosylformylglycinamidine Synthase Ii (Tm1246) From Thermotoga Maritima At 2.15 A Resolution Length = 615 Back     alignment and structure
>gi|194368756|pdb|3D54|A Chain A, Stucture Of Purlqs From Thermotoga Maritima Length = 629 Back     alignment and structure
gi|126030643|pdb|2HS0|A Chain A, T. Maritima Purl Complexed With Atp Length = 603 Back     alignment and structure
>gi|126030641|pdb|2HRU|A Chain A, T. Maritima Purl Complexed With Adp Length = 603 Back     alignment and structure
>gi|49259562|pdb|1VK3|A Chain A, Crystal Structure Of Phosphoribosylformylglycinamidine Synthase Ii (Tm1246) From Thermotoga Maritima At 2.15 A Resolution Length = 615 Back     alignment and structure
gi|152149567|pdb|2Z1E|A Chain A, Crystal Structure Of Hype From Thermococcus Kodakaraensis (Outward Form) Length = 338 Back     alignment and structure
>gi|296278508|pdb|3MCQ|A Chain A, Crystal Structure Of Thiamine-Monophosphate Kinase (Mfla_057 Methylobacillus Flagellatus Kt At 1.91 A Resolution Length = 319 Back     alignment and structure
>gi|158431305|pdb|2Z1T|A Chain A, Crystal Structure Of Hydrogenase Maturation Protein Hype Length = 343 Back     alignment and structure
gi|152149567|pdb|2Z1E|A Chain A, Crystal Structure Of Hype From Thermococcus Kodakaraensis (Outward Form) Length = 338 Back     alignment and structure
>gi|159794815|pdb|2I6R|A Chain A, Crystal Structure Of E. Coli Hype, A Hydrogenase Maturation Protein Length = 334 Back     alignment and structure
gi|114793560|pdb|2BTU|A Chain A, Crystal Structure Of Phosphoribosylformylglycinamidine Cyclo-Ligase From Bacillus Anthracis At 2.3a Resolution. Length = 346 Back     alignment and structure
>gi|186972926|pdb|2YYE|A Chain A, Crystal Structure Of Selenophosphate Synthetase From Aquifex Aeolicus Complexed With Ampcpp Length = 345 Back     alignment and structure
gi|190613481|pdb|2ZAU|A Chain A, Crystal Structure Of An N-Terminally Truncated Selenophosphate Synthetase From Aquifex Aeolicus Length = 311 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target737 phosphoribosylformylglycinamidine synthase II [Candidat
1vk3_A615 Phosphoribosylformylglycinamidine synthase II; TM1246, 1e-123
1t3t_A 1303 Phosphoribosylformylglycinamidine synthase; PURL, FGAM 1e-121
3fd5_A394 Selenide, water dikinase 1; selenophosphate synthetase, 1e-26
2z1u_A343 Hydrogenase expression/formation protein HYPE; alpha-be 6e-25
3mcq_A319 Thiamine-monophosphate kinase; structural genomics, joi 1e-24
2z1e_A338 Hydrogenase expression/formation protein HYPE; [NIFE] h 2e-24
2rb9_A334 HYPE protein; hydrogenase maturation, dimer, enzyme, X- 8e-22
1cli_A345 Protein (phosphoribosyl-aminoimidazole synthetase); AIR 2e-20
2btu_A346 Phosphoribosyl-aminoimidazole synthetase; synthase, PUR 2e-15
2yxz_A311 Thiamin-monophosphate kinase; alpha/beta structure, tra 2e-15
2z01_A348 Phosphoribosylformylglycinamidine cyclo-ligase; alpha a 5e-13
2v9y_A334 Phosphoribosylformylglycinamidine cyclo-ligase; multifu 3e-11
3m84_A350 Phosphoribosylformylglycinamidine cyclo-ligase; alpha-b 3e-09
3c9u_A342 Thiamine monophosphate kinase; beta barrel, alpha-beta 0.001
3fd5_A394 Selenide, water dikinase 1; selenophosphate synthetase, 1e-15
2z1u_A343 Hydrogenase expression/formation protein HYPE; alpha-be 2e-18
3mcq_A319 Thiamine-monophosphate kinase; structural genomics, joi 5e-17
2z1e_A338 Hydrogenase expression/formation protein HYPE; [NIFE] h 4e-15
1cli_A345 Protein (phosphoribosyl-aminoimidazole synthetase); AIR 2e-04
2yyd_A345 Selenide, water dikinase; FULL-length selenophosphate s 2e-13
3p4e_A349 Phosphoribosylformylglycinamidine cyclo-ligase; structu 8e-07
2btu_A346 Phosphoribosyl-aminoimidazole synthetase; synthase, PUR 2e-04
2z01_A348 Phosphoribosylformylglycinamidine cyclo-ligase; alpha a 2e-04
3c9u_A342 Thiamine monophosphate kinase; beta barrel, alpha-beta 6e-06
2yyd_A345 Selenide, water dikinase; FULL-length selenophosphate s 8e-20
3p4e_A349 Phosphoribosylformylglycinamidine cyclo-ligase; structu 4e-18
2yxz_A311 Thiamin-monophosphate kinase; alpha/beta structure, tra 3e-10
2v9y_A334 Phosphoribosylformylglycinamidine cyclo-ligase; multifu 1e-06
3m84_A350 Phosphoribosylformylglycinamidine cyclo-ligase; alpha-b 1e-06
>1vk3_A Phosphoribosylformylglycinamidine synthase II; TM1246, structural genomics, JCSG, PSI, protein structure initiative; 2.15A {Thermotoga maritima} SCOP: d.79.4.1 d.79.4.1 d.139.1.1 d.139.1.1 PDB: 3d54_A* 2hs3_A* 2hs0_A* 2hs4_A* 2hru_A* 2hry_A* Length = 615 Back     alignment and structure
 Score =  437 bits (1125), Expect = e-123
 Identities = 206/664 (31%), Positives = 311/664 (46%), Gaps = 69/664 (10%)

Query: 19  DECDQIIHILKRQPTLTEIGIISAMWNEHCSYKSSKKWLRTLPTTGKHVIQGPGENAGVV 78
              + +   L R+PT  E+   S MW+EHC Y  +KK++R LP TG         NAGVV
Sbjct: 16  RYLNILKEKLGREPTFVELQAFSVMWSEHCGYSHTKKYIRRLPKTG------FEGNAGVV 69

Query: 79  DIGGGDCVVFKMESHNHPSYIEPYQGAATGVGGILRDIFTMGARPVAAMNSLRFGAIHHP 138
           ++     V FK+ESHNHPS IEPY GAATGVGGI+RD+  MGARP A  +SL        
Sbjct: 70  NLDDYYSVAFKIESHNHPSAIEPYNGAATGVGGIIRDVLAMGARPTAIFDSLHMS----- 124

Query: 139 KTKHLLSGVVAGIAGYSNSFGVPTVGGEVEFLPCYNNNIIVNTFAAGIAKTNAIFSSKAR 198
               ++ G++ GIA Y NS GVPTVGGE+     Y +N +VN  AAG+ + + +  SKA 
Sbjct: 125 ---RIIDGIIEGIADYGNSIGVPTVGGELRISSLYAHNPLVNVLAAGVVRNDMLVDSKAS 181

Query: 199 GIGLPLVYLGAKTGRDGIGGASMASEEFGENIAKKRPTVQVGDPFTGKCLLEACLELMNT 258
             G  +V  G  TGRDGI GAS ASE+   + A K   +QVGDPF  K L+EA LE++  
Sbjct: 182 RPGQVIVIFGGATGRDGIHGASFASEDLTGDKATKLS-IQVGDPFAEKMLIEAFLEMVEE 240

Query: 259 DAVIAIQDMGAAGLTCSAIEMGNQGNLGITLDLDKVPTCEEGMTAYEMMLSESQERMLMI 318
             V   QD+GA G+  +  E+  +GNLG  + LD+VP  E  M  +E+++SESQERM ++
Sbjct: 241 GLVEGAQDLGAGGVLSATSELVAKGNLGAIVHLDRVPLREPDMEPWEILISESQERMAVV 300

Query: 319 LNPEKQHKAQEILNKWGLHFSIIGITTNDKLFRVIHRGEEVANLPIKALSDEAPEYDRAW 378
            +P+K  +  EI  K  L   ++     + ++RV++R + V  +P++ L++ APE D   
Sbjct: 301 TSPQKASRILEIARKHLLFGDVVAEVIEEPVYRVMYRNDLVMEVPVQLLAN-APEEDIVE 359

Query: 379 CEPITIPPSNPQLLCSDEDCTKSLLKLLSSPNLSSRRWVYEQYDTMIQSNSIQLPGGDAG 438
             P  IP                             R V+EQYD M+ ++   +     G
Sbjct: 360 YTPGKIPEFKRVEFEEVN-----------------AREVFEQYDHMVGTD--TVVPPGFG 400

Query: 439 VIRVEGHETKALAFSSDVTPRYVKADPFEGTKQAVAECWRNIIATGAKPLAITDNLNFGN 498
              +        +  +         D + GT  AV E  R  ++ GA+PLAIT+ +N+G+
Sbjct: 401 AAVMRIKRDGGYSLVTHSRADLALQDTYWGTLIAVLESVRKTLSVGAEPLAITNCVNYGD 460

Query: 499 PEKEEIMGQFVHSVKGIREACQILDFPIVSGNVSFYNETNGQSIFPTPTIAGVGILPDYS 558
           P+ + +       +  ++ AC+    P+ SGN S YN   G+ I PT  +  +G +    
Sbjct: 461 PDVDPV--GLSAMMTALKNACEFSGVPVASGNASLYNTYQGKPIPPTLVVGMLGKVNPQK 518

Query: 559 LMTRIDSAHEGDLILMIGNDGCHLDCSMYSLECASSNIGPPPKVDCHLEKNHGFFVLSMI 618
           +        +   +  +G +   L+                       EK     +  + 
Sbjct: 519 VAKP-----KPSKVFAVGWNDFELE----------------------REKELWRAIRKLS 551

Query: 619 NAKKITACHDISTGGLIITLAEMTISSAK-GMDIILPIEIEKDPKPFLFGEDQGRYVVCI 677
                     +S+  L+      T       +++ LP          +F E      V +
Sbjct: 552 EE----GAFILSSSQLLTRTHVETFREYGLKIEVKLPEVRPAHQMVLVFSERTPVVDVPV 607

Query: 678 SPEN 681
               
Sbjct: 608 KEIG 611