254780972

254780972

phosphoribosylformylglycinamidine synthase, PurS protein

GeneID in NCBI database:8209994Locus tag:CLIBASIA_04365
Protein GI in NCBI database:254780972Protein Accession:YP_003065385.1
Gene range:-(969219, 969473)Protein Length:84aa
Gene description:phosphoribosylformylglycinamidine synthase, PurS protein
COG prediction:[F] Phosphoribosylformylglycinamidine (FGAM) synthase, PurS component
KEGG prediction:purS; phosphoribosylformylglycinamidine synthase, PurS protein; K01952 phosphoribosylformylglycinamidine synthase [EC:6.3.5.3]
SEED prediction:Phosphoribosylformylglycinamidine synthase, PurS subunit (EC 6.3.5.3)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
Subsystem involved in SEED:De Novo Purine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80----
MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVIEDYDIKVQKSSS
cEEEEEEEEEccccccHHHHHHHHHHHHcccccHHHcEEEEEEEEEEccccHHHHHHHHHHHHHHHcccccEEEEEEEEEEccc
ccEEEEEEEccccccccHHHHHHHHHHHccccccccEEEcEEEEEEEccccHHHHHHHHHHHHHHHHcccEEEEEEEEEEEccc
MIKANVVVKLKKDVLDPQGKALKTALSNigfhninqirqgkifdiEMDETLSDIAEEELESICQNLlanpviedydikvqksss
mikanvvvklkkdvldpqGKALKTalsnigfhninqiRQGKIFDIEMDETLSDIAEEELESICQNLlanpviedydikvqksss
MIKANvvvklkkdvldPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVIEDYDIKVQKSSS
MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVIEDYDIKVQKS**
MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVIEDYDIKVQKSSS
MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVIEDYDIKVQKS**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVIEDYDIKVQKSSS
MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVIEDYDIKVQKSSS
MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVIEDYDIKVQKSSS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target84 phosphoribosylformylglycinamidine synthase, PurS protei
31512261084 phosphoribosylformylglycinamidine synthase, PurS protei 1 7e-35
9042094279 phosphoribosylformylglycinamidine (FGAM) synthase, PurS 1 4e-18
16384311480 phosphoribosylformylglycinamidine synthase subunit PurS 1 2e-17
25450242886 phosphoribosylformylglycinamidine synthase, purS protei 1 2e-17
25606094880 phosphoribosylformylglycinamidine synthase subunit PurS 1 3e-17
15300971180 phosphoribosylformylglycinamidine synthase subunit PurS 1 3e-17
30794558979 phosphoribosylformylglycinamidine synthase, PurS protei 1 3e-17
22782216780 phosphoribosylformylglycinamidine synthase subunit PurS 1 3e-17
23983172580 phosphoribosylformylglycinamidine synthase, purS protei 1 4e-17
22208613280 phosphoribosylformylglycinamidine synthase, purS protei 1 5e-17
>gi|315122610|ref|YP_004063099.1| phosphoribosylformylglycinamidine synthase, PurS protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 84 Back     alignment and organism information
 Score =  150 bits (378), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 73/83 (87%), Positives = 79/83 (95%)

Query: 1  MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELE 60
          MIKANV+VKLKKDVLDPQGKALKTALSNIGFHNI+QIRQGK+FDIEMDET  DIA++E+E
Sbjct: 1  MIKANVIVKLKKDVLDPQGKALKTALSNIGFHNISQIRQGKVFDIEMDETNPDIAKKEIE 60

Query: 61 SICQNLLANPVIEDYDIKVQKSS 83
          SICQNLLANPVIEDYDI VQK S
Sbjct: 61 SICQNLLANPVIEDYDISVQKYS 83


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|90420942|ref|ZP_01228847.1| phosphoribosylformylglycinamidine (FGAM) synthase, PurS component [Aurantimonas manganoxydans SI85-9A1] Length = 79 Back     alignment and organism information
>gi|163843114|ref|YP_001627518.1| phosphoribosylformylglycinamidine synthase subunit PurS [Brucella suis ATCC 23445] Length = 80 Back     alignment and organism information
>gi|254502428|ref|ZP_05114579.1| phosphoribosylformylglycinamidine synthase, purS protein [Labrenzia alexandrii DFL-11] Length = 86 Back     alignment and organism information
>gi|256060948|ref|ZP_05451106.1| phosphoribosylformylglycinamidine synthase subunit PurS [Brucella neotomae 5K33] Length = 80 Back     alignment and organism information
>gi|153009711|ref|YP_001370926.1| phosphoribosylformylglycinamidine synthase subunit PurS [Ochrobactrum anthropi ATCC 49188] Length = 80 Back     alignment and organism information
>gi|307945589|ref|ZP_07660925.1| phosphoribosylformylglycinamidine synthase, PurS protein [Roseibium sp. TrichSKD4] Length = 79 Back     alignment and organism information
>gi|227822167|ref|YP_002826138.1| phosphoribosylformylglycinamidine synthase subunit PurS [Sinorhizobium fredii NGR234] Length = 80 Back     alignment and organism information
>gi|239831725|ref|ZP_04680054.1| phosphoribosylformylglycinamidine synthase, purS protein [Ochrobactrum intermedium LMG 3301] Length = 80 Back     alignment and organism information
>gi|222086132|ref|YP_002544664.1| phosphoribosylformylglycinamidine synthase, purS protein [Agrobacterium radiobacter K84] Length = 80 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target84 phosphoribosylformylglycinamidine synthase, PurS protei
PRK0597480 PRK05974, PRK05974, phosphoribosylformylglycinamidine s 2e-24
COG182883 COG1828, PurS, Phosphoribosylformylglycinamidine (FGAM) 2e-19
TIGR0030280 TIGR00302, TIGR00302, phosphoribosylformylglycinamidine 1e-17
PRK0642373 PRK06423, PRK06423, phosphoribosylformylglycinamidine s 3e-05
pfam0270080 pfam02700, PurS, Phosphoribosylformylglycinamidine (FGA 3e-23
>gnl|CDD|180332 PRK05974, PRK05974, phosphoribosylformylglycinamidine synthase subunit PurS; Reviewed Back     alignment and domain information
>gnl|CDD|32013 COG1828, PurS, Phosphoribosylformylglycinamidine (FGAM) synthase, PurS component [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|129402 TIGR00302, TIGR00302, phosphoribosylformylglycinamidine synthase, purS protein Back     alignment and domain information
>gnl|CDD|102368 PRK06423, PRK06423, phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>gnl|CDD|145710 pfam02700, PurS, Phosphoribosylformylglycinamidine (FGAM) synthase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 84 phosphoribosylformylglycinamidine synthase, PurS protei
TIGR0030280 TIGR00302 phosphoribosylformylglycinamidine synthase, p 99.98
COG182883 PurS Phosphoribosylformylglycinamidine (FGAM) synthase, 99.97
pfam0270080 PurS Phosphoribosylformylglycinamidine (FGAM) synthase. 99.97
PRK0597479 phosphoribosylformylglycinamidine synthase subunit PurS 99.97
PRK0642373 phosphoribosylformylglycinamidine synthase; Provisional 99.95
PRK0578384 hypothetical protein; Provisional 99.94
>TIGR00302 TIGR00302 phosphoribosylformylglycinamidine synthase, purS protein; InterPro: IPR003850 Phosphoribosylformylglycinamidine(FGAM) synthetase, 6 Back     alignment and domain information
>COG1828 PurS Phosphoribosylformylglycinamidine (FGAM) synthase, PurS component [Nucleotide transport and metabolism] Back     alignment and domain information
>pfam02700 PurS Phosphoribosylformylglycinamidine (FGAM) synthase Back     alignment and domain information
>PRK05974 phosphoribosylformylglycinamidine synthase subunit PurS; Reviewed Back     alignment and domain information
>PRK06423 phosphoribosylformylglycinamidine synthase; Provisional Back     alignment and domain information
>PRK05783 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target84 phosphoribosylformylglycinamidine synthase, PurS protei
1twj_A84 Crystal Structure Of B. Subtilis Purs P21 Crystal F 2e-24
1t4a_A84 Structure Of B. Subtilis Purs C2 Crystal Form Lengt 2e-21
2yx5_A83 Crystal Structure Of Methanocaldococcus Jannaschii 3e-18
1vq3_A94 Crystal Structure Of Phosphoribosylformylglycinamid 2e-14
3d54_B82 Stucture Of Purlqs From Thermotoga Maritima Length 3e-14
1gtd_A85 Northeast Structural Genomics Consortium (Nesg Id T 3e-14
2cuw_A84 Crystal Structure Of Thermus Thermophilus Purs, One 1e-11
2zw2_A92 Crystal Structure Of Formylglycinamide Ribonucleoti 2e-09
gi|52695885|pdb|1TWJ|A Chain A, Crystal Structure Of B. Subtilis Purs P21 Crystal Form Length = 84 Back     alignment and structure
 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 30/84 (35%), Positives = 54/84 (64%), Gaps = 1/84 (1%)

Query: 1  MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELE 60
          M K  V V LK+ VLDPQG A++ AL ++ ++ +  +R GK  ++ ++++  D+    ++
Sbjct: 1  MYKVKVYVSLKESVLDPQGSAVQHALHSMTYNEVQDVRIGKYMELTIEKSDRDLDV-LVK 59

Query: 61 SICQNLLANPVIEDYDIKVQKSSS 84
           +C+ LLAN VIEDY  +V++  +
Sbjct: 60 EMCEKLLANTVIEDYRYEVEEVVA 83


>gi|55669844|pdb|1T4A|A Chain A, Structure Of B. Subtilis Purs C2 Crystal Form Length = 84 Back     alignment and structure
gi|159795644|pdb|2YX5|A Chain A, Crystal Structure Of Methanocaldococcus Jannaschii Purs, One Of The Subunits Of Formylglycinamide Ribonucleotide Amidotransferase In The Purine Biosynthetic Pathway Length = 83 Back     alignment and structure
>gi|58177056|pdb|1VQ3|A Chain A, Crystal Structure Of Phosphoribosylformylglycinamidine Synthase, Purs Subunit (Ec 6.3.5.3) (Tm1244) From Thermotoga Maritima At 1.90 A Resolution Length = 94 Back     alignment and structure
gi|194368757|pdb|3D54|B Chain B, Stucture Of Purlqs From Thermotoga Maritima Length = 82 Back     alignment and structure
>gi|27573601|pdb|1GTD|A Chain A, Northeast Structural Genomics Consortium (Nesg Id Tt50) Structure Of Mth169, The Purs Subunit Of Fgam Synthetase Length = 85 Back     alignment and structure
>gi|83754881|pdb|2CUW|A Chain A, Crystal Structure Of Thermus Thermophilus Purs, One Of The Subunits Of Formylglycinamide Ribonucleotide Amidotransferase In The Purine Biosynthetic Pathway Length = 84 Back     alignment and structure
gi|268612231|pdb|2ZW2|A Chain A, Crystal Structure Of Formylglycinamide Ribonucleotide Amidotransferase Iii From Sulfolobus Tokodaii (Stpurs) Length = 92 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target84 phosphoribosylformylglycinamidine synthase, PurS protei
2yx5_A83 UPF0062 protein MJ1593; anti parallel beta sheet, NPPSF 5e-24
1vq3_A94 Phosphoribosylformylglycinamidine synthase, PURS subuni 1e-22
1t4a_A84 PURS; tetramer, complex formyl glycinamide synthetase, 7e-22
1gtd_A85 MTH169; synthetase, FGAM synthetase, purine synthesis p 1e-20
2zw2_A92 Putative uncharacterized protein STS178; purine metabol 2e-20
2dgb_A84 Hypothetical protein PURS; purine, structural genomics, 4e-19
>2yx5_A UPF0062 protein MJ1593; anti parallel beta sheet, NPPSFA, national project on protein structural and functional analyses; 2.30A {Methanocaldococcus jannaschii} Length = 83 Back     alignment and structure
 Score =  104 bits (262), Expect = 5e-24
 Identities = 38/81 (46%), Positives = 61/81 (75%)

Query: 1  MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELE 60
          M KA V++KLKK VL+P+G+ ++ AL+ +GF+N+ +++  K+ DI M+    +  +EE+E
Sbjct: 1  MYKATVIIKLKKGVLNPEGRTIQRALNFLGFNNVKEVQTYKMIDIIMEGENEEKVKEEVE 60

Query: 61 SICQNLLANPVIEDYDIKVQK 81
           +C+ LLANPVI DY+IKV+K
Sbjct: 61 EMCKKLLANPVIHDYEIKVEK 81


>1vq3_A Phosphoribosylformylglycinamidine synthase, PURS subunit; TM1244, PURS subunit (EC 6.3.5.3), structural genomics; 1.90A {Thermotoga maritima MSB8} SCOP: d.284.1.1 PDB: 3d54_B* Length = 94 Back     alignment and structure
>1t4a_A PURS; tetramer, complex formyl glycinamide synthetase, FGAR, FGAM, structural protein; 2.00A {Bacillus subtilis} SCOP: d.284.1.1 PDB: 1twj_A Length = 84 Back     alignment and structure
>1gtd_A MTH169; synthetase, FGAM synthetase, purine synthesis pathway, PSI, protein structure initiative, NESG; 2.56A {Methanobacterium thermoautotrophicum} SCOP: d.284.1.1 Length = 85 Back     alignment and structure
>2zw2_A Putative uncharacterized protein STS178; purine metabolism, ligase; 1.55A {Sulfolobus tokodaii} Length = 92 Back     alignment and structure
>2dgb_A Hypothetical protein PURS; purine, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.10A {Thermus thermophilus} PDB: 2cuw_A Length = 84 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target84 phosphoribosylformylglycinamidine synthase, PurS protei
2yx5_A83 UPF0062 protein MJ1593; anti parallel beta sheet, NPPSF 99.97
1t4a_A84 PURS; tetramer, complex formyl glycinamide synthetase, 99.97
2zw2_A92 Putative uncharacterized protein STS178; purine metabol 99.97
1gtd_A85 MTH169; synthetase, FGAM synthetase, purine synthesis p 99.96
1vq3_A94 Phosphoribosylformylglycinamidine synthase, PURS subuni 99.96
2dgb_A84 Hypothetical protein PURS; purine, structural genomics, 99.95
1t3t_A 1303 Phosphoribosylformylglycinamidine synthase; PURL, FGAM 92.28
>2yx5_A UPF0062 protein MJ1593; anti parallel beta sheet, NPPSFA, national project on protein structural and functional analyses; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
Probab=99.97  E-value=5.6e-32  Score=205.80  Aligned_cols=83  Identities=46%  Similarity=0.817  Sum_probs=81.7

Q ss_pred             CEEEEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCEEEEEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEEE
Q ss_conf             95999999958866687789999998628864200002301899997389989999999999998479761247999999
Q gi|254780972|r    1 MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVIEDYDIKVQ   80 (84)
Q Consensus         1 m~k~~V~V~lK~gVlDPqG~aV~~aL~~lG~~~v~~vr~GK~iei~i~~~~~~~a~~~v~~~c~~lLaNpvIE~y~i~i~   80 (84)
                      ||+++|+|+||||||||||+||+++|++|||+++.+||+||+|+|+++++|++.|++++++||++||+|||||+|+|+++
T Consensus         1 M~k~~V~V~lK~gVlDPqG~ai~~aL~~lG~~~v~~vr~gK~i~l~i~~~~~e~a~~~v~~~c~~lLaNpvIE~y~i~i~   80 (83)
T 2yx5_A            1 MYKATVIIKLKKGVLNPEGRTIQRALNFLGFNNVKEVQTYKMIDIIMEGENEEKVKEEVEEMCKKLLANPVIHDYEIKVE   80 (83)
T ss_dssp             CEEEEEEEEECTTCCCHHHHHHHHHHHHTTCTTCCCCCCCEEEEEEEC-CCHHHHHHHHHHHHHHTTCCTTTEEEEEEEE
T ss_pred             CEEEEEEEEECCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEEE
T ss_conf             96999999989977383799999999864965665467457999998889989999999999998639765168999999


Q ss_pred             ECC
Q ss_conf             717
Q gi|254780972|r   81 KSS   83 (84)
Q Consensus        81 e~~   83 (84)
                      +.+
T Consensus        81 ~~e   83 (83)
T 2yx5_A           81 KIE   83 (83)
T ss_dssp             ECC
T ss_pred             ECC
T ss_conf             869



>1t4a_A PURS; tetramer, complex formyl glycinamide synthetase, FGAR, FGAM, structural protein; 2.00A {Bacillus subtilis} SCOP: d.284.1.1 PDB: 1twj_A Back     alignment and structure
>2zw2_A Putative uncharacterized protein STS178; purine metabolism, ligase; 1.55A {Sulfolobus tokodaii} Back     alignment and structure
>1gtd_A MTH169; synthetase, FGAM synthetase, purine synthesis pathway, PSI, protein structure initiative, NESG; 2.56A {Methanobacterium thermoautotrophicum} SCOP: d.284.1.1 Back     alignment and structure
>1vq3_A Phosphoribosylformylglycinamidine synthase, PURS subunit; TM1244, PURS subunit (EC 6.3.5.3), structural genomics; 1.90A {Thermotoga maritima MSB8} SCOP: d.284.1.1 PDB: 3d54_B* Back     alignment and structure
>2dgb_A Hypothetical protein PURS; purine, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.10A {Thermus thermophilus} PDB: 2cuw_A Back     alignment and structure
>1t3t_A Phosphoribosylformylglycinamidine synthase; PURL, FGAM synthetase, PURS, PURQ, formyl glycinamide, ligase; HET: CYG ADP; 1.90A {Salmonella typhimurium} SCOP: a.5.10.1 c.23.16.1 d.284.1.2 d.79.4.1 d.79.4.1 d.139.1.1 d.139.1.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 84 phosphoribosylformylglycinamidine synthase, PurS protei
d1vq3a_86 d.284.1.1 (A:) PurS subunit of FGAM synthetase {Thermot 4e-22
d1t4aa_80 d.284.1.1 (A:) PurS subunit of FGAM synthetase {Bacillu 5e-22
d1gtda_82 d.284.1.1 (A:) PurS subunit of FGAM synthetase {Archaeo 8e-20
>d1vq3a_ d.284.1.1 (A:) PurS subunit of FGAM synthetase {Thermotoga maritima [TaxId: 2336]} Length = 86 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: PurS-like
superfamily: PurS-like
family: PurS subunit of FGAM synthetase
domain: PurS subunit of FGAM synthetase
species: Thermotoga maritima [TaxId: 2336]
 Score = 96.7 bits (241), Expect = 4e-22
 Identities = 21/79 (26%), Positives = 45/79 (56%)

Query: 1  MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELE 60
          + K  + V+ + +V DP+G+ ++  L       + ++R GK   +E++    + A E ++
Sbjct: 7  LFKFAIDVQYRSNVRDPRGETIERVLREEKGLPVKKLRLGKSIHLEVEAENKEKAYEIVK 66

Query: 61 SICQNLLANPVIEDYDIKV 79
            C+ LL NPV+E+Y+++ 
Sbjct: 67 KACEELLVNPVVEEYEVRE 85


>d1t4aa_ d.284.1.1 (A:) PurS subunit of FGAM synthetase {Bacillus subtilis [TaxId: 1423]} Length = 80 Back     information, alignment and structure
>d1gtda_ d.284.1.1 (A:) PurS subunit of FGAM synthetase {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 82 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target84 phosphoribosylformylglycinamidine synthase, PurS protei
d1t4aa_80 PurS subunit of FGAM synthetase {Bacillus subtilis [Tax 99.97
d1gtda_82 PurS subunit of FGAM synthetase {Archaeon Methanobacter 99.96
d1vq3a_86 PurS subunit of FGAM synthetase {Thermotoga maritima [T 99.96
d1t3ta3152 FGAM synthase PurL, PurS-like domain {Salmonella typhim 90.83
>d1t4aa_ d.284.1.1 (A:) PurS subunit of FGAM synthetase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: PurS-like
superfamily: PurS-like
family: PurS subunit of FGAM synthetase
domain: PurS subunit of FGAM synthetase
species: Bacillus subtilis [TaxId: 1423]
Probab=99.97  E-value=4.7e-31  Score=199.08  Aligned_cols=80  Identities=36%  Similarity=0.667  Sum_probs=77.1

Q ss_pred             CEEEEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCEEEEEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEEE
Q ss_conf             95999999958866687789999998628864200002301899997389989999999999998479761247999999
Q gi|254780972|r    1 MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESICQNLLANPVIEDYDIKVQ   80 (84)
Q Consensus         1 m~k~~V~V~lK~gVlDPqG~aV~~aL~~lG~~~v~~vr~GK~iei~i~~~~~~~a~~~v~~~c~~lLaNpvIE~y~i~i~   80 (84)
                      ||+++|+|+|||||+||||+||+++|++|||+++++||+||+|+|+++++++ +|.+++++||++||+|||||+|+|+++
T Consensus         1 m~k~~V~V~lK~gVlDPqG~ai~~aL~~lG~~~v~~vr~GK~i~l~i~~~~~-~a~~~v~~~c~~lLaNpvIE~y~i~i~   79 (80)
T d1t4aa_           1 MYKVKVYVSLKESVLDPQGSAVQHALHSMTYNEVQDVRIGKYMELTIEKSDR-DLDVLVKEMCEKLLANTVIEDYRYEVE   79 (80)
T ss_dssp             CEEEEEEEEECTTSCCHHHHHHHHHHHHTTCTTEEEEEEEEEEEEEECCCSS-CHHHHHHHHHHHTTCCTTTEEEEEEEE
T ss_pred             CEEEEEEEEECCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEEEEEEECCCHH-HHHHHHHHHHHHHCCCCCEEEEEEEEE
T ss_conf             9699999997998728179999999986597666557888699999759849-999999999998649755267999997


Q ss_pred             E
Q ss_conf             7
Q gi|254780972|r   81 K   81 (84)
Q Consensus        81 e   81 (84)
                      |
T Consensus        80 e   80 (80)
T d1t4aa_          80 E   80 (80)
T ss_dssp             C
T ss_pred             C
T ss_conf             9



>d1gtda_ d.284.1.1 (A:) PurS subunit of FGAM synthetase {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1vq3a_ d.284.1.1 (A:) PurS subunit of FGAM synthetase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t3ta3 d.284.1.2 (A:1-152) FGAM synthase PurL, PurS-like domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 84 phosphoribosylformylglycinamidine synthase, PurS p
2yx5_A_83 (A:) UPF0062 protein MJ1593; anti parallel beta sh 1e-22
1vq3_A_94 (A:) Phosphoribosylformylglycinamidine synthase, P 2e-22
2zw2_A_92 (A:) Putative uncharacterized protein STS178; puri 3e-22
1gtd_A_85 (A:) MTH169; synthetase, FGAM synthetase, purine s 3e-21
1t4a_A_84 (A:) PURS; tetramer, complex formyl glycinamide sy 1e-20
2dgb_A_84 (A:) Hypothetical protein PURS; purine, structural 9e-19
>2yx5_A (A:) UPF0062 protein MJ1593; anti parallel beta sheet, NPPSFA, national project on protein structural and functional analyses; 2.30A {Methanocaldococcus jannaschii}Length = 83 Back     alignment and structure
 Score =  100 bits (250), Expect = 1e-22
 Identities = 38/81 (46%), Positives = 61/81 (75%)

Query: 1  MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELE 60
          M KA V++KLKK VL+P+G+ ++ AL+ +GF+N+ +++  K+ DI M+    +  +EE+E
Sbjct: 1  MYKATVIIKLKKGVLNPEGRTIQRALNFLGFNNVKEVQTYKMIDIIMEGENEEKVKEEVE 60

Query: 61 SICQNLLANPVIEDYDIKVQK 81
           +C+ LLANPVI DY+IKV+K
Sbjct: 61 EMCKKLLANPVIHDYEIKVEK 81


>1vq3_A (A:) Phosphoribosylformylglycinamidine synthase, PURS subunit; TM1244, PURS subunit (EC 6.3.5.3), structural genomics; 1.90A {Thermotoga maritima MSB8}Length = 94 Back     alignment and structure
>2zw2_A (A:) Putative uncharacterized protein STS178; purine metabolism, ligase; 1.55A {Sulfolobus tokodaii}Length = 92 Back     alignment and structure
>1gtd_A (A:) MTH169; synthetase, FGAM synthetase, purine synthesis pathway, PSI, protein structure initiative, NESG; 2.56A {Methanobacterium thermoautotrophicum}Length = 85 Back     alignment and structure
>1t4a_A (A:) PURS; tetramer, complex formyl glycinamide synthetase, FGAR, FGAM, structural protein; 2.00A {Bacillus subtilis}Length = 84 Back     alignment and structure
>2dgb_A (A:) Hypothetical protein PURS; purine, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.10A {Thermus thermophilus} PDB: 2cuw_ALength = 84 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target84 phosphoribosylformylglycinamidine synthase, PurS protei
2zw2_A_92 Putative uncharacterized protein STS178; purine me 99.97
1gtd_A_85 MTH169; synthetase, FGAM synthetase, purine synthe 99.97
2yx5_A_83 UPF0062 protein MJ1593; anti parallel beta sheet, 99.97
1t4a_A_84 PURS; tetramer, complex formyl glycinamide synthet 99.96
2dgb_A_84 Hypothetical protein PURS; purine, structural geno 99.96
1vq3_A_94 Phosphoribosylformylglycinamidine synthase, PURS s 99.95
>2zw2_A (A:) Putative uncharacterized protein STS178; purine metabolism, ligase; 1.55A {Sulfolobus tokodaii} Back     alignment and structure
Probab=99.97  E-value=2.9e-31  Score=202.57  Aligned_cols=84  Identities=18%  Similarity=0.387  Sum_probs=81.7

Q ss_pred             CEEEEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCEEEEEEEEEEEECCCCHHHHHHHHHHHHHHH-CCCCCEEEEEEEE
Q ss_conf             959999999588666877899999986288642000023018999973899899999999999984-7976124799999
Q gi|254780972|r    1 MIKANVVVKLKKDVLDPQGKALKTALSNIGFHNINQIRQGKIFDIEMDETLSDIAEEELESICQNL-LANPVIEDYDIKV   79 (84)
Q Consensus         1 m~k~~V~V~lK~gVlDPqG~aV~~aL~~lG~~~v~~vr~GK~iei~i~~~~~~~a~~~v~~~c~~l-LaNpvIE~y~i~i   79 (84)
                      ||+++|+|+||||||||||+||+++|++|||++|.+||+||+|+|+++++|+++|.+++++||++| |+|||||+|+|++
T Consensus         5 ~~~~~V~V~lK~gVlDPqG~aI~~aL~~lG~~~V~~VRvgK~~~l~i~~~~~e~a~~~v~~~c~~L~LaNpvIEdy~i~v   84 (92)
T 2zw2_A            5 LYRVELIITNKEGVRDPEGETIQRYVVSRFSDKIIETRAGKYLVFRVNSSSQQEATELVKKLADEMRLYNPIVHKIEIRA   84 (92)
T ss_dssp             EEEEEEEEEECTTSCCHHHHHHHHHTHHHHCTTEEEEEEEEEEEEEEECSSHHHHHHHHHHHHHHTTSSCTTTEEEEEEE
T ss_pred             EEEEEEEEEECCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEEEEEEECCCCHHHHHHHHHHHHHHCCCCCCCEEEEEEEE
T ss_conf             69999999988855380578999999863887654478765999999079989999999999964777687368999999


Q ss_pred             EECCC
Q ss_conf             97179
Q gi|254780972|r   80 QKSSS   84 (84)
Q Consensus        80 ~e~~s   84 (84)
                      ++.++
T Consensus        85 ~e~~~   89 (92)
T 2zw2_A           85 NRIED   89 (92)
T ss_dssp             EEEC-
T ss_pred             EEECC
T ss_conf             98036



>1gtd_A (A:) MTH169; synthetase, FGAM synthetase, purine synthesis pathway, PSI, protein structure initiative, NESG; 2.56A {Methanobacterium thermoautotrophicum} Back     alignment and structure
>2yx5_A (A:) UPF0062 protein MJ1593; anti parallel beta sheet, NPPSFA, national project on protein structural and functional analyses; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1t4a_A (A:) PURS; tetramer, complex formyl glycinamide synthetase, FGAR, FGAM, structural protein; 2.00A {Bacillus subtilis} Back     alignment and structure
>2dgb_A (A:) Hypothetical protein PURS; purine, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.10A {Thermus thermophilus} PDB: 2cuw_A Back     alignment and structure
>1vq3_A (A:) Phosphoribosylformylglycinamidine synthase, PURS subunit; TM1244, PURS subunit (EC 6.3.5.3), structural genomics; 1.90A {Thermotoga maritima MSB8} Back     alignment and structure