254780973

254780973

phosphoribosylaminoimidazole-succinocarboxamide synthase

GeneID in NCBI database:8209995Locus tag:CLIBASIA_04370
Protein GI in NCBI database:254780973Protein Accession:YP_003065386.1
Gene range:-(969493, 970260)Protein Length:255aa
Gene description:phosphoribosylaminoimidazole-succinocarboxamide synthase
COG prediction:[F] Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
KEGG prediction:purC; phosphoribosylaminoimidazole-succinocarboxamide synthase (EC:6.3.2.6); K01923 phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:6.3.2.6]
SEED prediction:Phosphoribosylaminoimidazole-succinocarboxamide synthase (EC 6.3.2.6)
Pathway involved in KEGG:Purine metabolism [PATH:las00230]
Subsystem involved in SEED:De Novo Purine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-----
MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKKNEPALKENLILNRK
ccccccccccccEEEEEcccccEEEEEEEcccEEEccccccccccHHHHHHHHHHHHHHHHHHccccccHHccccccEEEEEEEEEEEEEEEEcHHHHHHHHHHHcccccccccccEEEEEEcccccccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcEEEEEEEccccccEEEEEEEccccccccccHHHcccccHHHHHccccHHHHHHHHHHHHHHHccccccccccccccccc
ccHHHHHHHcccEEEEccccccEEEEEEcccccccccccHHHEcccccHcHHHHHHHHHHHHHcccccHHHHccccHHHHHHHEcEccHEEEEHHHHHHHHHHHccccccccccccEEEEEEcccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEEccccccEEEEEccccccccccccccccccccHHHHHcccccHHHHHHHHHHHHccccccccccccccEEccc
mrprnpvyeekTKIIyeglepgtliqffkddnllennprcatlngkgvlnnRISEYMFTqlgkigiphyFIRRINMREQLVRDVEMIPLLITVRNTAAGSlakrlnipeglslprslvefyylpdssektlvsEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLLDDDILRIVLAdeifpdccrlwdlskkeecdkkrfskSNDQLLEGYSEVARRLGifkknepalkenlilnrk
mrprnpvyeektkiiyeglepgtLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAagslakrlnipeglslprSLVEFYYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLLDDDILRIVLADEIFPDCCRLWdlskkeecdkkrfsksndqlleGYSEVArrlgifkknepalkenlilnrk
MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGrlldddilriVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKKNEPALKENLILNRK
***RNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI*****************
********EEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKKNEPALKENLILNRK
*RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKKNEPALKE*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKKNEPALKENLILNRK
MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKKNEPALKENLILNRK
MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKKNEPALKENLILNRK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target255 phosphoribosylaminoimidazole-succinocarboxamide synthas
315122609255 phosphoribosylaminoimidazole-succinocarboxamide synthas 1 1e-117
86357893254 phosphoribosylaminoimidazole-succinocarboxamide synthas 1 8e-90
218514554254 phosphoribosylaminoimidazole-succinocarboxamide synthas 1 1e-89
190891978254 phosphoribosylaminoimidazolesuccinocarboxamide synthase 1 2e-89
209549520254 phosphoribosylaminoimidazole-succinocarboxamide synthas 1 3e-89
222086131254 phosphoribosylaminoimidazole-succinocarboxamide synthas 1 9e-89
116252352254 phosphoribosylaminoimidazole-succinocarboxamide synthas 1 2e-88
15965525254 phosphoribosylaminoimidazole-succinocarboxamide synthas 1 3e-87
227822166254 phosphoribosylaminoimidazole-succinocarboxamide synthas 1 4e-87
218460296237 phosphoribosylaminoimidazole-succinocarboxamide synthas 1 5e-87
>gi|315122609|ref|YP_004063098.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 255 Back     alignment and organism information
 Score =  424 bits (1091), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 205/255 (80%), Positives = 228/255 (89%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           MR RNP+YEEK KI+YEG EPGTLIQFFKDDNL ++   C TLNGKGVLNNRISEYMF Q
Sbjct: 1   MRQRNPIYEEKNKIVYEGPEPGTLIQFFKDDNLSKDGEDCRTLNGKGVLNNRISEYMFAQ 60

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L K+ IP+YFIRR+NMREQLVRDVE+IPL I VRNTAAGSLAKRL I EGLSLPRS+VEF
Sbjct: 61  LNKMNIPNYFIRRLNMREQLVRDVEIIPLRIVVRNTAAGSLAKRLGIEEGLSLPRSIVEF 120

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  DS +KTLVSEEH+TAFNW N SE+EE+TALS+RINDF+TGLFLGINIQLVDF IKC
Sbjct: 121 YYQTDSIQKTLVSEEHVTAFNWVNPSEIEEITALSLRINDFITGLFLGINIQLVDFSIKC 180

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK 240
           GRLLD DI+RIVL+DEI PDCCRLWD+ K+E+CDKKRFS+S+DQLLEGYSEVARRLGIFK
Sbjct: 181 GRLLDGDIIRIVLSDEISPDCCRLWDVEKQEQCDKKRFSRSSDQLLEGYSEVARRLGIFK 240

Query: 241 KNEPALKENLILNRK 255
           KNEPALK   IL+RK
Sbjct: 241 KNEPALKITSILSRK 255


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86357893|ref|YP_469785.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium etli CFN 42] Length = 254 Back     alignment and organism information
>gi|218514554|ref|ZP_03511394.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium etli 8C-3] Length = 254 Back     alignment and organism information
>gi|190891978|ref|YP_001978520.1| phosphoribosylaminoimidazolesuccinocarboxamide synthase [Rhizobium etli CIAT 652] Length = 254 Back     alignment and organism information
>gi|209549520|ref|YP_002281437.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 254 Back     alignment and organism information
>gi|222086131|ref|YP_002544663.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Agrobacterium radiobacter K84] Length = 254 Back     alignment and organism information
>gi|116252352|ref|YP_768190.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium leguminosarum bv. viciae 3841] Length = 254 Back     alignment and organism information
>gi|15965525|ref|NP_385878.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Sinorhizobium meliloti 1021] Length = 254 Back     alignment and organism information
>gi|227822166|ref|YP_002826137.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Sinorhizobium fredii NGR234] Length = 254 Back     alignment and organism information
>gi|218460296|ref|ZP_03500387.1| phosphoribosylaminoimidazole-succinocarboxamide synthase [Rhizobium etli Kim 5] Length = 237 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target255 phosphoribosylaminoimidazole-succinocarboxamide synthas
PRK09362238 PRK09362, PRK09362, phosphoribosylaminoimidazole-succin 2e-77
COG0152247 COG0152, PurC, Phosphoribosylaminoimidazolesuccinocarbo 7e-59
TIGR00081237 TIGR00081, purC, phosphoribosylaminoimidazole-succinoca 2e-43
pfam01259243 pfam01259, SAICAR_synt, SAICAR synthetase 7e-40
cd00476230 cd00476, SAICAR_synt, 5-aminoimidazole-4-(N-succinylcar 2e-34
cd01416252 cd01416, SAICAR_synt_Ade5, Ade5_like 5-aminoimidazole-4 3e-21
cd01415230 cd01415, SAICAR_synt_PurC, bacterial and archaeal 5-ami 1e-71
cd01414279 cd01414, SAICAR_synt_Sc, non-metazoan 5-aminoimidazole- 3e-09
>gnl|CDD|181800 PRK09362, PRK09362, phosphoribosylaminoimidazole-succinocarboxamide synthase; Reviewed Back     alignment and domain information
>gnl|CDD|30501 COG0152, PurC, Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|161698 TIGR00081, purC, phosphoribosylaminoimidazole-succinocarboxamide synthase Back     alignment and domain information
>gnl|CDD|110273 pfam01259, SAICAR_synt, SAICAR synthetase Back     alignment and domain information
>gnl|CDD|133468 cd00476, SAICAR_synt, 5-aminoimidazole-4-(N-succinylcarboxamide) ribonucleotide (SAICAR) synthase Back     alignment and domain information
>gnl|CDD|133471 cd01416, SAICAR_synt_Ade5, Ade5_like 5-aminoimidazole-4-(N-succinylcarboxamide) ribonucleotide (SAICAR) synthase Back     alignment and domain information
>gnl|CDD|133470 cd01415, SAICAR_synt_PurC, bacterial and archaeal 5-aminoimidazole-4-(N-succinylcarboxamide) ribonucleotide (SAICAR) synthase Back     alignment and domain information
>gnl|CDD|133469 cd01414, SAICAR_synt_Sc, non-metazoan 5-aminoimidazole-4-(N-succinylcarboxamide) ribonucleotide (SAICAR) synthase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 255 phosphoribosylaminoimidazole-succinocarboxamide synthas
PRK09362238 phosphoribosylaminoimidazole-succinocarboxamide synthas 100.0
cd01415230 SAICAR_synt_PurC bacterial and archaeal 5-aminoimidazol 100.0
cd01416252 SAICAR_synt_Ade5 Ade5_like 5-aminoimidazole-4-(N-succin 100.0
cd00476230 SAICAR_synt 5-aminoimidazole-4-(N-succinylcarboxamide) 100.0
COG0152247 PurC Phosphoribosylaminoimidazolesuccinocarboxamide (SA 100.0
pfam01259243 SAICAR_synt SAICAR synthetase. Also known as Phosphorib 100.0
). ; GO: 0004639 phosphoribosylaminoimidazolesuccinocarboxamide synthase activity, 0006164 purine nucleotide biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00081">TIGR00081374 purC phosphoribosylaminoimidazole-succinocarboxamide sy 100.0
PRK12607295 phosphoribosylaminoimidazole-succinocarboxamide synthas 100.0
cd01414279 SAICAR_synt_Sc non-metazoan 5-aminoimidazole-4-(N-succi 100.0
PRK13961297 phosphoribosylaminoimidazole-succinocarboxamide synthas 100.0
PRK13959335 phosphoribosylaminoimidazole-succinocarboxamide synthas 100.0
PRK13960367 phosphoribosylaminoimidazole-succinocarboxamide synthas 100.0
TIGR02735365 purC_vibrio phosphoribosylaminoimidazole-succinocarboxa 100.0
KOG2835373 consensus 99.97
KOG2835373 consensus 99.4
>PRK09362 phosphoribosylaminoimidazole-succinocarboxamide synthase; Reviewed Back     alignment and domain information
>cd01415 SAICAR_synt_PurC bacterial and archaeal 5-aminoimidazole-4-(N-succinylcarboxamide) ribonucleotide (SAICAR) synthase Back     alignment and domain information
>cd01416 SAICAR_synt_Ade5 Ade5_like 5-aminoimidazole-4-(N-succinylcarboxamide) ribonucleotide (SAICAR) synthase Back     alignment and domain information
>cd00476 SAICAR_synt 5-aminoimidazole-4-(N-succinylcarboxamide) ribonucleotide (SAICAR) synthase Back     alignment and domain information
>COG0152 PurC Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>pfam01259 SAICAR_synt SAICAR synthetase Back     alignment and domain information
>TIGR00081 purC phosphoribosylaminoimidazole-succinocarboxamide synthase; InterPro: IPR001636 Phosphoribosylaminoimidazole-succinocarboxamide synthase (6 Back     alignment and domain information
>PRK12607 phosphoribosylaminoimidazole-succinocarboxamide synthase; Provisional Back     alignment and domain information
>cd01414 SAICAR_synt_Sc non-metazoan 5-aminoimidazole-4-(N-succinylcarboxamide) ribonucleotide (SAICAR) synthase Back     alignment and domain information
>PRK13961 phosphoribosylaminoimidazole-succinocarboxamide synthase; Provisional Back     alignment and domain information
>PRK13959 phosphoribosylaminoimidazole-succinocarboxamide synthase; Provisional Back     alignment and domain information
>PRK13960 phosphoribosylaminoimidazole-succinocarboxamide synthase; Provisional Back     alignment and domain information
>TIGR02735 purC_vibrio phosphoribosylaminoimidazole-succinocarboxamide synthase; InterPro: IPR014106 Members of this protein family appear to represent a novel form of phosphoribosylaminoimidazole-succinocarboxamide synthase (SAICAR synthetase), significantly different in sequence from (IPR001636 from INTERPRO), which is found in a broad range of bacteria and eukaryotes Back     alignment and domain information
>KOG2835 consensus Back     alignment and domain information
>KOG2835 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target255 phosphoribosylaminoimidazole-succinocarboxamide synthas
2ywv_A244 Crystal Structure Of Saicar Synthetase From Geobaci 2e-65
3kre_A263 Crystal Structure Of Phosphoribosylaminoimidazole- 3e-62
2gqs_A237 Saicar Synthetase Complexed With Cair-Mg2+ And Adp 6e-62
3nua_A238 Crystal Structure Of Phosphoribosylaminoimidazole-S 7e-62
2gqr_A237 Saicar Synthetase Complexed With Adp-Mg2+ Length = 3e-59
2yzl_A242 Crystal Structure Of Phosphoribosylaminoimidazole- 1e-57
2h31_A 425 Crystal Structure Of Human Paics, A Bifunctional Ca 1e-45
1kut_A230 Structural Genomics, Protein Tm1243, (Saicar Synthe 1e-42
3r9r_A301 Structure Of A Phosphoribosylaminoimidazole-Succino 7e-40
1obg_A305 Saicar-Synthase Complexed With Atp Length = 305 8e-38
1a48_A306 Saicar Synthase Length = 306 8e-38
>gi|159795633|pdb|2YWV|A Chain A, Crystal Structure Of Saicar Synthetase From Geobacillus Kaustophilus Length = 244 Back     alignment and structure
 Score =  253 bits (645), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 96/236 (40%), Positives = 134/236 (56%), Gaps = 3/236 (1%)

Query: 2   RPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQL 61
             +  +YE K K IY   EP  L   +KD     N  + AT+ GKG LNN IS  +F +L
Sbjct: 5   TKQQLLYEGKAKKIYATDEPDVLWVEYKDSATAFNGEKKATIAGKGRLNNEISSLLFLKL 64

Query: 62  GKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFY 121
            + GI ++FI +++  EQLVR V +IPL + VRN  AGSLAKR+ + EG  L   LVEFY
Sbjct: 65  REAGIANHFIEKLSPTEQLVRRVTIIPLEVVVRNVVAGSLAKRIGLEEGTPLEAPLVEFY 124

Query: 122 YLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCG 181
           Y  D     L+ E+HI     A++ EV  +   ++ +ND +   F   N++L+DF+++ G
Sbjct: 125 YKNDDLGDPLLLEDHIFILKLASREEVAALKQAALAVNDVLRLHFAERNVRLIDFKLEFG 184

Query: 182 RLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLG 237
           R  D     I+LADEI PD CRLWD    E+ DK  F +    L + Y  + +RLG
Sbjct: 185 RTAD---GAILLADEISPDTCRLWDAKTNEKLDKDVFRRDLGSLTDAYEVILQRLG 237


>gi|270047866|pdb|3KRE|A Chain A, Crystal Structure Of Phosphoribosylaminoimidazole- Succinocarboxamide Synthase From Ehrlichia Chaffeensis At 1.8a Resolution Length = 263 Back     alignment and structure
gi|109157959|pdb|2GQS|A Chain A, Saicar Synthetase Complexed With Cair-Mg2+ And Adp Length = 237 Back     alignment and structure
>gi|304446033|pdb|3NUA|A Chain A, Crystal Structure Of Phosphoribosylaminoimidazole-Succinocarboxamide Synthase From Clostridium Perfringens Length = 238 Back     alignment and structure
>gi|109157957|pdb|2GQR|A Chain A, Saicar Synthetase Complexed With Adp-Mg2+ Length = 237 Back     alignment and structure
gi|160286255|pdb|2YZL|A Chain A, Crystal Structure Of Phosphoribosylaminoimidazole- Succinocarboxamide Synthase With Adp From Methanocaldococcus Jannaschii Length = 242 Back     alignment and structure
>gi|126030593|pdb|2H31|A Chain A, Crystal Structure Of Human Paics, A Bifunctional Carboxylase And Synthetase In Purine Biosynthesis Length = 425 Back     alignment and structure
>gi|23200290|pdb|1KUT|A Chain A, Structural Genomics, Protein Tm1243, (Saicar Synthetase) Length = 230 Back     alignment and structure
>gi|329666292|pdb|3R9R|A Chain A, Structure Of A Phosphoribosylaminoimidazole-Succinocarboxamide Synthase From Mycobacterium Abscessus Atcc 19977 DSM 44196 Length = 301 Back     alignment and structure
>gi|157879485|pdb|1OBG|A Chain A, Saicar-Synthase Complexed With Atp Length = 305 Back     alignment and structure
>gi|313507122|pdb|1A48|A Chain A, Saicar Synthase Length = 306 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target255 phosphoribosylaminoimidazole-succinocarboxamide synthas
3kre_A263 Phosphoribosylaminoimidazole-succinocarboxamide synthas 9e-54
3nua_A238 Phosphoribosylaminoimidazole-succinocarboxamide S; alph 1e-50
1kut_A230 Phosphoribosylaminoimidazole-succinocarboxamide synthas 4e-48
2ywv_A244 Phosphoribosylaminoimidazole succinocarboxamide synthet 5e-48
2h31_A 425 Multifunctional protein ADE2; alpha-beta-alpha, ligase, 4e-47
2z02_A242 Phosphoribosylaminoimidazole-succinocarboxamide synthas 2e-45
2gqr_A237 Phosphoribosylaminoimidazole-succinocarboxamide synthas 6e-45
2cnq_A306 Phosphoribosylaminoimidazole-succinocarboxamide synthas 8e-30
>3kre_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ATP-binding, ligase; 1.80A {Ehrlichia chaffeensis str} Length = 263 Back     alignment and structure
 Score =  205 bits (522), Expect = 9e-54
 Identities = 97/238 (40%), Positives = 148/238 (62%)

Query: 1   MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQ 60
           M  +  +YE K KII+  L P  +IQ FKD+    NN + A ++ KG+LNN IS ++  +
Sbjct: 22  MENKEKIYEGKAKIIFATLNPLEVIQHFKDEITAFNNKKAAIIHEKGILNNYISSFLMKK 81

Query: 61  LGKIGIPHYFIRRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEF 120
           L   GI  +FI  +N REQLV+ + +IP+ + +RN AAG+ +KR  I +G      ++EF
Sbjct: 82  LIDKGIKTHFISLLNQREQLVKKITIIPIEVVIRNLAAGNFSKRFQIADGTPFKSPIIEF 141

Query: 121 YYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKC 180
           YY  D     +VSE HI +F W    E+E++  LS++IN+ ++ LF  + I+LVDF+++ 
Sbjct: 142 YYKNDELSDPMVSEGHILSFQWLTNQELEKIKILSLKINNILSELFFNVGIKLVDFKLEF 201

Query: 181 GRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
           G+L +D+   + LADEI PD CRLWD+S  +  DK R+  +   ++EGY EVA +L  
Sbjct: 202 GKLHNDEQSDLFLADEISPDTCRLWDISTNKRLDKDRYRLNLGNVIEGYREVAHKLNA 259


>3nua_A Phosphoribosylaminoimidazole-succinocarboxamide S; alpha-beta structure, csgid, ligase; HET: ADP AMP CIT; 1.40A {Clostridium perfringens atcc 13124} Length = 238 Back     alignment and structure
>1kut_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; structural genomics, saicar synthetase, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: d.143.1.1 Length = 230 Back     alignment and structure
>2ywv_A Phosphoribosylaminoimidazole succinocarboxamide synthetase; ADP complex, structural genomics, NPPSFA; HET: ADP; 1.75A {Geobacillus kaustophilus} Length = 244 Back     alignment and structure
>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Length = 425 Back     alignment and structure
>2z02_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; 2-layer sandwich, ligase, purine biosynthesis, structural genomics; HET: ATP CIT; 2.03A {Methanocaldococcus jannaschii} PDB: 2yzl_A* Length = 242 Back     alignment and structure
>2gqr_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; PURC, ADE2, ADE1, nucleotide complex, octahedral magnesium coordination; HET: ADP; 2.00A {Escherichia coli} PDB: 2gqs_A* Length = 237 Back     alignment and structure
>2cnq_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; ligase, phosphoribosylaminoimidazolesuccinocarboxamide (saicar) SYN ligase; HET: ADP AMZ AMP; 1.00A {Saccharomyces cerevisiae} SCOP: d.143.1.1 PDB: 1a48_A* 1obd_A* 2cnu_A* 2cnv_A* 1obg_A* Length = 306 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target255 phosphoribosylaminoimidazole-succinocarboxamide synthas
3kre_A263 Phosphoribosylaminoimidazole-succinocarboxamide synthas 100.0
2ywv_A244 Phosphoribosylaminoimidazole succinocarboxamide synthet 100.0
2z02_A242 Phosphoribosylaminoimidazole-succinocarboxamide synthas 100.0
2gqr_A237 Phosphoribosylaminoimidazole-succinocarboxamide synthas 100.0
3nua_A238 Phosphoribosylaminoimidazole-succinocarboxamide S; alph 100.0
1kut_A230 Phosphoribosylaminoimidazole-succinocarboxamide synthas 100.0
2h31_A 425 Multifunctional protein ADE2; alpha-beta-alpha, ligase, 100.0
2cnq_A306 Phosphoribosylaminoimidazole-succinocarboxamide synthas 100.0
>3kre_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ATP-binding, ligase; 1.80A {Ehrlichia chaffeensis str} Back     alignment and structure
Probab=100.00  E-value=0  Score=591.44  Aligned_cols=241  Identities=40%  Similarity=0.747  Sum_probs=236.8

Q ss_pred             CCCCCEEEECCCEEEEECCCCCEEEEEEECCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCEEE
Q ss_conf             99877636133037687288997999993682451620145568887999999999999987339974057438840023
Q gi|254780973|r    1 MRPRNPVYEEKTKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIGIPHYFIRRINMREQL   80 (255)
Q Consensus         1 m~~~~~lyeGKvK~iY~~~d~~~li~~~~DriSAfD~~~~~~I~gKG~~l~~iS~~~F~~l~~~Gi~th~i~~~~~~~~i   80 (255)
                      |+++++|||||||+||+++|++.|+|+||||+||||+++++.|||||++||+||+|||++|+++|++|||++++++|+|+
T Consensus        22 m~~~~~ly~GKvK~iY~~~d~~~ll~~~~DriSafD~~~~~~IpgKG~~l~~iS~~wF~~l~~~gi~th~i~~~~~r~ml  101 (263)
T 3kre_A           22 MENKEKIYEGKAKIIFATLNPLEVIQHFKDEITAFNNKKAAIIHEKGILNNYISSFLMKKLIDKGIKTHFISLLNQREQL  101 (263)
T ss_dssp             ----CEEEECSSEEEEECSSTTEEEEEECSEEEETTTTEEEECTTHHHHHHHHHHHHHHHHHHTTCCBSEEEECSSSEEE
T ss_pred             CCCCCEEEECCCEEEEECCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEE
T ss_conf             75455556316878887599999999998885343762578899889999999999999987557664320136884799


Q ss_pred             EECCCCCCEEEEEECEEECCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHH
Q ss_conf             10026553599992446010100256433773786434443454456886415578888540898999789999999999
Q gi|254780973|r   81 VRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRIND  160 (255)
Q Consensus        81 v~k~~~iPiE~VvR~yaaGS~~kry~~~~G~~l~~pl~e~~~K~d~~~DP~i~~~~~~~~~~~~~~~~~~i~~~a~~i~~  160 (255)
                      |+||+|||+|||||||||||+|++|+..+|..+++|++++++|+++++||+++++++.++++++.+++++|+++|++||+
T Consensus       102 vkk~~~iPiE~VvR~y~~GS~~~~Y~~~~~~~~~~~l~~~~~k~~~~~Dp~i~~~~~~~~~~~~~~e~~~i~~~sl~i~~  181 (263)
T 3kre_A          102 VKKITIIPIEVVIRNLAAGNFSKRFQIADGTPFKSPIIEFYYKNDELSDPMVSEGHILSFQWLTNQELEKIKILSLKINN  181 (263)
T ss_dssp             EECEEECSEEEEEEEECCHHHHHHHTCCTTCEEEEEEEEEEECCTTTTCCEECHHHHHHTTSSCHHHHHHHHHHHHHHHH
T ss_pred             EEECCCCCEEEEEEEEECHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             98125785699994137031120112566755477888531245445778746777887420107788889999999999


Q ss_pred             HHHHHHHHCCCEEECCCEEEEECCCCCCCEEEEEEEECCCCCEEEECCCCCCCCHHHHHCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             99999998797663120666310468888799996305874141176756704478761236779999999999714232
Q gi|254780973|r  161 FMTGLFLGINIQLVDFRIKCGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK  240 (255)
Q Consensus       161 ~l~~~~~~~Gl~LvD~K~EFG~~~~~~~g~iiL~DEItPDs~R~Wd~~~~e~lDKd~~R~~l~~v~~~Y~ev~~rl~~~~  240 (255)
                      +++++|.++|++|||||||||++.|++.|+|+|+||||||||||||.+++++||||+||+||++++++|+||++||+.++
T Consensus       182 ~~~~~~~~~GliLvDtK~EFG~~~~~~~g~ivLiDEITPDssR~Wd~~~~e~lDKq~~R~~l~~v~~~Y~ei~~rl~~~~  261 (263)
T 3kre_A          182 ILSELFFNVGIKLVDFKLEFGKLHNDEQSDLFLADEISPDTCRLWDISTNKRLDKDRYRLNLGNVIEGYREVAHKLNAIP  261 (263)
T ss_dssp             HHHHHHHHTTEEEEEEEECEEEETTCTTCCCEECSCCSTTTEEEEETTTCCBCSTHHHHTTCSCHHHHHHHHHHHHTCSC
T ss_pred             HHHHHHHHCCCEEEEEEEEEEEECCCCCCEEEEEEEECCCCCEEEECCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             99999996596899977898862368888499999767986300068987656748875224668899999999861068


Q ss_pred             C
Q ss_conf             3
Q gi|254780973|r  241 K  241 (255)
Q Consensus       241 ~  241 (255)
                      .
T Consensus       262 ~  262 (263)
T 3kre_A          262 N  262 (263)
T ss_dssp             C
T ss_pred             C
T ss_conf             9



>2ywv_A Phosphoribosylaminoimidazole succinocarboxamide synthetase; ADP complex, structural genomics, NPPSFA; HET: ADP; 1.75A {Geobacillus kaustophilus} Back     alignment and structure
>2z02_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; 2-layer sandwich, ligase, purine biosynthesis, structural genomics; HET: ATP CIT; 2.03A {Methanocaldococcus jannaschii} PDB: 2yzl_A* Back     alignment and structure
>2gqr_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; PURC, ADE2, ADE1, nucleotide complex, octahedral magnesium coordination; HET: ADP; 2.00A {Escherichia coli} PDB: 2gqs_A* Back     alignment and structure
>3nua_A Phosphoribosylaminoimidazole-succinocarboxamide S; alpha-beta structure, csgid, ligase; HET: ADP AMP CIT; 1.40A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1kut_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; structural genomics, saicar synthetase, PSI, protein structure initiative; 2.20A {Thermotoga maritima} SCOP: d.143.1.1 Back     alignment and structure
>2h31_A Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Back     alignment and structure
>2cnq_A Phosphoribosylaminoimidazole-succinocarboxamide synthase; ligase, phosphoribosylaminoimidazolesuccinocarboxamide (saicar) SYN ligase; HET: ADP AMZ AMP; 1.00A {Saccharomyces cerevisiae} SCOP: d.143.1.1 PDB: 1a48_A* 1obd_A* 2cnu_A* 2cnv_A* 1obg_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 255 phosphoribosylaminoimidazole-succinocarboxamide synthas
d1kuta_224 d.143.1.1 (A:) SAICAR synthase {Thermotoga maritima [Ta 2e-40
d2cnqa1304 d.143.1.1 (A:2-305) SAICAR synthase {Baker's yeast (Sac 2e-29
>d1kuta_ d.143.1.1 (A:) SAICAR synthase {Thermotoga maritima [TaxId: 2336]} Length = 224 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: SAICAR synthase-like
superfamily: SAICAR synthase-like
family: SAICAR synthase
domain: SAICAR synthase
species: Thermotoga maritima [TaxId: 2336]
 Score =  159 bits (404), Expect = 2e-40
 Identities = 64/228 (28%), Positives = 97/228 (42%), Gaps = 7/228 (3%)

Query: 12  TKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIGIPHYFI 71
           TKI+   +     +  FKDD    +  +   L GKG +    +  +   L + GI  + +
Sbjct: 1   TKIVK--VTGDYALLEFKDDITAGDGLKHDVLTGKGSICAETTAILMKYLSEKGIKTHLV 58

Query: 72  RRINMREQLVRDVEMIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPDSSEKTL 131
             I  R   V  ++M PL + VR   AGS  +R    EG  LP  LVEF+   D     +
Sbjct: 59  EYIPPRTLKVIPLKMFPLEVVVRLKKAGSFVRRYGGAEGEDLPVPLVEFFIKDDERHDPM 118

Query: 132 VSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLLDDDILRI 191
           V  +H+     A + + E+M   +++I   +   F   N +L D + + G   D     +
Sbjct: 119 VCVDHLEILGIATKKQAEKMKEAAVKITLALKEFFERANFELWDIKYEFGLDKDG---NV 175

Query: 192 VLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIF 239
           VL DEI PD  RL    K E  DK  + +     L+ Y EV       
Sbjct: 176 VLGDEISPDTFRLRK--KGEIFDKDVYRRDLGDPLKKYREVLELCRSL 221


>d2cnqa1 d.143.1.1 (A:2-305) SAICAR synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 304 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target255 phosphoribosylaminoimidazole-succinocarboxamide synthas
d1kuta_224 SAICAR synthase {Thermotoga maritima [TaxId: 2336]} 100.0
d2cnqa1304 SAICAR synthase {Baker's yeast (Saccharomyces cerevisia 100.0
>d1kuta_ d.143.1.1 (A:) SAICAR synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: SAICAR synthase-like
superfamily: SAICAR synthase-like
family: SAICAR synthase
domain: SAICAR synthase
species: Thermotoga maritima [TaxId: 2336]
Probab=100.00  E-value=0  Score=522.81  Aligned_cols=223  Identities=28%  Similarity=0.383  Sum_probs=213.1

Q ss_pred             CEEEEECCCCCEEEEEEECCCEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCEEEEECCCCCCEEE
Q ss_conf             03768728899799999368245162014556888799999999999998733997405743884002310026553599
Q gi|254780973|r   12 TKIIYEGLEPGTLIQFFKDDNLLENNPRCATLNGKGVLNNRISEYMFTQLGKIGIPHYFIRRINMREQLVRDVEMIPLLI   91 (255)
Q Consensus        12 vK~iY~~~d~~~li~~~~DriSAfD~~~~~~I~gKG~~l~~iS~~~F~~l~~~Gi~th~i~~~~~~~~iv~k~~~iPiE~   91 (255)
                      ||.+|..+  +.++|+||||+||||+++++.|||||++||+||+|||++|+++||||||++.++||+|+|++|+||||||
T Consensus         1 tki~~~~~--d~ll~~f~DriSAfD~~~~~~IpgKG~~l~~is~~~F~~L~~~gI~tH~i~~~~~~~~~vkk~~~iPiE~   78 (224)
T d1kuta_           1 TKIVKVTG--DYALLEFKDDITAGDGLKHDVLTGKGSICAETTAILMKYLSEKGIKTHLVEYIPPRTLKVIPLKMFPLEV   78 (224)
T ss_dssp             CEEEEEET--TEEEEEECCC-----------CCSHHHHHHHHHHHHHHHHHHTTCCBSEEEEETTTEEEECCCEECSEEE
T ss_pred             CEEEEECC--CEEEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCEEEEHHCCCCCEEE
T ss_conf             90899379--9899999788635376167889982099999999999974117843320035672123320126677699


Q ss_pred             EEECEEECCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             99244601010025643377378643444345445688641557888854089899978999999999999999998797
Q gi|254780973|r   92 TVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGLFLGINI  171 (255)
Q Consensus        92 VvR~yaaGS~~kry~~~~G~~l~~pl~e~~~K~d~~~DP~i~~~~~~~~~~~~~~~~~~i~~~a~~i~~~l~~~~~~~Gl  171 (255)
                      |||||||||+|++|+..+|..|++|++++++|++++|||++|++++..+++++++++++|+++|+++|++++++|.++|+
T Consensus        79 VvR~y~~GS~~~~y~~~~g~~~~~pl~e~~~k~~~~~D~~i~~~~~~~~~~~~~~~~~~i~~~al~i~~~l~~~~~~~gl  158 (224)
T d1kuta_          79 VVRLKKAGSFVRRYGGAEGEDLPVPLVEFFIKDDERHDPMVCVDHLEILGIATKKQAEKMKEAAVKITLALKEFFERANF  158 (224)
T ss_dssp             EEEEECCHHHHHHHCCCTTCEEEEEEEEEEECCGGGTCCBCCHHHHHHTTSCCHHHHHHHHHHHHHHHHHHHHHHHTTTE
T ss_pred             EEEEEEHHHHHHHCCCCCCCCCCCCCCCCHHCCCCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             99643717767542665565477544320002444676321577776762277888899999999999999999863462


Q ss_pred             EEECCCEEEEECCCCCCCEEEEEEEECCCCCEEEECCCCCCCCHHHHHCCHHHHHHHHHHHHHHHCCCCC
Q ss_conf             6631206663104688887999963058741411767567044787612367799999999997142323
Q gi|254780973|r  172 QLVDFRIKCGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFKK  241 (255)
Q Consensus       172 ~LvD~K~EFG~~~~~~~g~iiL~DEItPDs~R~Wd~~~~e~lDKd~~R~~l~~v~~~Y~ev~~rl~~~~~  241 (255)
                      +|||||||||++.+   |+|+|+|||||||||||+.  +++||||+||+||++++++|+||++|+..+..
T Consensus       159 iLvD~K~EFG~~~~---g~ivL~DEItpDs~R~w~~--~~~~DK~~~R~~l~~~~~~Y~ev~~~~~~~~~  223 (224)
T d1kuta_         159 ELWDIKYEFGLDKD---GNVVLGDEISPDTFRLRKK--GEIFDKDVYRRDLGDPLKKYREVLELCRSLNS  223 (224)
T ss_dssp             EEEEEEECEEECTT---CCEEECSCCSTTTEEEEET--TCCCCHHHHHHGGGCTTHHHHHHHHHHHHHTT
T ss_pred             EEECCCEEEEECCC---CCEEEEECCCCCCCCCCCC--CCCCCHHHHHHCCCCHHHHHHHHHHHHHHHHC
T ss_conf             42321158726699---9299998038975461789--87448788871022043899999999988544



>d2cnqa1 d.143.1.1 (A:2-305) SAICAR synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 255 phosphoribosylaminoimidazole-succinocarboxamide sy
2gqr_A_86-237152 (A:86-237) Phosphoribosylaminoimidazole-succinocar 1e-39
3kre_A_105-240136 (A:105-240) Phosphoribosylaminoimidazole-succinoca 7e-37
2z02_A_92-222131 (A:92-222) Phosphoribosylaminoimidazole-succinocar 8e-35
2ywv_A_89-219131 (A:89-219) Phosphoribosylaminoimidazole succinocar 4e-32
2h31_A_90-234145 (A:90-234) Multifunctional protein ADE2; alpha-bet 7e-29
2cnq_A_113-252140 (A:113-252) Phosphoribosylaminoimidazole-succinoca 1e-26
1kut_A_79-199121 (A:79-199) Phosphoribosylaminoimidazole-succinocar 3e-31
2ywv_A_1-88_220-244113 (A:1-88,A:220-244) Phosphoribosylaminoimidazole su 1e-24
2h31_A_1-89_235-260_395-425146 (A:1-89,A:235-260,A:395-425) Multifunctional prote 8e-24
3kre_A_1-104_241-263127 (A:1-104,A:241-263) Phosphoribosylaminoimidazole-s 2e-23
2z02_A_1-91_223-242111 (A:1-91,A:223-242) Phosphoribosylaminoimidazole-su 5e-23
2gqr_A_1-8585 (A:1-85) Phosphoribosylaminoimidazole-succinocarbo 2e-21
2cnq_A_1-112_253-305165 (A:1-112,A:253-305) Phosphoribosylaminoimidazole-s 3e-20
1kut_A_1-78_200-230109 (A:1-78,A:200-230) Phosphoribosylaminoimidazole-su 9e-20
>2gqr_A (A:86-237) Phosphoribosylaminoimidazole-succinocarboxamide synthase; PURC, ADE2, ADE1, nucleotide complex, octahedral magnesium coordination; HET: ADP; 2.00A {Escherichia coli} PDB: 2gqs_A*Length = 152 Back     alignment and structure
 Score =  157 bits (399), Expect = 1e-39
 Identities = 57/152 (37%), Positives = 80/152 (52%), Gaps = 4/152 (2%)

Query: 87  IPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPDSSEKTLVSEEHITAFNWANQS 146
           +P+   VRN AAGSL KRL I EG+ L   L + +   D+     V+E +   F W ++ 
Sbjct: 2   VPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDLFLKNDAXHDPXVNESYCETFGWVSKE 61

Query: 147 EVEEMTALSIRINDFMTGLFLGINIQLVDFRIKCGRLLDDDILRIVLADEIFPDCCRLWD 206
            +     L+ + ND +  LF    + LVDF+++ G         +VL DE  PD  RLWD
Sbjct: 62  NLARXKELTYKANDVLKKLFDDAGLILVDFKLEFGL--YKG--EVVLGDEFSPDGSRLWD 117

Query: 207 LSKKEECDKKRFSKSNDQLLEGYSEVARRLGI 238
               E+ DK RF +S   L+E Y  VARRLG+
Sbjct: 118 KETLEKXDKDRFRQSLGGLIEAYEAVARRLGV 149


>3kre_A (A:105-240) Phosphoribosylaminoimidazole-succinocarboxamide synthase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ATP-binding, ligase; 1.80A {Ehrlichia chaffeensis str}Length = 136 Back     alignment and structure
>2z02_A (A:92-222) Phosphoribosylaminoimidazole-succinocarboxamide synthase; 2-layer sandwich, ligase, purine biosynthesis, structural genomics; HET: ATP CIT; 2.03A {Methanocaldococcus jannaschii} PDB: 2yzl_A*Length = 131 Back     alignment and structure
>2ywv_A (A:89-219) Phosphoribosylaminoimidazole succinocarboxamide synthetase; ADP complex, structural genomics, NPPSFA; HET: ADP; 1.75A {Geobacillus kaustophilus}Length = 131 Back     alignment and structure
>2h31_A (A:90-234) Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens}Length = 145 Back     alignment and structure
>1kut_A (A:79-199) Phosphoribosylaminoimidazole-succinocarboxamide synthase; structural genomics, saicar synthetase, PSI, protein structure initiative; 2.20A {Thermotoga maritima}Length = 121 Back     alignment and structure
>2ywv_A (A:1-88,A:220-244) Phosphoribosylaminoimidazole succinocarboxamide synthetase; ADP complex, structural genomics, NPPSFA; HET: ADP; 1.75A {Geobacillus kaustophilus}Length = 113 Back     alignment and structure
>2h31_A (A:1-89,A:235-260,A:395-425) Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens}Length = 146 Back     alignment and structure
>3kre_A (A:1-104,A:241-263) Phosphoribosylaminoimidazole-succinocarboxamide synthase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ATP-binding, ligase; 1.80A {Ehrlichia chaffeensis str}Length = 127 Back     alignment and structure
>2z02_A (A:1-91,A:223-242) Phosphoribosylaminoimidazole-succinocarboxamide synthase; 2-layer sandwich, ligase, purine biosynthesis, structural genomics; HET: ATP CIT; 2.03A {Methanocaldococcus jannaschii} PDB: 2yzl_A*Length = 111 Back     alignment and structure
>2gqr_A (A:1-85) Phosphoribosylaminoimidazole-succinocarboxamide synthase; PURC, ADE2, ADE1, nucleotide complex, octahedral magnesium coordination; HET: ADP; 2.00A {Escherichia coli} PDB: 2gqs_A*Length = 85 Back     alignment and structure
>1kut_A (A:1-78,A:200-230) Phosphoribosylaminoimidazole-succinocarboxamide synthase; structural genomics, saicar synthetase, PSI, protein structure initiative; 2.20A {Thermotoga maritima}Length = 109 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target255 phosphoribosylaminoimidazole-succinocarboxamide synthas
2gqr_A_86-237152 Phosphoribosylaminoimidazole-succinocarboxamide sy 100.0
3kre_A_105-240136 Phosphoribosylaminoimidazole-succinocarboxamide sy 100.0
2z02_A_92-222131 Phosphoribosylaminoimidazole-succinocarboxamide sy 100.0
2ywv_A_89-219131 Phosphoribosylaminoimidazole succinocarboxamide sy 100.0
2h31_A_90-234145 Multifunctional protein ADE2; alpha-beta-alpha, li 100.0
1kut_A_79-199121 Phosphoribosylaminoimidazole-succinocarboxamide sy 100.0
2cnq_A_113-252140 Phosphoribosylaminoimidazole-succinocarboxamide sy 100.0
2cnq_A_1-112_253-305165 Phosphoribosylaminoimidazole-succinocarboxamide sy 99.96
2ywv_A_1-88_220-244113 Phosphoribosylaminoimidazole succinocarboxamide sy 99.96
2gqr_A_1-8585 Phosphoribosylaminoimidazole-succinocarboxamide sy 99.96
3kre_A_1-104_241-263127 Phosphoribosylaminoimidazole-succinocarboxamide sy 99.96
2z02_A_1-91_223-242111 Phosphoribosylaminoimidazole-succinocarboxamide sy 99.95
2h31_A_1-89_235-260_395-425146 Multifunctional protein ADE2; alpha-beta-alpha, li 99.94
1kut_A_1-78_200-230109 Phosphoribosylaminoimidazole-succinocarboxamide sy 99.93
2cnq_A_1-112_253-305165 Phosphoribosylaminoimidazole-succinocarboxamide sy 95.05
1kut_A_1-78_200-230109 Phosphoribosylaminoimidazole-succinocarboxamide sy 94.95
>2gqr_A (A:86-237) Phosphoribosylaminoimidazole-succinocarboxamide synthase; PURC, ADE2, ADE1, nucleotide complex, octahedral magnesium coordination; HET: ADP; 2.00A {Escherichia coli} PDB: 2gqs_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=370.15  Aligned_cols=151  Identities=38%  Similarity=0.635  Sum_probs=147.3

Q ss_pred             CCCEEEEEECEEECCHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             55359999244601010025643377378643444345445688641557888854089899978999999999999999
Q gi|254780973|r   86 MIPLLITVRNTAAGSLAKRLNIPEGLSLPRSLVEFYYLPDSSEKTLVSEEHITAFNWANQSEVEEMTALSIRINDFMTGL  165 (255)
Q Consensus        86 ~iPiE~VvR~yaaGS~~kry~~~~G~~l~~pl~e~~~K~d~~~DP~i~~~~~~~~~~~~~~~~~~i~~~a~~i~~~l~~~  165 (255)
                      .||||||||||||||+|+|||+++|++|++|++||++|+|++|||+||++++.++|+++++++++|+++|+++|++++++
T Consensus         1 ~IPlEvVvRn~a~GS~~krygl~eg~~l~~Pive~~~K~d~~~Dp~i~~~~~~~~~~~~~~e~~~i~~~al~v~~~l~~~   80 (152)
T 2gqr_A            1 XVPVECVVRNRAAGSLVKRLGIEEGIELNPPLFDLFLKNDAXHDPXVNESYCETFGWVSKENLARXKELTYKANDVLKKL   80 (152)
T ss_dssp             ECSEEEEEEEECCHHHHHHHCCCTTCEEEEEEEEEEECCGGGTCCEECHHHHHHTTSSCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCEEEEEHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             21179997434130204256864223446443322122344688764588999846210345888988888888998888


Q ss_pred             HHHCCCEEECCCEEEEECCCCCCCEEEEEEEECCCCCEEEECCCCCCCCHHHHHCCHHHHHHHHHHHHHHHCCCC
Q ss_conf             998797663120666310468888799996305874141176756704478761236779999999999714232
Q gi|254780973|r  166 FLGINIQLVDFRIKCGRLLDDDILRIVLADEIFPDCCRLWDLSKKEECDKKRFSKSNDQLLEGYSEVARRLGIFK  240 (255)
Q Consensus       166 ~~~~Gl~LvD~K~EFG~~~~~~~g~iiL~DEItPDs~R~Wd~~~~e~lDKd~~R~~l~~v~~~Y~ev~~rl~~~~  240 (255)
                      |.++|++|||||+|||++    .|+|+||||||||||||||.+++++||||+||+|+++++++|+|+++||+...
T Consensus        81 ~~~~gi~LvD~KlEFG~~----~g~i~L~DEItpDs~Rlw~~~~~e~lDKe~~R~~l~~~~~~Y~ev~~rl~~~~  151 (152)
T 2gqr_A           81 FDDAGLILVDFKLEFGLY----KGEVVLGDEFSPDGSRLWDKETLEKXDKDRFRQSLGGLIEAYEAVARRLGVQL  151 (152)
T ss_dssp             HHHTTEEEEEEEEEEEEE----TTEEEEESCCSTTSEEEEETTTCCBCSTHHHHTTCCCHHHHHHHHHHHHTCCC
T ss_pred             HHHCCCEEEEEEEEEEEC----CCCEEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             986795886416899745----99789999457986424067767745869987212336699999999848887



>3kre_A (A:105-240) Phosphoribosylaminoimidazole-succinocarboxamide synthase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ATP-binding, ligase; 1.80A {Ehrlichia chaffeensis str} Back     alignment and structure
>2z02_A (A:92-222) Phosphoribosylaminoimidazole-succinocarboxamide synthase; 2-layer sandwich, ligase, purine biosynthesis, structural genomics; HET: ATP CIT; 2.03A {Methanocaldococcus jannaschii} PDB: 2yzl_A* Back     alignment and structure
>2ywv_A (A:89-219) Phosphoribosylaminoimidazole succinocarboxamide synthetase; ADP complex, structural genomics, NPPSFA; HET: ADP; 1.75A {Geobacillus kaustophilus} Back     alignment and structure
>2h31_A (A:90-234) Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Back     alignment and structure
>1kut_A (A:79-199) Phosphoribosylaminoimidazole-succinocarboxamide synthase; structural genomics, saicar synthetase, PSI, protein structure initiative; 2.20A {Thermotoga maritima} Back     alignment and structure
>2ywv_A (A:1-88,A:220-244) Phosphoribosylaminoimidazole succinocarboxamide synthetase; ADP complex, structural genomics, NPPSFA; HET: ADP; 1.75A {Geobacillus kaustophilus} Back     alignment and structure
>2gqr_A (A:1-85) Phosphoribosylaminoimidazole-succinocarboxamide synthase; PURC, ADE2, ADE1, nucleotide complex, octahedral magnesium coordination; HET: ADP; 2.00A {Escherichia coli} PDB: 2gqs_A* Back     alignment and structure
>3kre_A (A:1-104,A:241-263) Phosphoribosylaminoimidazole-succinocarboxamide synthase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ATP-binding, ligase; 1.80A {Ehrlichia chaffeensis str} Back     alignment and structure
>2z02_A (A:1-91,A:223-242) Phosphoribosylaminoimidazole-succinocarboxamide synthase; 2-layer sandwich, ligase, purine biosynthesis, structural genomics; HET: ATP CIT; 2.03A {Methanocaldococcus jannaschii} PDB: 2yzl_A* Back     alignment and structure
>2h31_A (A:1-89,A:235-260,A:395-425) Multifunctional protein ADE2; alpha-beta-alpha, ligase, lyase; 2.80A {Homo sapiens} Back     alignment and structure
>1kut_A (A:1-78,A:200-230) Phosphoribosylaminoimidazole-succinocarboxamide synthase; structural genomics, saicar synthetase, PSI, protein structure initiative; 2.20A {Thermotoga maritima} Back     alignment and structure
>1kut_A (A:1-78,A:200-230) Phosphoribosylaminoimidazole-succinocarboxamide synthase; structural genomics, saicar synthetase, PSI, protein structure initiative; 2.20A {Thermotoga maritima} Back     alignment and structure