254780971

254780971

phosphoribosylformylglycinamidine synthase subunit I

GeneID in NCBI database:8209993Locus tag:CLIBASIA_04360
Protein GI in NCBI database:254780971Protein Accession:YP_003065384.1
Gene range:-(968435, 969094)Protein Length:219aa
Gene description:phosphoribosylformylglycinamidine synthase I
COG prediction:none
KEGG prediction:purQ; phosphoribosylformylglycinamidine synthase I (EC:6.3.5.3); K01952 phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
SEED prediction:Phosphoribosylformylglycinamidine synthase, glutamine amidotransferase subunit (EC 6.3.5.3)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
Subsystem involved in SEED:De Novo Purine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MKTAIVQIPGLNRDNDMIKAITKIIGQSPILVWQSDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQILVELNLLPGILMRNCSLKFVCKQVLLEVVNSNTAFTKSYKMNQIIKCPVAHHDGNYFIDAKGLAEIEKNNQIVFRYASGTNPNGSLHDIAGVINRRGNVLGMMPHPENIIEKFHGGIDGRGLFASLLT
cEEEEEEEccccHHHHHHHHHHHHccccEEEEEcccccHHcccEEEEcccccccccccHHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHcccccHHHcccccccEEccccEEEEcccccHHHHccccccEEEEEEEEccccEEEcHHHHHHHHHcccEEEEEccccccccccccEEEEEcccccEEEEEccHHHHHHHHHccccHHHHHHHHHc
ccEEEEEEccccccHHHHHHHHHHcccccEEEEccccccccccEEEEcccccccHHHHHHHHHHHcHHHHHHHHHHHccccEEEEcccHHHEHHccccccccHccccccEEEccEEEEEEccccccccccccccEEEEEEEcccccccccHHHHHHHHHcccEEEEEEccccccccHHHcccEEcccccEcccccccHHHHHHHHccccHHHHHHHHHc
mktaivqipglnrdnDMIKAITKIIgqspilvwqsdtdipdvdlivipggfsygdylrcgaiaARTPVMQAIKKKAQQGIKVMGICNGFQILVELNllpgilmrncslkFVCKQVLLEVVNSNtaftksykmnqiikcpvahhdgnyfidaKGLAEIEKNNQIVFRyasgtnpngslhdIAGVINRrgnvlgmmphpeniiekfhggidgrGLFASLLT
mktaivqipglnrdnDMIKAITKIIGQSPILVWQSDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQILVELNLLPGILMRNCSLKFVCKQVLLEVVNSNTaftksykmnQIIKCPVAHHDGNYFIDAKGLAEIEKNNQIVFRYASGTNPNGSLHDIAGVINRRGNVLGMMPHPENIIEKFHGGIDGRGLFASLLT
MKTAIVQIPGLNRDNDMIKAITKIIGQSPILVWQSDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMqaikkkaqqgikVMGICNGFQILVELNLLPGILMRNCSLKFVCKQVLLEVVNSNTAFTKSYKMNQIIKCPVAHHDGNYFIDAKGLAEIEKNNQIVFRYASGTNPNGSLHDIAGVINRRGNVLGMMPHPENIIEKFHGGIDGRGLFASLLT
MKTAIVQIPGLNRDNDMIKAITKIIGQSPILVWQSDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQILVELNLLPGILMRNCSLKFVCKQVLLEVVNSNTAFTKSYKMNQIIKCPVAHHDGNYFIDAKGLAEIEKNNQIVFRYASGTNPNGSLHDIAGVINRRGNVLGMMPHPENIIEKFHGGIDGRGLFASLLT
MKTAIVQIPGLNRDNDMIKAITKIIGQSPILVWQSDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQILVELNLLPGILMRNCSLKFVCKQVLLEVVNSNTAFTKSYKMNQIIKCPVAHHDGNYFIDAKGLAEIEKNNQIVFRYASGTNPNGSLHDIAGVINRRGNVLGMMPHPENIIEKFHGGIDGRGLFASLLT
MKTAIVQIPGLNRDNDMIKAITKIIGQSPILVWQSDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQILVELNLLPGILMRNCSLKFVCKQVLLEVVNSNTAFTKSYKMNQIIKCPVAHHDGNYFIDAKGLAEIEKNNQIVFRYASGTNPNGSLHDIAGVINRRGNVLGMMPHPENIIEKFHGGIDGRGLFASLLT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTAIVQIPGLNRDNDMIKAITKIIGQSPILVWQSDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQILVELNLLPGILMRNCSLKFVCKQVLLEVVNSNTAFTKSYKMNQIIKCPVAHHDGNYFIDAKGLAEIEKNNQIVFRYASGTNPNGSLHDIAGVINRRGNVLGMMPHPENIIEKFHGGIDGRGLFASLLT
MKTAIVQIPGLNRDNDMIKAITKIIGQSPILVWQSDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQILVELNLLPGILMRNCSLKFVCKQVLLEVVNSNTAFTKSYKMNQIIKCPVAHHDGNYFIDAKGLAEIEKNNQIVFRYASGTNPNGSLHDIAGVINRRGNVLGMMPHPENIIEKFHGGIDGRGLFASLLT
MKTAIVQIPGLNRDNDMIKAITKIIGQSPILVWQSDTDIPDVDLIVIPGGFSYGDYLRCGAIAARTPVMQAIKKKAQQGIKVMGICNGFQILVELNLLPGILMRNCSLKFVCKQVLLEVVNSNTAFTKSYKMNQIIKCPVAHHDGNYFIDAKGLAEIEKNNQIVFRYASGTNPNGSLHDIAGVINRRGNVLGMMPHPENIIEKFHGGIDGRGLFASLLT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target219 phosphoribosylformylglycinamidine synthase subunit I [C
315122611219 phosphoribosylformylglycinamidine synthase I [Candidatu 1 1e-107
307302647223 phosphoribosylformylglycinamidine synthase I [Sinorhizo 1 4e-97
150396712223 phosphoribosylformylglycinamidine synthase I [Sinorhizo 1 5e-97
15965527223 phosphoribosylformylglycinamidine synthase subunit I [S 1 1e-96
325293245223 phosphoribosylformylglycinamidine synthase I [Agrobacte 1 9e-96
222086134223 phosphoribosylformylglycinamidine synthase I [Agrobacte 1 1e-95
227822168223 phosphoribosylformylglycinamidine synthase I [Sinorhizo 1 2e-94
116252354223 phosphoribosylformylglycinamidine synthase I [Rhizobium 1 2e-94
241204858223 phosphoribosylformylglycinamidine synthase I [Rhizobium 1 3e-94
86357896223 phosphoribosylformylglycinamidine synthase subunit I [R 1 8e-94
>gi|315122611|ref|YP_004063100.1| phosphoribosylformylglycinamidine synthase I [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 219 Back     alignment and organism information
 Score =  393 bits (1009), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 181/218 (83%), Positives = 203/218 (93%)

Query: 1   MKTAIVQIPGLNRDNDMIKAITKIIGQSPILVWQSDTDIPDVDLIVIPGGFSYGDYLRCG 60
           MK AIVQIPGLNRD DMI A+ KI G+ PILVWQSDT+IPDVDLI+IPGGFSYGDYLRCG
Sbjct: 1   MKIAIVQIPGLNRDRDMIMAVKKITGKFPILVWQSDTNIPDVDLIIIPGGFSYGDYLRCG 60

Query: 61  AIAARTPVMQAIKKKAQQGIKVMGICNGFQILVELNLLPGILMRNCSLKFVCKQVLLEVV 120
           AIAARTPVMQ +KK+AQQG+K++GICNGFQILVELNLLPGILMRN SLKF+CKQVL+EVV
Sbjct: 61  AIAARTPVMQVVKKRAQQGVKILGICNGFQILVELNLLPGILMRNTSLKFICKQVLIEVV 120

Query: 121 NSNTAFTKSYKMNQIIKCPVAHHDGNYFIDAKGLAEIEKNNQIVFRYASGTNPNGSLHDI 180
           N+NTAFT+SYKMNQI+K P+AHHDGNYFID++GLAEIE NNQ+VFRYASG NPNGSLHDI
Sbjct: 121 NANTAFTQSYKMNQIVKFPIAHHDGNYFIDSQGLAEIESNNQVVFRYASGRNPNGSLHDI 180

Query: 181 AGVINRRGNVLGMMPHPENIIEKFHGGIDGRGLFASLL 218
           AG+ NR+GNVLGMMPHPEN+IE+ HGGIDGR LF SLL
Sbjct: 181 AGITNRQGNVLGMMPHPENMIEEIHGGIDGRALFTSLL 218


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|307302647|ref|ZP_07582403.1| phosphoribosylformylglycinamidine synthase I [Sinorhizobium meliloti BL225C] Length = 223 Back     alignment and organism information
>gi|150396712|ref|YP_001327179.1| phosphoribosylformylglycinamidine synthase I [Sinorhizobium medicae WSM419] Length = 223 Back     alignment and organism information
>gi|15965527|ref|NP_385880.1| phosphoribosylformylglycinamidine synthase subunit I [Sinorhizobium meliloti 1021] Length = 223 Back     alignment and organism information
>gi|325293245|ref|YP_004279109.1| phosphoribosylformylglycinamidine synthase I [Agrobacterium sp. H13-3] Length = 223 Back     alignment and organism information
>gi|222086134|ref|YP_002544666.1| phosphoribosylformylglycinamidine synthase I [Agrobacterium radiobacter K84] Length = 223 Back     alignment and organism information
>gi|227822168|ref|YP_002826139.1| phosphoribosylformylglycinamidine synthase I [Sinorhizobium fredii NGR234] Length = 223 Back     alignment and organism information
>gi|116252354|ref|YP_768192.1| phosphoribosylformylglycinamidine synthase I [Rhizobium leguminosarum bv. viciae 3841] Length = 223 Back     alignment and organism information
>gi|241204858|ref|YP_002975954.1| phosphoribosylformylglycinamidine synthase I [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 223 Back     alignment and organism information
>gi|86357896|ref|YP_469788.1| phosphoribosylformylglycinamidine synthase subunit I [Rhizobium etli CFN 42] Length = 223 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target219 phosphoribosylformylglycinamidine synthase subunit I [C
PRK03619219 PRK03619, PRK03619, phosphoribosylformylglycinamidine s 1e-109
TIGR01737227 TIGR01737, FGAM_synth_I, phosphoribosylformylglycinamid 3e-89
cd01740238 cd01740, GATase1_FGAR_AT, Type 1 glutamine amidotransfe 1e-71
PRK01175261 PRK01175, PRK01175, phosphoribosylformylglycinamidine s 5e-42
TIGR018571239 TIGR01857, FGAM-synthase, phosphoribosylformylglycinami 2e-22
KOG19071320 KOG1907, KOG1907, KOG1907, Phosphoribosylformylglycinam 9e-20
TIGR017351310 TIGR01735, FGAM_synt, phosphoribosylformylglycinamidine 2e-18
PLN032061307 PLN03206, PLN03206, phosphoribosylformylglycinamidine s 8e-14
COG0311194 COG0311, PDX2, Predicted glutamine amidotransferase inv 1e-04
COG0047231 COG0047, PurL, Phosphoribosylformylglycinamidine (FGAM) 5e-83
PRK052971290 PRK05297, PRK05297, phosphoribosylformylglycinamidine s 8e-16
KOG0623 541 KOG0623, KOG0623, KOG0623, Glutamine amidotransferase/c 0.001
cd01653115 cd01653, GATase1, Type 1 glutamine amidotransferase (GA 8e-08
cd0312892 cd03128, GAT_1, Type 1 glutamine amidotransferase (GATa 3e-07
pfam07685158 pfam07685, GATase_3, CobB/CobQ-like glutamine amidotran 1e-06
PRK00784488 PRK00784, PRK00784, cobyric acid synthase; Provisional 3e-06
cd03130198 cd03130, GATase1_CobB, Type 1 glutamine amidotransferas 4e-06
cd01750194 cd01750, GATase1_CobQ, Type 1 glutamine amidotransferas 4e-06
cd01748198 cd01748, GATase1_IGP_Synthase, Type 1 glutamine amidotr 3e-05
PRK01077451 PRK01077, PRK01077, cobyrinic acid a,c-diamide synthase 3e-05
cd03134165 cd03134, GATase1_PfpI_like, A type 1 glutamine amidotra 7e-05
COG1492486 COG1492, CobQ, Cobyric acid synthase [Coenzyme metaboli 1e-04
PRK13527200 PRK13527, PRK13527, glutamine amidotransferase subunit 1e-04
COG0118204 COG0118, HisH, Glutamine amidotransferase [Amino acid t 2e-04
cd03136185 cd03136, GATase1_AraC_ArgR_like, AraC transcriptional r 3e-04
COG1797451 COG1797, CobB, Cobyrinic acid a,c-diamide synthase [Coe 3e-04
pfam01965141 pfam01965, DJ-1_PfpI, DJ-1/PfpI family 5e-04
pfam00117187 pfam00117, GATase, Glutamine amidotransferase class-I 6e-04
PRK13141205 PRK13141, hisH, imidazole glycerol phosphate synthase s 0.002
cd01741188 cd01741, GATase1_1, Subgroup of proteins having the Typ 0.003
cd03137187 cd03137, GATase1_AraC_1, AraC transcriptional regulator 0.004
>gnl|CDD|179609 PRK03619, PRK03619, phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>gnl|CDD|162511 TIGR01737, FGAM_synth_I, phosphoribosylformylglycinamidine synthase I Back     alignment and domain information
>gnl|CDD|153211 cd01740, GATase1_FGAR_AT, Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase Back     alignment and domain information
>gnl|CDD|179238 PRK01175, PRK01175, phosphoribosylformylglycinamidine synthase I; Provisional Back     alignment and domain information
>gnl|CDD|130916 TIGR01857, FGAM-synthase, phosphoribosylformylglycinamidine synthase, clade II Back     alignment and domain information
>gnl|CDD|37118 KOG1907, KOG1907, KOG1907, Phosphoribosylformylglycinamidine synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|130796 TIGR01735, FGAM_synt, phosphoribosylformylglycinamidine synthase, single chain form Back     alignment and domain information
>gnl|CDD|178745 PLN03206, PLN03206, phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>gnl|CDD|30659 COG0311, PDX2, Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|30396 COG0047, PurL, Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|179999 PRK05297, PRK05297, phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>gnl|CDD|35842 KOG0623, KOG0623, KOG0623, Glutamine amidotransferase/cyclase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|153210 cd01653, GATase1, Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|153222 cd03128, GAT_1, Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|116299 pfam07685, GATase_3, CobB/CobQ-like glutamine amidotransferase domain Back     alignment and domain information
>gnl|CDD|179125 PRK00784, PRK00784, cobyric acid synthase; Provisional Back     alignment and domain information
>gnl|CDD|153224 cd03130, GATase1_CobB, Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase Back     alignment and domain information
>gnl|CDD|153221 cd01750, GATase1_CobQ, Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ) Back     alignment and domain information
>gnl|CDD|153219 cd01748, GATase1_IGP_Synthase, Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>gnl|CDD|179218 PRK01077, PRK01077, cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>gnl|CDD|153228 cd03134, GATase1_PfpI_like, A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus Back     alignment and domain information
>gnl|CDD|31681 COG1492, CobQ, Cobyric acid synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|184114 PRK13527, PRK13527, glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>gnl|CDD|30467 COG0118, HisH, Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|153230 cd03136, GATase1_AraC_ArgR_like, AraC transcriptional regulators having an N-terminal Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>gnl|CDD|31982 COG1797, CobB, Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|145245 pfam01965, DJ-1_PfpI, DJ-1/PfpI family Back     alignment and domain information
>gnl|CDD|143892 pfam00117, GATase, Glutamine amidotransferase class-I Back     alignment and domain information
>gnl|CDD|183868 PRK13141, hisH, imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>gnl|CDD|153212 cd01741, GATase1_1, Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>gnl|CDD|153231 cd03137, GATase1_AraC_1, AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 219 phosphoribosylformylglycinamidine synthase subunit I [C
TIGR01737264 FGAM_synth_I phosphoribosylformylglycinamidine synthase 100.0
PRK03619223 phosphoribosylformylglycinamidine synthase subunit I; P 100.0
COG0047231 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, 100.0
PRK01175255 phosphoribosylformylglycinamidine synthase subunit I; P 100.0
cd01740238 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATa 100.0
TIGR017351401 FGAM_synt phosphoribosylformylglycinamidine synthase; I 100.0
PRK052971294 phosphoribosylformylglycinamidine synthase; Provisional 100.0
KOG19071320 consensus 100.0
TIGR018571279 FGAM-synthase phosphoribosylformylglycinamidine synthas 100.0
TIGR017391313 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synt 99.98
PRK13143201 hisH imidazole glycerol phosphate synthase subunit HisH 99.82
PRK13153203 consensus 99.82
PRK13175206 consensus 99.81
PRK13525191 glutamine amidotransferase subunit PdxT; Provisional 99.81
COG0118204 HisH Glutamine amidotransferase [Amino acid transport a 99.79
PRK13147211 consensus 99.79
PRK13180209 consensus 99.79
PRK13146208 hisH imidazole glycerol phosphate synthase subunit HisH 99.78
PRK13527196 glutamine amidotransferase subunit PdxT; Provisional 99.77
PRK13181199 hisH imidazole glycerol phosphate synthase subunit HisH 99.77
TIGR01855211 IMP_synth_hisH imidazole glycerol phosphate synthase, g 99.76
PRK13141204 hisH imidazole glycerol phosphate synthase subunit HisH 99.76
PRK13170196 hisH imidazole glycerol phosphate synthase subunit HisH 99.76
PRK13148225 consensus 99.76
PRK13172213 consensus 99.75
PRK13173211 consensus 99.74
PRK13178213 consensus 99.74
cd01748198 GATase1_IGP_Synthase Type 1 glutamine amidotransferase 99.74
PRK13174212 consensus 99.74
CHL00188210 hisH imidazole glycerol phosphate synthase subunit hisH 99.73
PRK13152201 hisH imidazole glycerol phosphate synthase subunit HisH 99.72
PRK13151195 consensus 99.71
pfam01174188 SNO SNO glutamine amidotransferase family. This family 99.7
PRK13171200 consensus 99.7
cd01749183 GATase1_PB Glutamine Amidotransferase (GATase_I) involv 99.7
PRK13179207 consensus 99.7
PRK13177207 consensus 99.7
PRK13144190 consensus 99.68
PRK13176216 consensus 99.68
PRK13142192 hisH imidazole glycerol phosphate synthase subunit HisH 99.57
cd01742181 GATase1_GMP_Synthase Type 1 glutamine amidotransferase 99.54
PRK00074 513 guaA GMP synthase; Reviewed 99.47
PRK00784492 cobyric acid synthase; Provisional 99.38
PRK07765221 para-aminobenzoate synthase component II; Provisional 99.38
cd01743184 GATase1_Anthranilate_Synthase Type 1 glutamine amidotra 99.38
PRK06895191 para-aminobenzoate synthase component II; Provisional 99.38
TIGR00888195 guaA_Nterm GMP synthase, N-terminal domain; InterPro: I 99.37
pfam00117187 GATase Glutamine amidotransferase class-I. 99.35
PRK13526179 glutamine amidotransferase subunit PdxT; Provisional 99.3
PRK00758184 GMP synthase subunit A; Validated 99.29
COG0311194 PDX2 Predicted glutamine amidotransferase involved in p 99.25
PRK08857192 para-aminobenzoate synthase component II; Provisional 99.23
cd01744178 GATase1_CPSase Small chain of the glutamine-dependent f 99.22
PRK05670192 anthranilate synthase component II; Provisional 99.21
COG0518198 GuaA GMP synthase - Glutamine amidotransferase domain [ 99.2
cd01745189 GATase1_2 Subgroup of proteins having the Type 1 glutam 99.19
PRK01077451 cobyrinic acid a,c-diamide synthase; Validated 99.16
PRK06278 482 cobyrinic acid a,c-diamide synthase; Validated 99.15
CHL00101190 trpG anthranilate synthase component 2 99.12
PRK11366254 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Prov 99.11
PRK08007187 para-aminobenzoate synthase component II; Provisional 99.08
PRK06774191 para-aminobenzoate synthase component II; Provisional 99.07
PRK08250235 glutamine amidotransferase; Provisional 99.06
cd01746235 GATase1_CTP_Synthase Type 1 glutamine amidotransferase 99.05
COG0504533 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide trans 99.05
TIGR00313502 cobQ cobyric acid synthase CobQ; InterPro: IPR004459 Co 99.04
PRK07649195 para-aminobenzoate/anthranilate synthase glutamine amid 99.03
cd01741188 GATase1_1 Subgroup of proteins having the Type 1 glutam 99.02
pfam07722219 Peptidase_C26 Peptidase C26. These peptidases have gamm 99.0
cd03130198 GATase1_CobB Type 1 glutamine amidotransferase (GATase1 98.98
COG2071243 Predicted glutamine amidotransferases [General function 98.97
PRK05665240 amidotransferase; Provisional 98.97
PRK06490243 glutamine amidotransferase; Provisional 98.93
PRK09065238 glutamine amidotransferase; Provisional 98.92
PRK09522 531 bifunctional anthranilate synthase/anthranilate phospho 98.88
KOG0623 541 consensus 98.85
PRK06186229 hypothetical protein; Validated 98.83
PRK05380534 pyrG CTP synthetase; Validated 98.82
PRK07567242 glutamine amidotransferase; Provisional 98.81
PRK05637208 anthranilate synthase component II; Provisional 98.8
PRK07053235 glutamine amidotransferase; Provisional 98.72
cd01747273 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransf 98.66
COG0512191 PabA Anthranilate/para-aminobenzoate synthases componen 98.5
PRK13896432 cobyrinic acid a,c-diamide synthase; Provisional 98.45
TIGR01368383 CPSaseIIsmall carbamoyl-phosphate synthase, small subun 98.36
KOG1224 767 consensus 98.3
PRK12838356 carbamoyl phosphate synthase small subunit; Reviewed 98.29
KOG3210226 consensus 97.94
TIGR00566212 trpG_papA glutamine amidotransferase of anthranilate sy 97.91
COG1797451 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme meta 97.88
PRK13566724 anthranilate synthase; Provisional 97.84
pfam09825 364 BPL_N Biotin-protein ligase, N terminal. The function o 97.64
COG0505368 CarA Carbamoylphosphate synthase small subunit [Amino a 97.58
TIGR01815726 TrpE-clade3 anthranilate synthase; InterPro: IPR010112 97.56
COG3442250 Predicted glutamine amidotransferase [General function 96.87
COG4285253 Uncharacterized conserved protein [Function unknown] 96.85
KOG1559340 consensus 96.78
cd01750194 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1 99.21
COG1492486 CobQ Cobyric acid synthase [Coenzyme metabolism] 98.51
cd03134165 GATase1_PfpI_like A type 1 glutamine amidotransferase ( 98.41
cd03135163 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1 98.4
cd03169180 GATase1_PfpI_1 Type 1 glutamine amidotransferase (GATas 98.31
cd03140170 GATase1_PfpI_3 Type 1 glutamine amidotransferase (GATas 98.23
PRK11574196 hypothetical protein; Provisional 98.15
cd03137187 GATase1_AraC_1 AraC transcriptional regulators having a 98.01
cd0312892 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like 98.01
cd01653115 GATase1 Type 1 glutamine amidotransferase (GATase1)-lik 97.89
COG0693188 ThiJ Putative intracellular protease/amidase [General f 97.86
PRK09393320 ftrA transcriptional activator FtrA; Provisional 97.67
cd03136185 GATase1_AraC_ArgR_like AraC transcriptional regulators 97.53
cd03132142 GATase1_catalase Type 1 glutamine amidotransferase (GAT 97.14
KOG0370 1435 consensus 96.08
COG4977328 Transcriptional regulator containing an amidase domain 94.42
cd03144114 GATase1_ScBLP_like Type 1 glutamine amidotransferase (G 94.37
PRK05282233 peptidase E; Validated 93.4
cd03146212 GAT1_Peptidase_E Type 1 glutamine amidotransferase (GAT 93.27
cd03145217 GAT1_cyanophycinase Type 1 glutamine amidotransferase ( 92.64
COG1348278 NifH Nitrogenase subunit NifH (ATPase) [Inorganic ion t 90.42
KOG0026223 consensus 90.33
TIGR00337571 PyrG CTP synthase; InterPro: IPR004468 CTP synthase is 98.83
KOG1622 552 consensus 98.77
CHL00197383 carA carbamoyl-phosphate synthase arginine-specific sma 98.23
KOG2387585 consensus 97.7
pfam04204298 HTS Homoserine O-succinyltransferase. 94.36
PRK05368302 homoserine O-succinyltransferase; Provisional 94.2
pfam07685158 GATase_3 CobB/CobQ-like glutamine amidotransferase doma 98.81
TIGR01382189 PfpI intracellular protease, PfpI family; InterPro: IPR 98.47
cd03139183 GATase1_PfpI_2 Type 1 glutamine amidotransferase (GATas 97.97
pfam01965141 DJ-1_PfpI DJ-1/PfpI family. The family includes the pro 97.83
cd03138195 GATase1_AraC_2 AraC transcriptional regulators having a 97.14
TIGR01383186 not_thiJ DJ-1 family protein; InterPro: IPR006287 These 96.97
TIGR01823 851 PabB-fungal para-aminobenzoate synthase; InterPro: IPR0 96.77
KOG3179245 consensus 96.36
cd03141221 GATase1_Hsp31_like Type 1 glutamine amidotransferase (G 95.46
cd03133213 GATase1_ES1 Type 1 glutamine amidotransferase (GATase1) 95.09
PRK11780217 isoprenoid biosynthesis protein with amidotransferase-l 94.74
cd03147231 GATase1_Ydr533c_like Type 1 glutamine amidotransferase 92.41
PRK12564355 carbamoyl phosphate synthase small subunit; Reviewed 98.36
TIGR00379464 cobB cobyrinic acid a,c-diamide synthase; InterPro: IPR 96.53
KOG2764247 consensus 94.53
>TIGR01737 FGAM_synth_I phosphoribosylformylglycinamidine synthase I; InterPro: IPR010075 In some species, phosphoribosylformylglycinamidine synthase is composed of a single polypeptide chain Back     alignment and domain information
>PRK03619 phosphoribosylformylglycinamidine synthase subunit I; Provisional Back     alignment and domain information
>COG0047 PurL Phosphoribosylformylglycinamidine (FGAM) synthase, glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK01175 phosphoribosylformylglycinamidine synthase subunit I; Provisional Back     alignment and domain information
>cd01740 GATase1_FGAR_AT Type 1 glutamine amidotransferase (GATase1)-like domain found in Formylglycinamide ribonucleotide amidotransferase Back     alignment and domain information
>TIGR01735 FGAM_synt phosphoribosylformylglycinamidine synthase; InterPro: IPR010073 This entry represents a single-molecule form of phosphoribosylformylglycinamidine synthase, also called FGAM synthase, an enzyme of purine de novo biosynthesis Back     alignment and domain information
>PRK05297 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>KOG1907 consensus Back     alignment and domain information
>TIGR01857 FGAM-synthase phosphoribosylformylglycinamidine synthase; InterPro: IPR010141 This entry represents a single-molecule form of phosphoribosylformylglycinamidine synthase, also called FGAM synthase, an enzyme of purine de novo biosynthesis, which represent a second clade of the enzymes found in Clostridia, Bifidobacteria and Streptococcus species Back     alignment and domain information
>TIGR01739 tegu_FGAM_synt herpesvirus tegument protein/v-FGAM-synthase; InterPro: IPR010077 This entry describes a family of large proteins of herpes virus Back     alignment and domain information
>PRK13143 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13153 consensus Back     alignment and domain information
>PRK13175 consensus Back     alignment and domain information
>PRK13525 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>COG0118 HisH Glutamine amidotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13147 consensus Back     alignment and domain information
>PRK13180 consensus Back     alignment and domain information
>PRK13146 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13527 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK13181 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>TIGR01855 IMP_synth_hisH imidazole glycerol phosphate synthase, glutamine amidotransferase subunit; InterPro: IPR010139 Imidazole glycerol phosphate synthetase (IGPS) is a key metabolic enzyme, which links amino acid and nucleotide biosynthesis: it catalyses the closure of the imidazole ring within histidine biosynthesis (fifth step), and provides the substrate for de novo purine biosynthesis Back     alignment and domain information
>PRK13141 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13170 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13148 consensus Back     alignment and domain information
>PRK13172 consensus Back     alignment and domain information
>PRK13173 consensus Back     alignment and domain information
>PRK13178 consensus Back     alignment and domain information
>cd01748 GATase1_IGP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in imidazole glycerol phosphate synthase (IGPS) Back     alignment and domain information
>PRK13174 consensus Back     alignment and domain information
>CHL00188 hisH imidazole glycerol phosphate synthase subunit hisH; Provisional Back     alignment and domain information
>PRK13152 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>PRK13151 consensus Back     alignment and domain information
>pfam01174 SNO SNO glutamine amidotransferase family Back     alignment and domain information
>PRK13171 consensus Back     alignment and domain information
>cd01749 GATase1_PB Glutamine Amidotransferase (GATase_I) involved in pyridoxine biosynthesis Back     alignment and domain information
>PRK13179 consensus Back     alignment and domain information
>PRK13177 consensus Back     alignment and domain information
>PRK13144 consensus Back     alignment and domain information
>PRK13176 consensus Back     alignment and domain information
>PRK13142 hisH imidazole glycerol phosphate synthase subunit HisH; Provisional Back     alignment and domain information
>cd01742 GATase1_GMP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in GMP synthetase Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>PRK00784 cobyric acid synthase; Provisional Back     alignment and domain information
>PRK07765 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>cd01743 GATase1_Anthranilate_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Anthranilate synthase Back     alignment and domain information
>PRK06895 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>TIGR00888 guaA_Nterm GMP synthase, N-terminal domain; InterPro: IPR004739 The N-terminal region of GMP synthase 6 Back     alignment and domain information
>pfam00117 GATase Glutamine amidotransferase class-I Back     alignment and domain information
>PRK13526 glutamine amidotransferase subunit PdxT; Provisional Back     alignment and domain information
>PRK00758 GMP synthase subunit A; Validated Back     alignment and domain information
>COG0311 PDX2 Predicted glutamine amidotransferase involved in pyridoxine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK08857 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>cd01744 GATase1_CPSase Small chain of the glutamine-dependent form of carbamoyl phosphate synthase, CPSase II Back     alignment and domain information
>PRK05670 anthranilate synthase component II; Provisional Back     alignment and domain information
>COG0518 GuaA GMP synthase - Glutamine amidotransferase domain [Nucleotide transport and metabolism] Back     alignment and domain information
>cd01745 GATase1_2 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>PRK06278 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>CHL00101 trpG anthranilate synthase component 2 Back     alignment and domain information
>PRK11366 puuD gamma-glutamyl-gamma-aminobutyrate hydrolase; Provisional Back     alignment and domain information
>PRK08007 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK06774 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK08250 glutamine amidotransferase; Provisional Back     alignment and domain information
>cd01746 GATase1_CTP_Synthase Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase Back     alignment and domain information
>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00313 cobQ cobyric acid synthase CobQ; InterPro: IPR004459 Cobyric acid synthase (CobQ) catalyses amidations at positions B, D, E, and G on adenosylcobyrinic A,C-diamide in the biosynthesis of cobalamin Back     alignment and domain information
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>cd01741 GATase1_1 Subgroup of proteins having the Type 1 glutamine amidotransferase (GATase1) domain Back     alignment and domain information
>pfam07722 Peptidase_C26 Peptidase C26 Back     alignment and domain information
>cd03130 GATase1_CobB Type 1 glutamine amidotransferase (GATase1) domain found in Cobyrinic Acid a,c-Diamide Synthase Back     alignment and domain information
>COG2071 Predicted glutamine amidotransferases [General function prediction only] Back     alignment and domain information
>PRK05665 amidotransferase; Provisional Back     alignment and domain information
>PRK06490 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK09065 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK09522 bifunctional anthranilate synthase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>KOG0623 consensus Back     alignment and domain information
>PRK06186 hypothetical protein; Validated Back     alignment and domain information
>PRK05380 pyrG CTP synthetase; Validated Back     alignment and domain information
>PRK07567 glutamine amidotransferase; Provisional Back     alignment and domain information
>PRK05637 anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK07053 glutamine amidotransferase; Provisional Back     alignment and domain information
>cd01747 GATase1_Glutamyl_Hydrolase Type 1 glutamine amidotransferase (GATase1) domain found in gamma-Glutamyl Hydrolase Back     alignment and domain information
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional Back     alignment and domain information
>TIGR01368 CPSaseIIsmall carbamoyl-phosphate synthase, small subunit; InterPro: IPR006274 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>KOG1224 consensus Back     alignment and domain information
>PRK12838 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>KOG3210 consensus Back     alignment and domain information
>TIGR00566 trpG_papA glutamine amidotransferase of anthranilate synthase or para-aminobenzoate synthase; InterPro: IPR006221 This entry presents the glutamine amidotransferase domain or peptide of the tryptophan-biosynthetic pathway enzyme anthranilate synthase or of the folate biosynthetic pathway enzyme para-aminobenzoate synthase Back     alignment and domain information
>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK13566 anthranilate synthase; Provisional Back     alignment and domain information
>pfam09825 BPL_N Biotin-protein ligase, N terminal Back     alignment and domain information
>COG0505 CarA Carbamoylphosphate synthase small subunit [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01815 TrpE-clade3 anthranilate synthase; InterPro: IPR010112 This entry represents a small clade of anthranilate synthases from alpha proteobacteria and Nostoc (a cyanobacterium) Back     alignment and domain information
>COG3442 Predicted glutamine amidotransferase [General function prediction only] Back     alignment and domain information
>COG4285 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1559 consensus Back     alignment and domain information
>cd01750 GATase1_CobQ Type 1 glutamine amidotransferase (GATase1) domain found in Cobyric Acid Synthase (CobQ) Back     alignment and domain information
>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] Back     alignment and domain information
>cd03134 GATase1_PfpI_like A type 1 glutamine amidotransferase (GATase1)-like domain found in PfpI from Pyrococcus furiosus Back     alignment and domain information
>cd03135 GATase1_DJ-1 Type 1 glutamine amidotransferase (GATase1)-like domain found in Human DJ-1 Back     alignment and domain information
>cd03169 GATase1_PfpI_1 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>cd03140 GATase1_PfpI_3 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>PRK11574 hypothetical protein; Provisional Back     alignment and domain information
>cd03137 GATase1_AraC_1 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>cd03128 GAT_1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>cd01653 GATase1 Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>COG0693 ThiJ Putative intracellular protease/amidase [General function prediction only] Back     alignment and domain information
>PRK09393 ftrA transcriptional activator FtrA; Provisional Back     alignment and domain information
>cd03136 GATase1_AraC_ArgR_like AraC transcriptional regulators having an N-terminal Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>cd03132 GATase1_catalase Type 1 glutamine amidotransferase (GATase1)-like domain found in at the C-terminal of several large catalases Back     alignment and domain information
>KOG0370 consensus Back     alignment and domain information
>COG4977 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain [Transcription] Back     alignment and domain information
>cd03144 GATase1_ScBLP_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Saccharomyces cerevisiae biotin-apoprotein ligase (ScBLP) Back     alignment and domain information
>PRK05282 peptidase E; Validated Back     alignment and domain information
>cd03146 GAT1_Peptidase_E Type 1 glutamine amidotransferase (GATase1)-like domain found in peptidase E Back     alignment and domain information
>cd03145 GAT1_cyanophycinase Type 1 glutamine amidotransferase (GATase1)-like domain found in cyanophycinase Back     alignment and domain information
>COG1348 NifH Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0026 consensus Back     alignment and domain information
>TIGR00337 PyrG CTP synthase; InterPro: IPR004468 CTP synthase is involved in pyrimidine ribonucleotide/ribonucleoside metabolism Back     alignment and domain information
>KOG1622 consensus Back     alignment and domain information
>CHL00197 carA carbamoyl-phosphate synthase arginine-specific small subunit; Provisional Back     alignment and domain information
>KOG2387 consensus Back     alignment and domain information
>pfam04204 HTS Homoserine O-succinyltransferase Back     alignment and domain information
>PRK05368 homoserine O-succinyltransferase; Provisional Back     alignment and domain information
>pfam07685 GATase_3 CobB/CobQ-like glutamine amidotransferase domain Back     alignment and domain information
>TIGR01382 PfpI intracellular protease, PfpI family; InterPro: IPR006286 Peptidases are grouped into clans and families Back     alignment and domain information
>cd03139 GATase1_PfpI_2 Type 1 glutamine amidotransferase (GATase1)-like domain found in a subgroup of proteins similar to PfpI from Pyrococcus furiosus Back     alignment and domain information
>pfam01965 DJ-1_PfpI DJ-1/PfpI family Back     alignment and domain information
>cd03138 GATase1_AraC_2 AraC transcriptional regulators having a Type 1 glutamine amidotransferase (GATase1)-like domain Back     alignment and domain information
>TIGR01383 not_thiJ DJ-1 family protein; InterPro: IPR006287 These sequences represent the DJ-1 clade of the so-called ThiJ/PfpI family of proteins Back     alignment and domain information
>TIGR01823 PabB-fungal para-aminobenzoate synthase; InterPro: IPR010117 This entry represents the fungal clade of para-aminobenzoate synthase, which acts on chorismate to form para-aminobenzoic acid (PABA), a precursor of folate Back     alignment and domain information
>KOG3179 consensus Back     alignment and domain information
>cd03141 GATase1_Hsp31_like Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Escherichia coli Hsp31 protein Back     alignment and domain information
>cd03133 GATase1_ES1 Type 1 glutamine amidotransferase (GATase1)-like domain found in zebrafish ES1 Back     alignment and domain information
>PRK11780 isoprenoid biosynthesis protein with amidotransferase-like domain; Provisional Back     alignment and domain information
>cd03147 GATase1_Ydr533c_like Type 1 glutamine amidotransferase (GATase1)-like domain found in Saccharomyces cerevisiae Ydr533c protein Back     alignment and domain information
>PRK12564 carbamoyl phosphate synthase small subunit; Reviewed Back     alignment and domain information
>TIGR00379 cobB cobyrinic acid a,c-diamide synthase; InterPro: IPR004484 This family describes cobyrinic acid a,c-diamide synthase, the cobB (cbiA in Salmonella) protein of cobalamin biosynthesis Back     alignment and domain information
>KOG2764 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target219 phosphoribosylformylglycinamidine synthase subunit I [C
3d54_D213 Stucture Of Purlqs From Thermotoga Maritima Length 1e-49
1t3t_A1303 Structure Of Formylglycinamide Synthetase Length = 4e-45
1ox4_A 555 Towards Understanding The Mechanism Of The Complex 9e-05
1jvn_A 555 Crystal Structure Of Imidazole Glycerol Phosphate S 5e-04
>gi|194368759|pdb|3D54|D Chain D, Stucture Of Purlqs From Thermotoga Maritima Length = 213 Back     alignment and structure
 Score =  200 bits (508), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 96/217 (44%), Positives = 130/217 (59%), Gaps = 12/217 (5%)

Query: 2   KTAIVQIPGLNRDNDMIKAITKIIGQSPILVWQSDTDIPDVDLIVIPGGFSYGDYLRCGA 61
           +  +V  PG N D D   A+  I G  P  V   D  + D +LI++PGGFSYGDYLR GA
Sbjct: 4   RACVVVYPGSNCDRDAYHALE-INGFEPSYVGLDD-KLDDYELIILPGGFSYGDYLRPGA 61

Query: 62  IAARTPVMQAIKKKAQQGIKVMGICNGFQILVELNLLPGILMRNCSLKFVCKQVLLEVVN 121
           +AAR  +   I K A++G  +MGI NGFQIL+E+ LL G L++N S KF+CK V L V N
Sbjct: 62  VAAREKIAFEIAKAAERGKLIMGIXNGFQILIEMGLLKGALLQNSSGKFICKWVDLIVEN 121

Query: 122 SNTAFTKSYKMNQIIKCPVAHHDGNYFIDAKGLAEIEKNNQIVFRYASGTNPNGSLHDIA 181
           ++T FT +++  + I+ P+AH  G Y            +  +V RY    N  GS   IA
Sbjct: 122 NDTPFTNAFEKGEKIRIPIAHGFGRY--------VKIDDVNVVLRYVKDVN--GSDERIA 171

Query: 182 GVINRRGNVLGMMPHPENIIEKFHGGIDGRGLFASLL 218
           GV+N  GNV G+MPHPE  +E+  GG DG+ +F S+L
Sbjct: 172 GVLNESGNVFGLMPHPERAVEELIGGEDGKKVFQSIL 208


>gi|55669841|pdb|1T3T|A Chain A, Structure Of Formylglycinamide Synthetase Length = 1303 Back     alignment and structure
>gi|33357789|pdb|1OX4|A Chain A, Towards Understanding The Mechanism Of The Complex Cyclization Reaction Catalyzed By Imidazole Glycerophosphate Synthase Length = 555 Back     alignment and structure
>gi|16975311|pdb|1JVN|A Chain A, Crystal Structure Of Imidazole Glycerol Phosphate Synthase: A Tunnel Through A (BetaALPHA)8 BARREL JOINS TWO ACTIVE Sites Length = 555 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target219 phosphoribosylformylglycinamidine synthase subunit I [C
1t3t_A1303 Phosphoribosylformylglycinamidine synthase; PURL, FGAM 1e-31
3d54_D213 Phosphoribosylformylglycinamidine synthase 1; alpha-bet 7e-30
1q7r_A219 Predicted amidotransferase; structural genomics, YAAE, 5e-16
1l9x_A315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c. 9e-09
2nv0_A196 Glutamine amidotransferase subunit PDXT; 3-layer(ABA) s 3e-08
1jvn_A 555 Glutamine, bifunctional histidine biosynthesis protein 2e-05
2iss_D208 Glutamine amidotransferase subunit PDXT; (beta/alpha)8- 2e-05
1ka9_H200 Imidazole glycerol phosphtate synthase; riken structura 6e-05
2abw_A227 PDX2 protein, glutaminase; PLP-synthase, vitamin B6, ma 9e-05
3fij_A254 LIN1909 protein; 11172J, uncharacterized protein, nysgr 1e-04
1gpw_B201 Amidotransferase HISH; lyase/transferase, complex (lyas 6e-04
3cne_A175 Putative protease I; structural genomics, PSI-2, MCSG, 1e-05
3fse_A 365 Two-domain protein containing DJ-1/THIJ/PFPI- like and 6e-05
3bhn_A236 THIJ/PFPI domain protein; YP_001094981.1, DJ-1 like pro 0.001
3efe_A212 THIJ/PFPI family protein; structural genomics, csgid, c 0.003
1sy7_A715 Catalase 1; heme oxidation, singlet oxygen, oxidoreduct 0.004
1o1y_A239 Conserved hypothetical protein TM1158; structural genom 6e-04
3l83_A250 Glutamine amido transferase; structural genomics, nysgr 0.004
>1t3t_A Phosphoribosylformylglycinamidine synthase; PURL, FGAM synthetase, PURS, PURQ, formyl glycinamide, ligase; HET: CYG ADP; 1.90A {Salmonella typhimurium} SCOP: a.5.10.1 c.23.16.1 d.284.1.2 d.79.4.1 d.79.4.1 d.139.1.1 d.139.1.1 Length = 1303 Back     alignment and structure
 Score =  131 bits (329), Expect = 1e-31
 Identities = 64/224 (28%), Positives = 93/224 (41%), Gaps = 29/224 (12%)

Query: 2    KTAIVQIPGLNRDNDMIKAITKIIGQSPILVWQSD-----TDIPDVDLIVIPGGFSYGDY 56
            K A+++  G+N   +M  A  +  G   I V  SD       + +   +V  GGFSYGD 
Sbjct: 1049 KVAVLREQGVNSHVEMAAAFHRA-GFDAIDVHMSDLLGGRIGLGNFHALVACGGFSYGDV 1107

Query: 57   LRCGAIAART-----PVMQAIKK-KAQQGIKVMGICNGFQILVELNLL-PG-----ILMR 104
            L  G   A++      V    +    +     +G+CNG Q++  L  L PG       +R
Sbjct: 1108 LGAGEGWAKSILFNHRVRDEFETFFHRPQTLALGVCNGCQMMSNLRELIPGSELWPRFVR 1167

Query: 105  NCSLKFVCKQVLLEVVNSNTAFTKSYKMNQIIKCPVAHHDGN-YFIDAKGLAEIEKNNQI 163
            N S +F  +  L+EV  S +   +       +   V+H +G     D   LA +E    +
Sbjct: 1168 NHSDRFEARFSLVEVTQSPSLLLQGMV-GSQMPIAVSHGEGRVEVRDDAHLAALESKGLV 1226

Query: 164  VFRYASGT---------NPNGSLHDIAGVINRRGNVLGMMPHPE 198
              RY             NPNGS + I  V    G V  MMPHPE
Sbjct: 1227 ALRYVDNFGKVTETYPANPNGSPNGITAVTTENGRVTIMMPHPE 1270


>3d54_D Phosphoribosylformylglycinamidine synthase 1; alpha-beta structure, ATP-binding, cytoplasm, ligase, nucleotide-binding, purine biosynthesis; HET: CYG ADP; 3.50A {Thermotoga maritima} Length = 213 Back     alignment and structure
>1q7r_A Predicted amidotransferase; structural genomics, YAAE, PDX2, predicted glutamine amidotransferase, PSI; HET: MSE; 1.90A {Geobacillus stearothermophilus} SCOP: c.23.16.1 Length = 219 Back     alignment and structure
>1l9x_A Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c.23.16.1 Length = 315 Back     alignment and structure
>2nv0_A Glutamine amidotransferase subunit PDXT; 3-layer(ABA) sandwich, rossmann fold, glutaminase; 1.73A {Bacillus subtilis} SCOP: c.23.16.1 PDB: 1r9g_A 2nv2_B* Length = 196 Back     alignment and structure
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A substrate tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A Length = 555 Back     alignment and structure
>2iss_D Glutamine amidotransferase subunit PDXT; (beta/alpha)8-barrel, alpha/beta three layer sandwich, lyase; HET: 5RP; 2.90A {Thermotoga maritima} Length = 208 Back     alignment and structure
>1ka9_H Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.23.16.1 Length = 200 Back     alignment and structure
>2abw_A PDX2 protein, glutaminase; PLP-synthase, vitamin B6, malaria, transferase; HET: PG4; 1.62A {Plasmodium falciparum} SCOP: c.23.16.1 Length = 227 Back     alignment and structure
>3fij_A LIN1909 protein; 11172J, uncharacterized protein, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.30A {Listeria innocua} Length = 254 Back     alignment and structure
>1gpw_B Amidotransferase HISH; lyase/transferase, complex (lyase/transferase), histidine biosynthesis, glutaminase, glutamine amidotransferase; 2.4A {Thermotoga maritima} SCOP: c.23.16.1 PDB: 1k9v_F 1kxj_A Length = 201 Back     alignment and structure
>3cne_A Putative protease I; structural genomics, PSI-2, MCSG, protein structure initiative, midwest center for structural genomics; HET: FMN; 1.99A {Bacteroides thetaiotaomicron vpi-5482} Length = 175 Back     alignment and structure
>3fse_A Two-domain protein containing DJ-1/THIJ/PFPI- like and ferritin-like domains; YP_324989.1, structural genomics; HET: MSE CSX; 1.90A {Anabaena variabilis atcc 29413} Length = 365 Back     alignment and structure
>3bhn_A THIJ/PFPI domain protein; YP_001094981.1, DJ-1 like protein, DJ-1/PFPI family, structural genomics, joint center for structural genomics; HET: MSE; 1.76A {Shewanella loihica pv-4} Length = 236 Back     alignment and structure
>3efe_A THIJ/PFPI family protein; structural genomics, csgid, center for structural genomics of infectious diseases, chaperone; 2.30A {Bacillus anthracis} Length = 212 Back     alignment and structure
>1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3 Length = 715 Back     alignment and structure
>1o1y_A Conserved hypothetical protein TM1158; structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.70A {Thermotoga maritima} SCOP: c.23.16.1 Length = 239 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target219 phosphoribosylformylglycinamidine synthase subunit I [C
1t3t_A1303 Phosphoribosylformylglycinamidine synthase; PURL, FGAM 100.0
3d54_D213 Phosphoribosylformylglycinamidine synthase 1; alpha-bet 100.0
1q7r_A219 Predicted amidotransferase; structural genomics, YAAE, 99.89
2iss_D208 Glutamine amidotransferase subunit PDXT; (beta/alpha)8- 99.87
2abw_A227 PDX2 protein, glutaminase; PLP-synthase, vitamin B6, ma 99.84
1jvn_A 555 Glutamine, bifunctional histidine biosynthesis protein 99.83
1ka9_H200 Imidazole glycerol phosphtate synthase; riken structura 99.82
2nv0_A196 Glutamine amidotransferase subunit PDXT; 3-layer(ABA) s 99.79
1gpw_B201 Amidotransferase HISH; lyase/transferase, complex (lyas 99.77
2ywj_A186 Glutamine amidotransferase subunit PDXT; uncharacterize 99.76
2a9v_A212 GMP synthase; NP_394403.1, , structural genomics, joint 99.7
2ywd_A191 Glutamine amidotransferase subunit PDXT; pyridoxine bio 99.68
1wl8_A189 GMP synthase [glutamine-hydrolyzing] subunit A; transfe 99.52
1qdl_B195 Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptop 99.49
1l9x_A315 Gamma-glutamyl hydrolase; 1.60A {Homo sapiens} SCOP: c. 99.46
2ywb_A 503 GMP synthase [glutamine-hydrolyzing]; GMP synthetase, X 99.41
2vxo_A 697 GMP synthase [glutamine-hydrolyzing]; proto-oncogene, p 99.38
3fij_A254 LIN1909 protein; 11172J, uncharacterized protein, nysgr 99.37
1gpm_A 525 GMP synthetase, XMP aminase; class I glutamine amidotra 99.34
1o1y_A239 Conserved hypothetical protein TM1158; structural genom 99.33
2vpi_A218 GMP synthase; guanine monophosphate synthetase, phospho 99.32
1i1q_B192 Anthranilate synthase component II; tryptophan biosynth 99.23
2w7t_A273 CTP synthetase, putative cytidine triphosphate synthase 99.23
2v4u_A289 CTP synthase 2; pyrimidine biosynthesis, glutamine amid 99.17
3m3p_A250 Glutamine amido transferase; structural genomics, nysgr 99.09
1vco_A550 CTP synthetase; tetramer, riken structural genomics/pro 99.07
3nva_A535 CTP synthase; rossman fold, nucleotide binding, LIG; 2. 99.01
1s1m_A545 CTP synthase; CTP synthetase, UTP:ammonia ligase (ADP-f 98.99
1a9x_B379 Carbamoyl phosphate synthetase (small chain); amidotran 98.95
2vdj_A301 Homoserine O-succinyltransferase; methionine biosynthes 98.09
3cne_A175 Putative protease I; structural genomics, PSI-2, MCSG, 98.73
1g2i_A166 Protease I; intracellular protease, ATP-independent int 98.72
2fex_A188 Conserved hypothetical protein; structural genomics, pr 98.53
1oi4_A193 Hypothetical protein YHBO; PFPI/THIJ family, complete p 98.52
2rk3_A197 Protein DJ-1; parkinson'S disease, THIJ, PFPI, chaperon 98.51
2vrn_A190 Protease I, DR1199; cysteine sulfenic acid, DJ-1/THIJ/P 98.49
3fse_A 365 Two-domain protein containing DJ-1/THIJ/PFPI- like and 98.49
3noq_A