254780978

254780978

aspartyl/glutamyl-tRNA amidotransferase subunit A

GeneID in NCBI database:8210000Locus tag:CLIBASIA_04395
Protein GI in NCBI database:254780978Protein Accession:YP_003065391.1
Gene range:+(974616, 976097)Protein Length:493aa
Gene description:aspartyl/glutamyl-tRNA amidotransferase subunit A
COG prediction:[J] Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases
KEGG prediction:gatA; aspartyl/glutamyl-tRNA amidotransferase subunit A (EC:6.3.5.-); K02433 aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
SEED prediction:Aspartyl-tRNA(Asn) amidotransferase subunit A (EC 6.3.5.6) or Glutamyl-tRNA(Gln) amidotransferase subunit A (EC 6.3.5.7)
Pathway involved in KEGG:Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:tRNA aminoacylation, Glu and Gln;
tRNA aminoacylation, Asp and Asn
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490---
MSELNFMAVSESRDRLRSKDISAVELVDSYIQAIENSNSQMNAYIEVVAQKARAAAEESDKRIINGDARDLEGIPIGIKDCFATKGIHTQACSHILDGFRPHYESTVTQKLWDNGAVMLGKLNMDEFAMGSSNETSYYGPVISPWRSMDSTDKFTPGGSSGGSSAAVAGFLCAASIGTDTGGSIRQPASFTGTVGIKPTYGRCSRLGIISFAPSLDQAGIITRTVRDSAILLKAIAGYDECDATCVNLPVPDYERALDQSIQGMTVGIPKEYRLDYLSPTIDKTWQQGISWLKDAGAKIVEISLPHTQYALPAYYIISPAEASSNLARYDGVRYGLRVEGKDILEMYENTRSIGFGQEVKHRIMIGTYVLSSRCYDSHYLRARKIRTLIKRDFTEAFEQGVDVILTPTTPTSAFPLGKEENNSGSMGHIYNDVFTVAVNMAGLPAISVPAALCEKKMPLGLQLIGQPFREETLFSVGQIIEKEAGYFRPHKWW
cccHHHccHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccEEEEEcHHHHHHHHHHHHHHHHccccccccccEEEEcccEEccccccHHHHHHHHcccccccHHHHHHHHHcccEEEEccccccHHcccccccccccccccccccccccccccccccccHHHHHHHcccccEEEEEcccccccccHHHcccEEEcccccccccccccccccccccccEEEccHHHHHHHHHHHHccccccccccccccccHHHHccccccccEEEEEcccccccccHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEccccccccEEEEEEEEccccHHHHHHHHHHHHHHcccccccccc
ccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHHHHHHHcccccccccccHEEHHHHccccccccHHHHHHccccccccHHHHHHHHHcccEEEEcccccHHccccccccccccccccccccccccHccccccccHHHHHHHHcccccEEEEEEcccccHHHHHHcccEEEEcccccEccccEccccccccEEEEEEccHHHHHHHHHHHEccccccHHHHHcccccHHHHHcccccccEEcccHHHccccccHHHHHHHHHHHHHHHHcccEEEEEEccccccccEEEEEEcccHHHHHHHcccccEEcEccccccHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEcccccccccccccccccccHHHHHHHHccEEEEHcccccccEcccccccccccEEEEEEcccccHHHHHHHHHHHHHHcccccccccc
MSELNFMAVSESRdrlrskdisAVELVDSYIQAIENSNSQMNAYIEVVAQKARAAAEEsdkriingdardlegipigikdcfatkgihTQACSHIldgfrphyestVTQKLWDNGAVMLGKLnmdefamgssnetsyygpvispwrsmdstdkftpggssggssAAVAGFLCAAsigtdtggsirqpasftgtvgikptygrcsrlgiisfapsldqagiiTRTVRDSAILLKAIAgydecdatcvnlpvpdyeRALDQSIqgmtvgipkeyrldylsptidKTWQQGISWLKDAGAKIVEislphtqyalpayyiispaeassnlarydgvryglrVEGKDILEMYEntrsigfgqeVKHRIMIGTYVlssrcydshYLRARKIRTLIKRDFTEAFEQGVdviltpttptsafplgkeennsgsmghiyNDVFTVAVNMaglpaisvpaalcekkmplglqligqpfreetLFSVGQIIEKeagyfrphkww
mselnfmavsesrdrlrskdisAVELVDSYIQAIENSNSQMNAYIEVVAQKARAAaeesdkriingdardlegipIGIKDCFATKGIHTQACSHILDGFRPHYESTVTQKLWDNGAVMLGKLNMDEFAMGSSNETSYYGPVISPWRSMDSTDKFTPGGSSGGSSAAVAGFLCAASIGTDTGGSIRQPASFTGTVGIKPTYGRCSRLGIISFAPSLDQAGIITRTVRDSAILLKAIAGYDECDATCVNLPVPDYERALDQSIQGMTVGIPKEYRLDYLSPTIDKTWQQGISWLKDAGAKIVEISLPHTQYALPAYYIISPAEASSNLARYDGVRYGLRVEGKDILEMYENTrsigfgqevkHRIMIGTYVLSSRCYDSHYLRARKIRTLIKRDFTEAFEQgvdviltpttptsafplgKEENNSGSMGHIYNDVFTVAVNMAGLPAISVPAALCEKKMPLGLQLIGQPFREETLFSVGQIIEkeagyfrphkww
MSELNFMAVSESRDRLRSKDISAVELVDSYIQAIENSNSQMNAYIEVVAQKARAAAEESDKRIINGDARDLEGIPIGIKDCFATKGIHTQACSHILDGFRPHYESTVTQKLWDNGAVMLGKLNMDEFAMGSSNETSYYGPVISPWRSMDSTDKFTPggssggssaavagFLCAASIGTDTGGSIRQPASFTGTVGIKPTYGRCSRLGIISFAPSLDQAGIITRTVRDSAILLKAIAGYDECDATCVNLPVPDYERALDQSIQGMTVGIPKEYRLDYLSPTIDKTWQQGISWLKDAGAKIVEISLPHTQYALPAYYIISPAEASSNLARYDGVRYGLRVEGKDILEMYENTRSIGFGQEVKHRIMIGTYVLSSRCYDSHYLRARKIRTLIKRDFTEAFEQGVDVILTPTTPTSAFPLGKEENNSGSMGHIYNDVFTVAVNMAGLPAISVPAALCEKKMPLGLQLIGQPFREETLFSVGQIIEKEAGYFRPHKWW
*****FMAVSESRDRLRSKDISAVELVDSYIQAIENSNSQMNAYIEVVAQKARAAAEES*****NGDARDLEGIPIGIKDCFATKGIHTQACSHILDGFRPHYESTVTQKLWDNGAVMLGKLNMDEFAMGSSNETSYYGPVISPWRSMDS***********GSSAAVAGFLCAASIGTDTGGSIRQPASFTGTVGIKPTYGRCSRLGIISFAPSLDQAGIITRTVRDSAILLKAIAGYDECDATCVNLPVPDYERALDQSIQGMTVGIPKEYRLDYLSPTIDKTWQQGISWLKDAGAKIVEISLPHTQYALPAYYIISPAEASSNLARYDGVRYGLRVEGKDILEMYENTRSIGFGQEVKHRIMIGTYVLSSRCYDSHYLRARKIRTLIKRDFTEAFEQGVDVILTPTTPTSAFPLGKEENNSGSMGHIYNDVFTVAVNMAGLPAISVPAALCEKKMPLGLQLIGQPFREETLFSVGQIIEKEAGYF**HKWW
******************KDISAVELVDSYIQAIENSNSQMNAYIEVVAQ*********DKRIINGDARDLEGIPIGIKDCFATKGIHTQACSHILDGFRPHYESTVTQKLWDNGAVMLGKLNMDEFAMGSSNETSYYGPVISPWRSMDSTDK**********SAAVAGFLCAASIGTDTGGSIRQPASFTGTVGIKPTYGRCSRLGIISFAPSLDQAGIITRTVRDSAILLKAIAGYDECDATCVNLPVPDYERALDQSIQGMTVGIPKEYRLDYLSPTIDKTWQQGISWLKDAGAKIVEISLPHTQYALPAYYIISPAEASSNLARYDGVRYGLRVEGKDILEMYENTRSIGFGQEVKHRIMIGTYVLSSRCYDSHYLRARKIRTLIKRDFTEAFEQGVDVILTPTTPTSAFPLGKEENNSGSMGHIYNDVFTVAVNMAGLPAISVPAALCEKKMPLGLQLIGQPFREETLFSVGQIIEKEAGYFRPHKWW
*SELNFMAVSESRDRLRSKDISAVELVDSYIQAIENSNSQMNAYIEVVAQKARAAAEESDKRIINGDARDLEGIPIGIKDCFATKGIHTQACSHILDGFRPHYESTVTQKLWDNGAVMLGKLNMDEFAMGSSNETSYYGPVISPWRSMDSTDKFTPGGSSGGSSAAVAGFLCAASIGTDTGGSIRQPASFTGTVGIKPTYGRCSRLGIISFAPSLDQAGIITRTVRDSAILLKAIAGYDECDATCVNLPVPDYERALDQSIQGMTVGIPKEYRLDYLSPTIDKTWQQGISWLKDAGAKIVEISLPHTQYALPAYYIISPAEASSNLARYDGVRYGLRVEGKDILEMYENTRSIGFGQEVKHRIMIGTYVLSSRCYDSHYLRARKIRTLIKRDFTEAFEQGVDVILTPTTPTSAFPLGKEENNSGSMGHIYNDVFTVAVNMAGLPAISVPAALCEKKMPLGLQLIGQPFREETLFSVGQIIEKEAGYFRP****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSELNFMAVSESRDRLRSKDISAVELVDSYIQAIENSNSQMNAYIEVVAQKARAAAEESDKRIINGDARDLEGIPIGIKDCFATKGIHTQACSHILDGFRPHYESTVTQKLWDNGAVMLGKLNMDEFAMGSSNETSYYGPVISPWRSMDSTDKFTPGGSSGGSSAAVAGFLCAASIGTDTGGSIRQPASFTGTVGIKPTYGRCSRLGIISFAPSLDQAGIITRTVRDSAILLKAIAGYDECDATCVNLPVPDYERALDQSIQGMTVGIPKEYRLDYLSPTIDKTWQQGISWLKDAGAKIVEISLPHTQYALPAYYIISPAEASSNLARYDGVRYGLRVEGKDILEMYENTRSIGFGQEVKHRIMIGTYVLSSRCYDSHYLRARKIRTLIKRDFTEAFEQGVDVILTPTTPTSAFPLGKEENNSGSMGHIYNDVFTVAVNMAGLPAISVPAALCEKKMPLGLQLIGQPFREETLFSVGQIIEKEAGYFRPHKWW
MSELNFMAVSESRDRLRSKDISAVELVDSYIQAIENSNSQMNAYIEVVAQKARAAAEESDKRIINGDARDLEGIPIGIKDCFATKGIHTQACSHILDGFRPHYESTVTQKLWDNGAVMLGKLNMDEFAMGSSNETSYYGPVISPWRSMDSTDKFTPGGSSGGSSAAVAGFLCAASIGTDTGGSIRQPASFTGTVGIKPTYGRCSRLGIISFAPSLDQAGIITRTVRDSAILLKAIAGYDECDATCVNLPVPDYERALDQSIQGMTVGIPKEYRLDYLSPTIDKTWQQGISWLKDAGAKIVEISLPHTQYALPAYYIISPAEASSNLARYDGVRYGLRVEGKDILEMYENTRSIGFGQEVKHRIMIGTYVLSSRCYDSHYLRARKIRTLIKRDFTEAFEQGVDVILTPTTPTSAFPLGKEENNSGSMGHIYNDVFTVAVNMAGLPAISVPAALCEKKMPLGLQLIGQPFREETLFSVGQIIEKEAGYFRPHKWW
MSELNFMAVSESRDRLRSKDISAVELVDSYIQAIENSNSQMNAYIEVVAQKARAAAEESDKRIINGDARDLEGIPIGIKDCFATKGIHTQACSHILDGFRPHYESTVTQKLWDNGAVMLGKLNMDEFAMGSSNETSYYGPVISPWRSMDSTDKFTPGGSSGGSSAAVAGFLCAASIGTDTGGSIRQPASFTGTVGIKPTYGRCSRLGIISFAPSLDQAGIITRTVRDSAILLKAIAGYDECDATCVNLPVPDYERALDQSIQGMTVGIPKEYRLDYLSPTIDKTWQQGISWLKDAGAKIVEISLPHTQYALPAYYIISPAEASSNLARYDGVRYGLRVEGKDILEMYENTRSIGFGQEVKHRIMIGTYVLSSRCYDSHYLRARKIRTLIKRDFTEAFEQGVDVILTPTTPTSAFPLGKEENNSGSMGHIYNDVFTVAVNMAGLPAISVPAALCEKKMPLGLQLIGQPFREETLFSVGQIIEKEAGYFRPHKWW

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target493 aspartyl/glutamyl-tRNA amidotransferase subunit A [Cand
315122520492 aspartyl/glutamyl-tRNA amidotransferase subunit A [Cand 1 0.0
116251836493 aspartyl/glutamyl-tRNA amidotransferase subunit A [Rhiz 1 0.0
150396167493 aspartyl/glutamyl-tRNA amidotransferase subunit A [Sino 1 0.0
227821665493 aspartyl/glutamyl-tRNA amidotransferase subunit A [Sino 1 0.0
209549121493 aspartyl/glutamyl-tRNA amidotransferase subunit A [Rhiz 1 0.0
86357482493 aspartyl/glutamyl-tRNA amidotransferase subunit A [Rhiz 1 0.0
307317869500 glutamyl-tRNA(Gln) amidotransferase, A subunit [Sinorhi 1 0.0
241204446493 aspartyl/glutamyl-tRNA amidotransferase subunit A [Rhiz 1 0.0
260459191521 glutamyl-tRNA(Gln) amidotransferase, A subunit [Mesorhi 1 0.0
13470863521 aspartyl/glutamyl-tRNA amidotransferase subunit A [Meso 1 0.0
>gi|315122520|ref|YP_004063009.1| aspartyl/glutamyl-tRNA amidotransferase subunit A [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 492 Back     alignment and organism information
 Score =  882 bits (2278), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/492 (86%), Positives = 473/492 (96%)

Query: 1   MSELNFMAVSESRDRLRSKDISAVELVDSYIQAIENSNSQMNAYIEVVAQKARAAAEESD 60
           MS LN M++SESRDRL++KDISAVEL+D++IQAIE+ NS+MNAY+E+VAQKARA A +SD
Sbjct: 1   MSALNCMSLSESRDRLKNKDISAVELIDAHIQAIEDYNSKMNAYVEIVAQKARAFAMKSD 60

Query: 61  KRIINGDARDLEGIPIGIKDCFATKGIHTQACSHILDGFRPHYESTVTQKLWDNGAVMLG 120
           +RI +G+ RDLEGIPIG+KDCFATKGIHTQACSHILDGF+P YESTVTQKLWDNGA+MLG
Sbjct: 61  ERIASGNLRDLEGIPIGVKDCFATKGIHTQACSHILDGFKPEYESTVTQKLWDNGAIMLG 120

Query: 121 KLNMDEFAMGSSNETSYYGPVISPWRSMDSTDKFTPGGSSGGSSAAVAGFLCAASIGTDT 180
           KLNMDEFAMGSSNETSYYGPV+SPWR+++ST+KFTPGGSSGGSSAAV+GFLCAASIGTDT
Sbjct: 121 KLNMDEFAMGSSNETSYYGPVVSPWRAVNSTEKFTPGGSSGGSSAAVSGFLCAASIGTDT 180

Query: 181 GGSIRQPASFTGTVGIKPTYGRCSRLGIISFAPSLDQAGIITRTVRDSAILLKAIAGYDE 240
           GGSIRQPASFTGTVG+KPTYGRCSRLGIISFAPSLDQAG+ITR+VRD+AILLKAIAGYD 
Sbjct: 181 GGSIRQPASFTGTVGMKPTYGRCSRLGIISFAPSLDQAGVITRSVRDAAILLKAIAGYDN 240

Query: 241 CDATCVNLPVPDYERALDQSIQGMTVGIPKEYRLDYLSPTIDKTWQQGISWLKDAGAKIV 300
            D+TCV+LPVPDYE ++ +SI+G+TVGIPKEYRLD+LSPTI+KTW+QGI+WLKDAGAKIV
Sbjct: 241 RDSTCVDLPVPDYELSIGRSIKGITVGIPKEYRLDHLSPTIEKTWKQGIAWLKDAGAKIV 300

Query: 301 EISLPHTQYALPAYYIISPAEASSNLARYDGVRYGLRVEGKDILEMYENTRSIGFGQEVK 360
           +ISLPHTQYALPAYYII+PAEASSNLARYDGVRYGLRV GKDI++MYE TRS+GFG+E K
Sbjct: 301 DISLPHTQYALPAYYIIAPAEASSNLARYDGVRYGLRVAGKDIVDMYEKTRSVGFGKEAK 360

Query: 361 HRIMIGTYVLSSRCYDSHYLRARKIRTLIKRDFTEAFEQGVDVILTPTTPTSAFPLGKEE 420
           HRIMIGTYVLSS C+DSHYLRARKIRTLIKRDFTE F+QGVDVILTPTTPTSAFPLGKEE
Sbjct: 361 HRIMIGTYVLSSHCHDSHYLRARKIRTLIKRDFTEVFKQGVDVILTPTTPTSAFPLGKEE 420

Query: 421 NNSGSMGHIYNDVFTVAVNMAGLPAISVPAALCEKKMPLGLQLIGQPFREETLFSVGQII 480
           NNSGSMGHIYNDVFTVA NMAGLPAISVPAALC++KMPLGLQLIGQPFREE LFSVGQII
Sbjct: 421 NNSGSMGHIYNDVFTVATNMAGLPAISVPAALCDRKMPLGLQLIGQPFREEMLFSVGQII 480

Query: 481 EKEAGYFRPHKW 492
           EKEAGYFRPHKW
Sbjct: 481 EKEAGYFRPHKW 492


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|116251836|ref|YP_767674.1| aspartyl/glutamyl-tRNA amidotransferase subunit A [Rhizobium leguminosarum bv. viciae 3841] Length = 493 Back     alignment and organism information
>gi|150396167|ref|YP_001326634.1| aspartyl/glutamyl-tRNA amidotransferase subunit A [Sinorhizobium medicae WSM419] Length = 493 Back     alignment and organism information
>gi|227821665|ref|YP_002825635.1| aspartyl/glutamyl-tRNA amidotransferase subunit A [Sinorhizobium fredii NGR234] Length = 493 Back     alignment and organism information
>gi|209549121|ref|YP_002281038.1| aspartyl/glutamyl-tRNA amidotransferase subunit A [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 493 Back     alignment and organism information
>gi|86357482|ref|YP_469374.1| aspartyl/glutamyl-tRNA amidotransferase subunit A [Rhizobium etli CFN 42] Length = 493 Back     alignment and organism information
>gi|307317869|ref|ZP_07597307.1| glutamyl-tRNA(Gln) amidotransferase, A subunit [Sinorhizobium meliloti AK83] Length = 500 Back     alignment and organism information
>gi|241204446|ref|YP_002975542.1| aspartyl/glutamyl-tRNA amidotransferase subunit A [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 493 Back     alignment and organism information
>gi|260459191|ref|ZP_05807446.1| glutamyl-tRNA(Gln) amidotransferase, A subunit [Mesorhizobium opportunistum WSM2075] Length = 521 Back     alignment and organism information
>gi|13470863|ref|NP_102432.1| aspartyl/glutamyl-tRNA amidotransferase subunit A [Mesorhizobium loti MAFF303099] Length = 521 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target493 aspartyl/glutamyl-tRNA amidotransferase subunit A [Cand
PRK00012459 PRK00012, gatA, aspartyl/glutamyl-tRNA amidotransferase 0.0
TIGR00132460 TIGR00132, gatA, glutamyl-tRNA(Gln) and/or aspartyl-tRN 1e-160
pfam01425431 pfam01425, Amidase, Amidase 1e-129
KOG1211506 KOG1211, KOG1211, KOG1211, Amidases [Translation, ribos 1e-105
PRK07488472 PRK07488, PRK07488, indole acetimide hydrolase; Validat 2e-67
PRK09201465 PRK09201, PRK09201, amidase; Provisional 3e-65
TIGR02715452 TIGR02715, amido_AtzE, amidohydrolase, AtzE family 2e-61
PRK06169466 PRK06169, PRK06169, putative amidase; Provisional 1e-60
PRK08137497 PRK08137, PRK08137, amidase; Provisional 5e-53
PRK06170490 PRK06170, PRK06170, amidase; Provisional 3e-52
KOG1212560 KOG1212, KOG1212, KOG1212, Amidases [Translation, ribos 7e-47
PRK07056454 PRK07056, PRK07056, amidase; Provisional 1e-46
PRK12470462 PRK12470, PRK12470, amidase; Provisional 1e-45
PRK06828491 PRK06828, PRK06828, amidase; Provisional 2e-44
PRK07487469 PRK07487, PRK07487, amidase; Provisional 3e-44
PRK07042464 PRK07042, PRK07042, amidase; Provisional 4e-42
PRK08186 600 PRK08186, PRK08186, allophanate hydrolase; Provisional 1e-39
PRK06102452 PRK06102, PRK06102, hypothetical protein; Provisional 2e-39
PRK06707536 PRK06707, PRK06707, amidase; Provisional 3e-38
PRK05962424 PRK05962, PRK05962, amidase; Validated 1e-36
PRK06529482 PRK06529, PRK06529, amidase; Provisional 3e-32
COG0154475 COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransferase 1e-138
PRK07139439 PRK07139, PRK07139, amidase; Provisional 5e-72
PRK07235502 PRK07235, PRK07235, amidase; Provisional 2e-62
TIGR02713 561 TIGR02713, allophanate_hyd, allophanate hydrolase 5e-42
PRK08310395 PRK08310, PRK08310, amidase; Provisional 8e-30
PRK06061483 PRK06061, PRK06061, amidase; Provisional 4e-37
PRK07486484 PRK07486, PRK07486, amidase; Provisional 6e-31
PRK07869468 PRK07869, PRK07869, amidase; Provisional 1e-25
PRK11910615 PRK11910, PRK11910, amidase; Provisional 6e-21
PLN02722422 PLN02722, PLN02722, indole-3-acetamide amidohydrolase 3e-21
PRK06565566 PRK06565, PRK06565, amidase; Validated 1e-18
PRK06061483 PRK06061, PRK06061, amidase; Provisional 7e-07
PRK07869468 PRK07869, PRK07869, amidase; Provisional 2e-04
PRK07486484 PRK07486, PRK07486, amidase; Provisional 6e-05
>gnl|CDD|178793 PRK00012, gatA, aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|161728 TIGR00132, gatA, glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, A subunit Back     alignment and domain information
>gnl|CDD|144864 pfam01425, Amidase, Amidase Back     alignment and domain information
>gnl|CDD|36425 KOG1211, KOG1211, KOG1211, Amidases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|180998 PRK07488, PRK07488, indole acetimide hydrolase; Validated Back     alignment and domain information
>gnl|CDD|181695 PRK09201, PRK09201, amidase; Provisional Back     alignment and domain information
>gnl|CDD|162985 TIGR02715, amido_AtzE, amidohydrolase, AtzE family Back     alignment and domain information
>gnl|CDD|180437 PRK06169, PRK06169, putative amidase; Provisional Back     alignment and domain information
>gnl|CDD|181247 PRK08137, PRK08137, amidase; Provisional Back     alignment and domain information
>gnl|CDD|180438 PRK06170, PRK06170, amidase; Provisional Back     alignment and domain information
>gnl|CDD|36426 KOG1212, KOG1212, KOG1212, Amidases [Translation, ribosomal structure and biogenesis, Lipid transport and metabolism, Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|180813 PRK07056, PRK07056, amidase; Provisional Back     alignment and domain information
>gnl|CDD|171524 PRK12470, PRK12470, amidase; Provisional Back     alignment and domain information
>gnl|CDD|180715 PRK06828, PRK06828, amidase; Provisional Back     alignment and domain information
>gnl|CDD|180997 PRK07487, PRK07487, amidase; Provisional Back     alignment and domain information
>gnl|CDD|180805 PRK07042, PRK07042, amidase; Provisional Back     alignment and domain information
>gnl|CDD|181276 PRK08186, PRK08186, allophanate hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|180400 PRK06102, PRK06102, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180665 PRK06707, PRK06707, amidase; Provisional Back     alignment and domain information
>gnl|CDD|168315 PRK05962, PRK05962, amidase; Validated Back     alignment and domain information
>gnl|CDD|180608 PRK06529, PRK06529, amidase; Provisional Back     alignment and domain information
>gnl|CDD|30503 COG0154, GatA, Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|180858 PRK07139, PRK07139, amidase; Provisional Back     alignment and domain information
>gnl|CDD|180901 PRK07235, PRK07235, amidase; Provisional Back     alignment and domain information
>gnl|CDD|162984 TIGR02713, allophanate_hyd, allophanate hydrolase Back     alignment and domain information
>gnl|CDD|181375 PRK08310, PRK08310, amidase; Provisional Back     alignment and domain information
>gnl|CDD|180375 PRK06061, PRK06061, amidase; Provisional Back     alignment and domain information
>gnl|CDD|168970 PRK07486, PRK07486, amidase; Provisional Back     alignment and domain information
>gnl|CDD|181154 PRK07869, PRK07869, amidase; Provisional Back     alignment and domain information
>gnl|CDD|183377 PRK11910, PRK11910, amidase; Provisional Back     alignment and domain information
>gnl|CDD|166363 PLN02722, PLN02722, indole-3-acetamide amidohydrolase Back     alignment and domain information
>gnl|CDD|180626 PRK06565, PRK06565, amidase; Validated Back     alignment and domain information
>gnl|CDD|180375 PRK06061, PRK06061, amidase; Provisional Back     alignment and domain information
>gnl|CDD|181154 PRK07869, PRK07869, amidase; Provisional Back     alignment and domain information
>gnl|CDD|168970 PRK07486, PRK07486, amidase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 493 aspartyl/glutamyl-tRNA amidotransferase subunit A [Cand
PRK00012485 gatA aspartyl/glutamyl-tRNA amidotransferase subunit A; 100.0
PRK06169466 putative amidase; Provisional 100.0
PRK09201465 amidase; Provisional 100.0
PRK07042464 amidase; Provisional 100.0
COG0154475 GatA Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit 100.0
PRK07486484 amidase; Provisional 100.0
PRK06170490 amidase; Provisional 100.0
PRK07488473 indole acetimide hydrolase; Validated 100.0
PRK07487469 amidase; Provisional 100.0
PRK06061484 amidase; Provisional 100.0
PRK08137518 amidase; Provisional 100.0
TIGR02715454 amido_AtzE amidohydrolase, AtzE family; InterPro: IPR01 100.0
PRK12470460 amidase; Provisional 100.0
PRK07056452 amidase; Provisional 100.0
pfam01425431 Amidase Amidase. 100.0
PRK06102452 hypothetical protein; Provisional 100.0
PRK06565566 amidase; Validated 100.0
PRK07869467 amidase; Provisional 100.0
PRK06707536 amidase; Provisional 100.0
PRK05962431 amidase; Validated 100.0
PRK06828491 amidase; Provisional 100.0
PRK06529482 amidase; Provisional 100.0
PRK08186 600 amidase; Provisional 100.0
PRK11910615 amidase; Provisional 100.0
KOG1211506 consensus 100.0
KOG1212560 consensus 100.0
TIGR00132479 gatA glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amido 100.0
PRK07235504 amidase; Provisional 100.0
PRK07139439 amidase; Provisional 100.0
TIGR02713 582 allophanate_hyd allophanate hydrolase; InterPro: IPR014 100.0
PRK08310395 amidase; Provisional 100.0
>PRK00012 gatA aspartyl/glutamyl-tRNA amidotransferase subunit A; Reviewed Back     alignment and domain information
>PRK06169 putative amidase; Provisional Back     alignment and domain information
>PRK09201 amidase; Provisional Back     alignment and domain information
>PRK07042 amidase; Provisional Back     alignment and domain information
>COG0154 GatA Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07486 amidase; Provisional Back     alignment and domain information
>PRK06170 amidase; Provisional Back     alignment and domain information
>PRK07488 indole acetimide hydrolase; Validated Back     alignment and domain information
>PRK07487 amidase; Provisional Back     alignment and domain information
>PRK06061 amidase; Provisional Back     alignment and domain information
>PRK08137 amidase; Provisional Back     alignment and domain information
>TIGR02715 amido_AtzE amidohydrolase, AtzE family; InterPro: IPR014087 Members of this protein family are aminohydrolases related to, but distinct from, glutamyl-tRNA(Gln) amidotransferase subunit A Back     alignment and domain information
>PRK12470 amidase; Provisional Back     alignment and domain information
>PRK07056 amidase; Provisional Back     alignment and domain information
>pfam01425 Amidase Amidase Back     alignment and domain information
>PRK06102 hypothetical protein; Provisional Back     alignment and domain information
>PRK06565 amidase; Validated Back     alignment and domain information
>PRK07869 amidase; Provisional Back     alignment and domain information
>PRK06707 amidase; Provisional Back     alignment and domain information
>PRK05962 amidase; Validated Back     alignment and domain information
>PRK06828 amidase; Provisional Back     alignment and domain information
>PRK06529 amidase; Provisional Back     alignment and domain information
>PRK08186 amidase; Provisional Back     alignment and domain information
>PRK11910 amidase; Provisional Back     alignment and domain information
>KOG1211 consensus Back     alignment and domain information
>KOG1212 consensus Back     alignment and domain information
>TIGR00132 gatA glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, A subunit; InterPro: IPR004412 In many species, Gln-tRNA ligase is missing Back     alignment and domain information
>PRK07235 amidase; Provisional Back     alignment and domain information
>PRK07139 amidase; Provisional Back     alignment and domain information
>TIGR02713 allophanate_hyd allophanate hydrolase; InterPro: IPR014085 Allophanate hydrolase catalyses the second reaction in an ATP-dependent two-step degradation of urea to ammonia and C02, following the action of the biotin-containing urea carboxylase Back     alignment and domain information
>PRK08310 amidase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target493 aspartyl/glutamyl-tRNA amidotransferase subunit A [Cand
3h0l_A478 Structure Of Trna-Dependent Amidotransferase Gatcab 1e-72
2f2a_A486 Structure Of Trna-Dependent Amidotransferase Gatcab 7e-66
2df4_A485 Structure Of Trna-Dependent Amidotransferase Gatcab 7e-66
3kfu_E471 Crystal Structure Of The Transamidosome Length = 47 8e-65
3al0_A475 Crystal Structure Of The Glutamine Transamidosome F 1e-58
2gi3_A476 Crystal Structure Of Glutamyl-Trna(Gln) Amidotransf 3e-54
3a2p_A493 Structure Of 6-Aminohexanoate Cyclic Dimer Hydrolas 1e-46
3a2q_A493 Structure Of 6-Aminohexanoate Cyclic Dimer Hydrolas 1e-46
1m21_A503 Crystal Structure Analysis Of The Peptide Amidase P 3e-44
1obl_A414 Crystal Structure Of The S133a Mutant Of Malonamida 6e-30
1o9o_A414 Crystal Structure Of The S131a Mutant Of Malonamida 6e-30
1obk_A414 Crystal Structure Of The R158q Mutant Of Malonamida 9e-30
1obj_A414 Crystal Structure Of The T150a Mutant Of Malonamida 1e-29
1ock_A412 The Crystal Structure Of Malonamidase E2 From Brady 1e-29
1o9q_A414 Crystal Structure Of The S155c Mutant Of Malonamida 2e-29
1obi_A414 Crystal Structure Of The G130a Mutant Of Malonamida 3e-29
1o9n_A414 Crystal Structure Of The K62a Mutant Of Malonamidas 1e-27
3qk5_A587 Crystal Structure Of Fatty Acid Amide Hydrolase Wit 2e-23
1mt5_A537 Crystal Structure Of Fatty Acid Amide Hydrolase Len 2e-23
2wj1_A573 3d-Crystal Structure Of Humanized-Rat Fatty Acid Am 6e-23
2vya_A587 Crystal Structure Of Fatty Acid Amide Hydrolase Con 7e-23
2wap_A543 3d-Crystal Structure Of Humanized-Rat Fatty Acid Am 7e-23
3a1k_A521 Crystal Structure Of Rhodococcus Sp. N771 Amidase L 4e-31
3a1i_A521 Crystal Structure Of Rhodococcus Sp. N-771 Amidase 4e-31
2dc0_A434 Crystal Structure Of Amidase Length = 434 2e-23
2dc0_A434 Crystal Structure Of Amidase Length = 434 8e-16
gi|254574883|pdb|3H0L|A Chain A, Structure Of Trna-Dependent Amidotransferase Gatcab From Aquifex Aeolicus Length = 478 Back     alignment and structure
 Score =  278 bits (711), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 204/485 (42%), Positives = 302/485 (62%), Gaps = 15/485 (3%)

Query: 4   LNFMAVSESRDRLRSKDISAVELVDSYIQAIENSNSQMNAYIEVVAQKARAAAEESDKRI 63
           L   ++SE R+ L+  ++S  E+V+S+      +  ++ AYI  +  KA   AE   +R 
Sbjct: 2   LWKKSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVKAYITPLYGKALKQAESLKER- 60

Query: 64  INGDARDLEGIPIGIKDCFATKGIHTQACSHILDGFRPHYESTVTQKLWDNGAVMLGKLN 123
                  L GIPI +KD    +G  T   S IL+ F   Y++TV ++L   GA+++GK N
Sbjct: 61  ----ELPLFGIPIAVKDNILVEGEKTTCASKILENFVAPYDATVIERLKKAGALIVGKTN 116

Query: 124 MDEFAMGSSNETSYYGPVISPWRSMDSTDKFTPGGSSGGSSAAVAGFLCAASIGTDTGGS 183
           +DEFAMGSS E S + P  +PW         + G ++  +  +        S+G+DTGGS
Sbjct: 117 LDEFAMGSSTEYSAFFPTKNPWDLERVPGGSSGGSAASVAVLS-----APVSLGSDTGGS 171

Query: 184 IRQPASFTGTVGIKPTYGRCSRLGIISFAPSLDQAGIITRTVRDSAILLKAIAGYDECDA 243
           IRQPASF G +GIKPTYGR SR G+++FA SLDQ G+  R   D A++L+ I+G+DE D+
Sbjct: 172 IRQPASFCGVIGIKPTYGRVSRYGLVAFASSLDQIGVFGRRTEDVALVLEVISGWDEKDS 231

Query: 244 TCVNLPVPDYERALDQSIQGMTVGIPKEYRLDYLSPTIDKTWQQGISWLKDAGAKIVEIS 303
           T   +PVP++   + + ++G+ +G+PKE+    L P + + ++  I  L+  G +I E+S
Sbjct: 232 TSAKVPVPEWSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKELEKEGFEIKEVS 291

Query: 304 LPHTQYALPAYYIISPAEASSNLARYDGVRYGLRVEGKDILE-MYENTRSIGFGQEVKHR 362
           LPH +Y++P YYII+P+EASSNLARYDGVRYG R +    +  MY  TR  GFG EVK R
Sbjct: 292 LPHVKYSIPTYYIIAPSEASSNLARYDGVRYGYRAKEYKDIFEMYARTRDEGFGPEVKRR 351

Query: 363 IMIGTYVLSSRCYDSHYLRARKIRTLIKRDFTEAFEQGVDVILTPTTPTSAFPLGKEENN 422
           IM+GT+ LS+  YD++YL+A+K+R LI  DF +AFE+ VDVI +PTTPT  F  G+   N
Sbjct: 352 IMLGTFALSAGYYDAYYLKAQKVRRLITNDFLKAFEE-VDVIASPTTPTLPFKFGERLEN 410

Query: 423 SGSMGHIYNDVFTVAVNMAGLPAISVPAALCEKKMPLGLQLIGQPFREETLFSVGQIIEK 482
              +    +D+ TV  N+AGLPAIS+P A  +  +P+G QLIG+ + E TL  +  + E+
Sbjct: 411 P--IEMYLSDILTVPANLAGLPAISIPIAW-KDGLPVGGQLIGKHWDETTLLQISYLWEQ 467

Query: 483 EAGYF 487
           +  ++
Sbjct: 468 KFKHY 472


>gi|157882112|pdb|2F2A|A Chain A, Structure Of Trna-Dependent Amidotransferase Gatcab Complexed With Gln Length = 486 Back     alignment and structure
gi|112490471|pdb|2DF4|A Chain A, Structure Of Trna-Dependent Amidotransferase Gatcab Complexed With Mn2+ Length = 485 Back     alignment and structure
gi|304445800|pdb|3KFU|E Chain E, Crystal Structure Of The Transamidosome Length = 471 Back     alignment and structure
gi|307776355|pdb|3AL0|A Chain A, Crystal Structure Of The Glutamine Transamidosome From Thermotoga Maritima In The Glutamylation State. Length = 475 Back     alignment and structure
>gi|99032571|pdb|2GI3|A Chain A, Crystal Structure Of Glutamyl-Trna(Gln) Amidotransferase Subunit A (Tm1272) From Thermotoga Maritima At 1.80 A Resolution Length = 476 Back     alignment and structure
gi|262367840|pdb|3A2P|A Chain A, Structure Of 6-Aminohexanoate Cyclic Dimer Hydrolase Length = 493 Back     alignment and structure
>gi|262367841|pdb|3A2Q|A Chain A, Structure Of 6-Aminohexanoate Cyclic Dimer Hydrolase Complexed With Substrate Length = 493 Back     alignment and structure
>gi|24987671|pdb|1M21|A Chain A, Crystal Structure Analysis Of The Peptide Amidase Pam In Complex With The Competitive Inhibitor Chymostatin Length = 503 Back     alignment and structure
>gi|46015014|pdb|1OBL|A Chain A, Crystal Structure Of The S133a Mutant Of Malonamidase E2 Complexed With Malonate From Bradyrhizobium Japonicum Length = 414 Back     alignment and structure
>gi|40889175|pdb|1O9O|A Chain A, Crystal Structure Of The S131a Mutant Of Malonamidase E2 Complexed With Malonamate From Bradyrhizobium Japonicum Length = 414 Back     alignment and structure
>gi|46015012|pdb|1OBK|A Chain A, Crystal Structure Of The R158q Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 Back     alignment and structure
>gi|40889187|pdb|1OBJ|A Chain A, Crystal Structure Of The T150a Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 Back     alignment and structure
>gi|28949102|pdb|1OCK|A Chain A, The Crystal Structure Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 412 Back     alignment and structure
>gi|40889179|pdb|1O9Q|A Chain A, Crystal Structure Of The S155c Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 Back     alignment and structure
>gi|40889185|pdb|1OBI|A Chain A, Crystal Structure Of The G130a Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 Back     alignment and structure
>gi|40889173|pdb|1O9N|A Chain A, Crystal Structure Of The K62a Mutant Of Malonamidase E2 From Bradyrhizobium Japonicum Length = 414 Back     alignment and structure
>gi|327533725|pdb|3QK5|A Chain A, Crystal Structure Of Fatty Acid Amide Hydrolase With Small Molecule Inhibitor Length = 587 Back     alignment and structure
>gi|27573966|pdb|1MT5|A Chain A, Crystal Structure Of Fatty Acid Amide Hydrolase Length = 537 Back     alignment and structure
>gi|258588197|pdb|2WJ1|A Chain A, 3d-Crystal Structure Of Humanized-Rat Fatty Acid Amide Hydrolase (Faah) Conjugated With 7-Phenyl-1-(4-(Pyridin-2- Yl)oxazol-2-Yl)heptan-1-One, An Alpha-Ketooxazole Length = 573 Back     alignment and structure
>gi|198443139|pdb|2VYA|A Chain A, Crystal Structure Of Fatty Acid Amide Hydrolase Conjugated With The Drug-Like Inhibitor Pf-750 Length = 587 Back     alignment and structure
>gi|229597616|pdb|2WAP|A Chain A, 3d-Crystal Structure Of Humanized-Rat Fatty Acid Amide Hydrolase (Faah) Conjugated With The Drug-Like Urea Inhibitor Pf-3845 Length = 543 Back     alignment and structure
gi|262367837|pdb|3A1K|A Chain A, Crystal Structure Of Rhodococcus Sp. N771 Amidase Length = 521 Back     alignment and structure
>gi|262118484|pdb|3A1I|A Chain A, Crystal Structure Of Rhodococcus Sp. N-771 Amidase Complexed With Benzamide Length = 521 Back     alignment and structure
>gi|122919913|pdb|2DC0|A Chain A, Crystal Structure Of Amidase Length = 434 Back     alignment and structure
>gi|122919913|pdb|2DC0|A Chain A, Crystal Structure Of Amidase Length = 434 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target493 aspartyl/glutamyl-tRNA amidotransferase subunit A [Cand
3h0l_A478 Glutamyl-tRNA(Gln) amidotransferase subunit A; multi pr 1e-127
3kfu_E471 Glutamyl-tRNA(Gln) amidotransferase subunit A; ASPRS, g 1e-127
3ip4_A485 Glutamyl-tRNA(Gln) amidotransferase subunit A; multi pr 1e-122
2gi3_A476 Glutamyl-tRNA(Gln) amidotransferase subunit A; TM1272, 1e-108
1m22_A503 Peptide amidase, PAM; eleven-stranded beta sheet, cover 3e-91
1o9p_A414 Malonamidase E2; malonate; 1.8A {Bradyrhizobium japonic 2e-77
3a1k_A521 Amidase; AS family enzyme, hydrolase; 2.17A {Rhodococcu 1e-73
2wj1_A573 Fatty-acid amide hydrolase 1; monotopic membrane protei 4e-71
2dc0_A434 Probable amidase; structural genomics, NPPSFA, national 1e-59
3a2q_A493 6-aminohexanoate-cyclic-dimer hydrolase; alpha/beta fol 7e-56
>3h0l_A Glutamyl-tRNA(Gln) amidotransferase subunit A; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_A 3h0r_A* Length = 478 Back     alignment and structure
 Score =  449 bits (1157), Expect = e-127
 Identities = 219/485 (45%), Positives = 312/485 (64%), Gaps = 15/485 (3%)

Query: 7   MAVSESRDRLRSKDISAVELVDSYIQAIENSNSQMNAYIEVVAQKARAAAEESDKRIING 66
            ++SE R+ L+  ++S  E+V+S+      +  ++ AYI  +  KA   AE   +R    
Sbjct: 5   KSLSELRELLKRGEVSPKEVVESFYDRYNQTEEKVKAYITPLYGKALKQAESLKER---- 60

Query: 67  DARDLEGIPIGIKDCFATKGIHTQACSHILDGFRPHYESTVTQKLWDNGAVMLGKLNMDE 126
               L GIPI +KD    +G  T   S IL+ F   Y++TV ++L   GA+++GK N+DE
Sbjct: 61  -ELPLFGIPIAVKDNILVEGEKTTCASKILENFVAPYDATVIERLKKAGALIVGKTNLDE 119

Query: 127 FAMGSSNETSYYGPVISPWRSMDSTDKFTPGGSSGGSSAAVAGFLCAASIGTDTGGSIRQ 186
           FAMGSS E S + P  +PW       +  PGGSSGGS+A+VA      S+G+DTGGSIRQ
Sbjct: 120 FAMGSSTEYSAFFPTKNPWD-----LERVPGGSSGGSAASVAVLSAPVSLGSDTGGSIRQ 174

Query: 187 PASFTGTVGIKPTYGRCSRLGIISFAPSLDQAGIITRTVRDSAILLKAIAGYDECDATCV 246
           PASF G +GIKPTYGR SR G+++FA SLDQ G+  R   D A++L+ I+G+DE D+T  
Sbjct: 175 PASFCGVIGIKPTYGRVSRYGLVAFASSLDQIGVFGRRTEDVALVLEVISGWDEKDSTSA 234

Query: 247 NLPVPDYERALDQSIQGMTVGIPKEYRLDYLSPTIDKTWQQGISWLKDAGAKIVEISLPH 306
            +PVP++   + + ++G+ +G+PKE+    L P + + ++  I  L+  G +I E+SLPH
Sbjct: 235 KVPVPEWSEEVKKEVKGLKIGLPKEFFEYELQPQVKEAFENFIKELEKEGFEIKEVSLPH 294

Query: 307 TQYALPAYYIISPAEASSNLARYDGVRYGLRV-EGKDILEMYENTRSIGFGQEVKHRIMI 365
            +Y++P YYII+P+EASSNLARYDGVRYG R  E KDI EMY  TR  GFG EVK RIM+
Sbjct: 295 VKYSIPTYYIIAPSEASSNLARYDGVRYGYRAKEYKDIFEMYARTRDEGFGPEVKRRIML 354

Query: 366 GTYVLSSRCYDSHYLRARKIRTLIKRDFTEAFEQGVDVILTPTTPTSAFPLGKEENNSGS 425
           GT+ LS+  YD++YL+A+K+R LI  DF +AFE+ VDVI +PTTPT  F  G+   N   
Sbjct: 355 GTFALSAGYYDAYYLKAQKVRRLITNDFLKAFEE-VDVIASPTTPTLPFKFGERLENPIE 413

Query: 426 MGHIYNDVFTVAVNMAGLPAISVPAALCEKKMPLGLQLIGQPFREETLFSVGQIIEKEAG 485
           M    +D+ TV  N+AGLPAIS+P A  +  +P+G QLIG+ + E TL  +  + E++  
Sbjct: 414 M--YLSDILTVPANLAGLPAISIPIAWKD-GLPVGGQLIGKHWDETTLLQISYLWEQKFK 470

Query: 486 YFRPH 490
           ++   
Sbjct: 471 HYEKI 475


>3kfu_E Glutamyl-tRNA(Gln) amidotransferase subunit A; ASPRS, gatcab, ATP-binding, aminoacyl-tRNA synthetase, ligas nucleotide-binding, protein biosynthesis, ligase-RNA comple; HET: H2U 5MU PSU; 3.00A {Thermus thermophilus} Length = 471 Back     alignment and structure
>3ip4_A Glutamyl-tRNA(Gln) amidotransferase subunit A; multi protein complex, ligase, ATP-binding, nucleotide- binding; 1.90A {Staphylococcus aureus subsp} PDB: 2df4_A 2dqn_A* 2g5h_A 2g5i_A* 2f2a_A Length = 485 Back     alignment and structure
>2gi3_A Glutamyl-tRNA(Gln) amidotransferase subunit A; TM1272, structural genomics, joint center for structural genomics, JCSG; HET: MSE MPD; 1.80A {Thermotoga maritima} SCOP: c.117.1.1 Length = 476 Back     alignment and structure
>1m22_A Peptide amidase, PAM; eleven-stranded beta sheet, covered double layers of alpha helices on TOP and bottom, hydrolase; HET: EPE; 1.40A {Stenotrophomonas maltophilia} SCOP: c.117.1.1 PDB: 1m21_A* Length = 503 Back     alignment and structure
>1o9p_A Malonamidase E2; malonate; 1.8A {Bradyrhizobium japonicum} SCOP: c.117.1.1 PDB: 1o9o_A 1obl_A 1och_A 1obk_A 1obi_A 1o9q_A* 1obj_A 1o9n_A 1ock_A 1ocl_A 1ocm_A Length = 414 Back     alignment and structure
>3a1k_A Amidase; AS family enzyme, hydrolase; 2.17A {Rhodococcus SP} PDB: 3a1i_A Length = 521 Back     alignment and structure
>2wj1_A Fatty-acid amide hydrolase 1; monotopic membrane protein, golgi apparatus, endoplasmic reticulum, membrane, transmembrane, phosphoprotein; HET: S99; 1.84A {Rattus norvegicus} PDB: 2wj2_A* 2wap_A* 1mt5_A* 2vya_A* Length = 573 Back     alignment and structure
>2dc0_A Probable amidase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Thermus thermophilus} Length = 434 Back     alignment and structure
>3a2q_A 6-aminohexanoate-cyclic-dimer hydrolase; alpha/beta fold, nylon degradation, plasmid; 1.80A {Arthrobacter SP} PDB: 3a2p_A Length = 493 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target493 aspartyl/glutamyl-tRNA amidotransferase subunit A [Cand
3ip4_A485 Glutamyl-tRNA(Gln) amidotransferase subunit A; multi pr 100.0
3h0l_A478 Glutamyl-tRNA(Gln) amidotransferase subunit A; multi pr 100.0
3kfu_E471 Glutamyl-tRNA(Gln) amidotransferase subunit A; ASPRS, g 100.0
2gi3_A476 Glutamyl-tRNA(Gln) amidotransferase subunit A; TM1272, 100.0
2wj1_A573 Fatty-acid amide hydrolase 1; monotopic membrane protei 100.0
1m22_A503 Peptide amidase, PAM; eleven-stranded beta sheet, cover 100.0
3a2q_A493 6-aminohexanoate-cyclic-dimer hydrolase; alpha/beta fol 100.0
2dc0_A434 Probable amidase; structural genomics, NPPSFA, national 100.0
3a1k_A521 Amidase; AS family enzyme, hydrolase; 2.17A {Rhodococcu 100.0
1o9p_A414 Malonamidase E2; malonate; 1.8A {Bradyrhizobium japonic 100.0
>3ip4_A Glutamyl-tRNA(Gln) amidotransferase subunit A; multi protein complex, ligase, ATP-binding, nucleotide- binding; 1.90A {Staphylococcus aureus subsp} PDB: 2df4_A 2dqn_A* 2g5h_A 2g5i_A* 2f2a_A Back     alignment and structure
Probab=100.00  E-value=0  Score=864.67  Aligned_cols=480  Identities=45%  Similarity=0.760  Sum_probs=445.6

Q ss_pred             CCCCHHCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECHHHHHHHHHHHHHHHHCCC-CCCCCCCEEHHH
Q ss_conf             9841345099999999968987899999999999996885558999888999999999999997888-988661212232
Q gi|254780978|r    1 MSELNFMAVSESRDRLRSKDISAVELVDSYIQAIENSNSQMNAYIEVVAQKARAAAEESDKRIINGD-ARDLEGIPIGIK   79 (493)
Q Consensus         1 m~~~~~~s~~~l~~~~~~~~~t~~~~~~~~~~~i~~~~~~~na~~~~~~~~al~~A~~~d~~~~~~~-~~pL~GiPi~vK   79 (493)
                      |+ +.+.||.||+++|++|++||+||+++|++||+++|+.+|||+++++|+||++|+++|+++++|+ .+|||||||+||
T Consensus         1 m~-~~~~s~~~l~~~~~~~~~s~~e~~~~~l~ri~~~~~~~na~~~~~~~~a~~~A~~~d~~~~~~~~~gpL~GiPi~vK   79 (485)
T 3ip4_A            1 MS-IRYESVENLLTLIKDKKIKPSDVVKDIYDAIEETDPTIKSFLALDKENAIKKAQELDELQAKDQMDGKLFGIPMGIK   79 (485)
T ss_dssp             CC-GGGCCHHHHHHHHHTTSSCHHHHHHHHHHHHHHHHHHHCCEEEECHHHHHHHHHHHHHHHHTTCCCSTTTTCEEEEE
T ss_pred             CC-CCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEE
T ss_conf             99-85789999999998599989999999999999869864399996999999999999999977999998486879987


Q ss_pred             HHCCCCCCCCCCCHHHHHCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             00004878553303765157544432104688874000011100000135665322223433566767656655445554
Q gi|254780978|r   80 DCFATKGIHTQACSHILDGFRPHYESTVTQKLWDNGAVMLGKLNMDEFAMGSSNETSYYGPVISPWRSMDSTDKFTPGGS  159 (493)
Q Consensus        80 D~~~v~g~~tt~G~~~~~~~~~~~da~~V~~L~~aGAi~~gkt~~~e~~~~~~~~n~~~G~t~NP~~~~~~~~~~~~GGS  159 (493)
                      |+|+|+|++||+|+.+++++++.+|+++|++|+++|||++||||||||+++.+|.|.+||+|+||||+.     ++||||
T Consensus        80 D~~~v~G~~tt~Gs~~~~~~~~~~d~~~v~~l~~~Gai~~gkt~~~e~~~~~~~~n~~~g~~~NP~~~~-----~~~GGS  154 (485)
T 3ip4_A           80 DNIITNGLETTCASKMLEGFVPIYESTVMEKLHKENAVLIGKLNMDEFAMGGSTETSYFKKTVNPFDHK-----AVPGGS  154 (485)
T ss_dssp             TTBCBTTBCCCTTSGGGTTCCCSSCCHHHHHHHHTTCEEEEEECCSGGGCCSSSTTCSSCCCCBTTBTT-----BCCCSS
T ss_pred             CCCCCCCCCCCCCCHHHCCCCCCCCHHHHHHHHHCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCC-----CCCCCC
T ss_conf             560668971587784440689853202455576279774455677540466677885556776875443-----456898


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             44542100123343224321121111305541110115454100011233222212123544322023446653022467
Q gi|254780978|r  160 SGGSSAAVAGFLCAASIGTDTGGSIRQPASFTGTVGIKPTYGRCSRLGIISFAPSLDQAGIITRTVRDSAILLKAIAGYD  239 (493)
Q Consensus       160 s~G~a~ava~~~~~~aiGtD~gGSiR~PAa~cGi~GlKPT~G~is~~G~~~~~~~ld~~Gpmarsv~D~~~~l~vl~g~d  239 (493)
                      |||+|++||+|++|+|||||||||||+||+||||||||||+||||+.|++|+++++||+|||||||+|+++++++|+++|
T Consensus       155 SgGsaaavA~g~~~~alGtD~~GSiR~PAa~~G~~g~kpt~g~i~~~G~~~~~~~~d~~Gpmar~v~D~~l~l~~~~g~d  234 (485)
T 3ip4_A          155 SGGSAAAVAAGLVPLSLGSDTGGSIRQPAAYCGVVGMKPTYGRVSRFGLVAFASSLDQIGPLTRNVKDNAIVLEAISGAD  234 (485)
T ss_dssp             SHHHHHHHHTTSCSEEEEECSSSTTHHHHHHTTCEEEECCTTSBCCTTBCCSCTTTCCEEEEESSHHHHHHHHHHHBSCC
T ss_pred             CCCHHHHHHHHCCCEEEECCCCCHHHHHHHHHCCEEEECCCCCCCCCCCCCCCCCCCEECCCCCCHHHHHHHHHHCCCCC
T ss_conf             61007788761577688627885001237984945772899877899987767777831312299999999997301898


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             43101111246531012444322222234344443332014565566566543322110135688721455554444456
Q gi|254780978|r  240 ECDATCVNLPVPDYERALDQSIQGMTVGIPKEYRLDYLSPTIDKTWQQGISWLKDAGAKIVEISLPHTQYALPAYYIISP  319 (493)
Q Consensus       240 ~~D~~~~~~~~~~~~~~~~~~~k~lrIgi~~~~~~~~~~~~v~~~~~~ai~~L~~~G~~vvev~~p~~~~~~~~~~~~~~  319 (493)
                      +.|+.+.+.+..++...+..+++++|||++.+++...+++++.++++++++.|+++|++|+|+++|......+.++.+..
T Consensus       235 ~~d~~s~~~~~~~~~~~~~~~lk~lrIg~~~~~~~~~~~~~v~~~~~~a~~~L~~~G~~V~ev~~p~~~~~~~~~~~~~~  314 (485)
T 3ip4_A          235 VNDSTSAPVDDVDFTSEIGKDIKGLKVALPKEYLGEGVADDVKEAVQNAVETLKSLGAVVEEVSLPNTKFGIPSYYVIAS  314 (485)
T ss_dssp             TTCTTSCCCCCCCCSTTTTCCCTTCEEEEEGGGGSTTSCHHHHHHHHHHHHHHHHTTCEEEEECCTTGGGHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCHHHHHCCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHH
T ss_conf             43344678886453556256866878999720215778989999999999999978999999379861556788999999


Q ss_pred             HHHHHHHHHHHHHHCCCCC-CCCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             7898887765333103100-243102455432100001466666530233333200012233457899999999999986
Q gi|254780978|r  320 AEASSNLARYDGVRYGLRV-EGKDILEMYENTRSIGFGQEVKHRIMIGTYVLSSRCYDSHYLRARKIRTLIKRDFTEAFE  398 (493)
Q Consensus       320 ~e~~~~l~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~a~~~r~~~~~~~~~~~~  398 (493)
                      .++..++..|++.++.... ...++.+++...+...++++++.++..+....+..+.+..|.++.+.+..+...+.++|.
T Consensus       315 ~e~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~f~  394 (485)
T 3ip4_A          315 SEASSNLSRFDGIRYGYHSKEAHSLEELYKMSRSEGFGKEVKRRIFLGTFALSSGYYDAYYKKSQKVRTLIKNDFDKVFE  394 (485)
T ss_dssp             HHHHHHTTTCSSSSSSCCCTTCCSHHHHHHHHHHHHSCHHHHHHHHHHHHHHSTTTTTTTHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_conf             99998898755233110133313699999864232028899999986555532235899999999876666668999872


Q ss_pred             CCCCEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCEEEEEEECCCCCHHHHHHHHH
Q ss_conf             39989991799899987763346732578876437899999878983768403559998379999518998799999999
Q gi|254780978|r  399 QGVDVILTPTTPTSAFPLGKEENNSGSMGHIYNDVFTVAVNMAGLPAISVPAALCEKKMPLGLQLIGQPFREETLFSVGQ  478 (493)
Q Consensus       399 ~~~D~lI~Pt~~~~a~~~~~~~~~~~~~~~~~~~~~t~~~N~~G~PaisiP~G~~~~GLPvGiQiig~~~~D~~lL~~a~  478 (493)
                       +||+||+||++.+|+++++....  ....+....||.++|++|+|+++||+|+. +|||+||||||++|+|++||++|+
T Consensus       395 -~~D~ll~Pt~~~~a~~~~~~~~~--~~~~~~~~~~t~~~Nl~G~PaisvP~G~~-~GlPvGvQivg~~~~D~~LL~iA~  470 (485)
T 3ip4_A          395 -NYDVVVGPTAPTTAFNLGEEIDD--PLTMYANDLLTTPVNLAGLPGISVPCGQS-NGRPIGLQFIGKPFDEKTLYRVAY  470 (485)
T ss_dssp             -TCSEEEEESSSSSCCBTTTSTTC--HHHHHGGGTTTHHHHHHTCCEEEEEEEEE-TTEEEEEEEECSTTCHHHHHHHHH
T ss_pred             -CCCEEEECCCCCCCCCCCCCCCC--HHHHHHCCHHHHHHHHHCCCEEEEECCCC-CCCCEEEEEECCCCCHHHHHHHHH
T ss_conf             -59999957988777886533478--88887400899999997899299978789-998876778899999999999999


Q ss_pred             HHHHHHCCCCCC
Q ss_conf             999992577978
Q gi|254780978|r  479 IIEKEAGYFRPH  490 (493)
Q Consensus       479 ~~E~~~~~~~pp  490 (493)
                      +||++++|++-+
T Consensus       471 ~~E~~~~~~~~~  482 (485)
T 3ip4_A          471 QYETQYNLHDVY  482 (485)
T ss_dssp             HHHHHSCCTTTG
T ss_pred             HHHHCCCCCCCC
T ss_conf             999618966379



>3h0l_A Glutamyl-tRNA(Gln) amidotransferase subunit A; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_A 3h0r_A* Back     alignment and structure
>3kfu_E Glutamyl-tRNA(Gln) amidotransferase subunit A; ASPRS, gatcab, ATP-binding, aminoacyl-tRNA synthetase, ligas nucleotide-binding, protein biosynthesis, ligase-RNA comple; HET: H2U 5MU PSU; 3.00A {Thermus thermophilus} Back     alignment and structure
>2gi3_A Glutamyl-tRNA(Gln) amidotransferase subunit A; TM1272, structural genomics, joint center for structural genomics, JCSG; HET: MSE MPD; 1.80A {Thermotoga maritima} SCOP: c.117.1.1 PDB: 3al0_A* Back     alignment and structure
>2wj1_A Fatty-acid amide hydrolase 1; monotopic membrane protein, golgi apparatus, endoplasmic reticulum, membrane, transmembrane, phosphoprotein; HET: S99; 1.84A {Rattus norvegicus} PDB: 2wj2_A* 3k7f_A* 3k83_A* 3k84_A* 3lj6_A* 3lj7_A 2wap_A* 1mt5_A* 2vya_A* Back     alignment and structure
>1m22_A Peptide amidase, PAM; eleven-stranded beta sheet, covered double layers of alpha helices on TOP and bottom, hydrolase; HET: EPE; 1.40A {Stenotrophomonas maltophilia} SCOP: c.117.1.1 PDB: 1m21_A* Back     alignment and structure
>3a2q_A 6-aminohexanoate-cyclic-dimer hydrolase; alpha/beta fold, nylon degradation, plasmid; 1.80A {Arthrobacter SP} PDB: 3a2p_A Back     alignment and structure
>2dc0_A Probable amidase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Thermus thermophilus} Back     alignment and structure
>3a1k_A Amidase; AS family enzyme, hydrolase; 2.17A {Rhodococcus SP} PDB: 3a1i_A Back     alignment and structure
>1o9p_A Malonamidase E2; malonate; 1.8A {Bradyrhizobium japonicum} SCOP: c.117.1.1 PDB: 1o9o_A 1obl_A 1och_A 1obk_A 1obi_A 1o9q_A* 1obj_A 1o9n_A 1ock_A 1ocl_A 1ocm_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 493 aspartyl/glutamyl-tRNA amidotransferase subunit A [Cand
d2f2aa1485 c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransferase 1e-124
d2gi3a1475 c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransferase 1e-108
d1mt5a_537 c.117.1.1 (A:) Fatty acid amide hydrolase (oleamide hyd 1e-67
d1m22a_490 c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomonas ma 2e-65
d1ocka_412 c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium japonicu 2e-50
>d2f2aa1 c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransferase subunit A {Staphylococcus aureus [TaxId: 1280]} Length = 485 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Amidase signature (AS) enzymes
superfamily: Amidase signature (AS) enzymes
family: Amidase signature (AS) enzymes
domain: Glutamyl-tRNA(Gln) amidotransferase subunit A
species: Staphylococcus aureus [TaxId: 1280]
 Score =  438 bits (1126), Expect = e-124
 Identities = 216/492 (43%), Positives = 315/492 (64%), Gaps = 12/492 (2%)

Query: 1   MSELNFMAVSESRDRLRSKDISAVELVDSYIQAIENSNSQMNAYIEVVAQKARAAAEESD 60
           MS + + +V      ++ K I   ++V     AIE ++  + +++ +  + A   A+E D
Sbjct: 1   MS-IRYESVENLLTLIKDKKIKPSDVVKDIYDAIEETDPTIKSFLALDKENAIKKAQELD 59

Query: 61  KRIINGDARD-LEGIPIGIKDCFATKGIHTQACSHILDGFRPHYESTVTQKLWDNGAVML 119
           +          L GIP+GIKD   T G+ T   S +L+GF P YESTV +KL    AV++
Sbjct: 60  ELQAKDQMDGKLFGIPMGIKDNIITNGLETTCASKMLEGFVPIYESTVMEKLHKENAVLI 119

Query: 120 GKLNMDEFAMGSSNETSYYGPVISPWRSMDSTDKFTPGGSSGGSSAAVAGFLCAASIGTD 179
           GKLNMDEFAMG S ETSY+   ++P+       K  PGGSSGGS+AAVA  L   S+G+D
Sbjct: 120 GKLNMDEFAMGGSTETSYFKKTVNPFD-----HKAVPGGSSGGSAAAVAAGLVPLSLGSD 174

Query: 180 TGGSIRQPASFTGTVGIKPTYGRCSRLGIISFAPSLDQAGIITRTVRDSAILLKAIAGYD 239
           TGGSIRQPA++ G VG+KPTYGR SR G+++FA SLDQ G +TR V+D+AI+L+AI+G D
Sbjct: 175 TGGSIRQPAAYCGVVGMKPTYGRVSRFGLVAFASSLDQIGPLTRNVKDNAIVLEAISGAD 234

Query: 240 ECDATCVNLPVPDYERALDQSIQGMTVGIPKEYRLDYLSPTIDKTWQQGISWLKDAGAKI 299
             D+T   +   D+   + + I+G+ V +PKEY  + ++  + +  Q  +  LK  GA +
Sbjct: 235 VNDSTSAPVDDVDFTSEIGKDIKGLKVALPKEYLGEGVADDVKEAVQNAVETLKSLGAVV 294

Query: 300 VEISLPHTQYALPAYYIISPAEASSNLARYDGVRYGLRV-EGKDILEMYENTRSIGFGQE 358
            E+SLP+T++ +P+YY+I+ +EASSNL+R+DG+RYG    E   + E+Y+ +RS GFG+E
Sbjct: 295 EEVSLPNTKFGIPSYYVIASSEASSNLSRFDGIRYGYHSKEAHSLEELYKMSRSEGFGKE 354

Query: 359 VKHRIMIGTYVLSSRCYDSHYLRARKIRTLIKRDFTEAFEQGVDVILTPTTPTSAFPLGK 418
           VK RI +GT+ LSS  YD++Y +++K+RTLIK DF + FE   DV++ PT PT+AF LG+
Sbjct: 355 VKRRIFLGTFALSSGYYDAYYKKSQKVRTLIKNDFDKVFEN-YDVVVGPTAPTTAFNLGE 413

Query: 419 EENNSGSMGHIYNDVFTVAVNMAGLPAISVPAALCEKKMPLGLQLIGQPFREETLFSVGQ 478
           E ++  +M    ND+ T  VN+AGLP ISVP        P+GLQ IG+PF E+TL+ V  
Sbjct: 414 EIDDPLTMYA--NDLLTTPVNLAGLPGISVPCGQ-SNGRPIGLQFIGKPFDEKTLYRVAY 470

Query: 479 IIEKEAGYFRPH 490
             E +      +
Sbjct: 471 QYETQYNLHDVY 482


>d2gi3a1 c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransferase subunit A {Thermotoga maritima [TaxId: 2336]} Length = 475 Back     information, alignment and structure
>d1mt5a_ c.117.1.1 (A:) Fatty acid amide hydrolase (oleamide hydrolase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 537 Back     information, alignment and structure
>d1m22a_ c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomonas maltophilia [TaxId: 40324]} Length = 490 Back     information, alignment and structure
>d1ocka_ c.117.1.1 (A:) Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]} Length = 412 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target493 aspartyl/glutamyl-tRNA amidotransferase subunit A [Cand
d2f2aa1485 Glutamyl-tRNA(Gln) amidotransferase subunit A {Staphylo 100.0
d2gi3a1475 Glutamyl-tRNA(Gln) amidotransferase subunit A {Thermoto 100.0
d1m22a_490 Peptide amidase Pam {Stenotrophomonas maltophilia [TaxI 100.0
d1mt5a_537 Fatty acid amide hydrolase (oleamide hydrolase) {Rat (R 100.0
d1ocka_412 Malonamidase E2 {Bradyrhizobium japonicum [TaxId: 375]} 100.0
>d2f2aa1 c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransferase subunit A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Amidase signature (AS) enzymes
superfamily: Amidase signature (AS) enzymes
family: Amidase signature (AS) enzymes
domain: Glutamyl-tRNA(Gln) amidotransferase subunit A
species: Staphylococcus aureus [TaxId: 1280]
Probab=100.00  E-value=0  Score=857.19  Aligned_cols=479  Identities=44%  Similarity=0.755  Sum_probs=444.0

Q ss_pred             CCHHCHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECHHHHHHHHHHHHHHHHCCC-CCCCCCCEEHHHHH
Q ss_conf             41345099999999968987899999999999996885558999888999999999999997888-98866121223200
Q gi|254780978|r    3 ELNFMAVSESRDRLRSKDISAVELVDSYIQAIENSNSQMNAYIEVVAQKARAAAEESDKRIINGD-ARDLEGIPIGIKDC   81 (493)
Q Consensus         3 ~~~~~s~~~l~~~~~~~~~t~~~~~~~~~~~i~~~~~~~na~~~~~~~~al~~A~~~d~~~~~~~-~~pL~GiPi~vKD~   81 (493)
                      .|++.||.||++++++|++||+||+++|++||+++|+++|||+++++|+|+++|+++|+++++|+ .+|||||||+|||+
T Consensus         2 ~~~~~s~~~l~~~~~~~~~s~~e~~~~~l~ri~~~~~~lna~~~~~~~~a~~~A~~~d~~~~~~~~~gpL~GiPi~vKD~   81 (485)
T d2f2aa1           2 SIRYESVENLLTLIKDKKIKPSDVVKDIYDAIEETDPTIKSFLALDKENAIKKAQELDELQAKDQMDGKLFGIPMGIKDN   81 (485)
T ss_dssp             CSTTCCHHHHHHHHHTTSSCHHHHHHHHHHHHHHHHHHHCCEEEECHHHHHHHHHHHHHHHHTTCCCSTTTTCEEEEETT
T ss_pred             CCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCEEEEECHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECC
T ss_conf             98578999999999859998999999999999986997419999499999999999999997799999817686988856


Q ss_pred             CCCCCCCCCCCHHHHHCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             00487855330376515754443210468887400001110000013566532222343356676765665544555444
Q gi|254780978|r   82 FATKGIHTQACSHILDGFRPHYESTVTQKLWDNGAVMLGKLNMDEFAMGSSNETSYYGPVISPWRSMDSTDKFTPGGSSG  161 (493)
Q Consensus        82 ~~v~g~~tt~G~~~~~~~~~~~da~~V~~L~~aGAi~~gkt~~~e~~~~~~~~n~~~G~t~NP~~~~~~~~~~~~GGSs~  161 (493)
                      |+|+|++||+|+.+++++++.+|+++|++|+++|||++|||||+||+++..|.|.+||+|+||||+.     ++||||||
T Consensus        82 ~~v~g~~tt~Gs~~~~~~~~~~d~~~v~~l~~~Gai~~gkt~~~e~~~~~~~~n~~~g~~~NP~~~~-----~~~GGSSg  156 (485)
T d2f2aa1          82 IITNGLETTCASKMLEGFVPIYESTVMEKLHKENAVLIGKLNMDEFAMGGSTETSYFKKTVNPFDHK-----AVPGGSSG  156 (485)
T ss_dssp             BCBTTBCCCTTCGGGTTCCCSSCCHHHHHHHHTTCEEEEEECCSGGGCCSSSTTCSSCCCCBTTBTT-----BCCCSSSH
T ss_pred             CCCCCCCCCCCCHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCC-----CCCCCCCC
T ss_conf             0668972577584330687542101001100356530022223332143456675446767887765-----55677665


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCC
Q ss_conf             54210012334322432112111130554111011545410001123322221212354432202344665302246743
Q gi|254780978|r  162 GSSAAVAGFLCAASIGTDTGGSIRQPASFTGTVGIKPTYGRCSRLGIISFAPSLDQAGIITRTVRDSAILLKAIAGYDEC  241 (493)
Q Consensus       162 G~a~ava~~~~~~aiGtD~gGSiR~PAa~cGi~GlKPT~G~is~~G~~~~~~~ld~~Gpmarsv~D~~~~l~vl~g~d~~  241 (493)
                      |+|++||+|++|+|||||||||||+||+||||||||||+||||+.|++|+++++||+|||||+|+|+++++++|+++++.
T Consensus       157 GsaaavA~g~~~~alGtDt~GSiR~PAa~~Gl~G~kPt~G~is~~g~~~~~~~~d~~Gpmar~v~D~~~ll~~~~g~~~~  236 (485)
T d2f2aa1         157 GSAAAVAAGLVPLSLGSDTGGSIRQPAAYCGVVGMKPTYGRVSRFGLVAFASSLDQIGPLTRNVKDNAIVLEAISGADVN  236 (485)
T ss_dssp             HHHHHHHTTSCSCEEEECSSSTTHHHHHHTTCEEEECCTTSBCCTTBCCSCTTTCCEEEEESSHHHHHHHHHHHBSCBTT
T ss_pred             CCHHHHHHCCCCEEEECCCCCHHHHHHHHHCCEEECCCCCCCCCCCCCCCCCCCCEECCCCCCHHHHHHHHHHCCCCCCC
T ss_conf             42266775467657751788422222798595455489997789998887666783251449899999998610035655


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             10111124653101244432222223434444333201456556656654332211013568872145555444445678
Q gi|254780978|r  242 DATCVNLPVPDYERALDQSIQGMTVGIPKEYRLDYLSPTIDKTWQQGISWLKDAGAKIVEISLPHTQYALPAYYIISPAE  321 (493)
Q Consensus       242 D~~~~~~~~~~~~~~~~~~~k~lrIgi~~~~~~~~~~~~v~~~~~~ai~~L~~~G~~vvev~~p~~~~~~~~~~~~~~~e  321 (493)
                      |+.+.+.+..++...+..+++++|||++.+++...++++++++++++++.|+++|++|+|+++|......+.++.+...+
T Consensus       237 d~~~~~~~~~~~~~~~~~~~~~lrig~~~~~~~~~~~~~i~~a~~~a~~~L~~~G~~v~ev~lp~~~~~~~~~~~~~~~e  316 (485)
T d2f2aa1         237 DSTSAPVDDVDFTSEIGKDIKGLKVALPKEYLGEGVADDVKEAVQNAVETLKSLGAVVEEVSLPNTKFGIPSYYVIASSE  316 (485)
T ss_dssp             BTTSCCCCCCCCSTTTTCCCTTCEEEEEGGGGSTTSCHHHHHHHHHHHHHHHHTTCEEEEECCTTGGGHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCHHHHHCCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             44567888645355625786687899973021476898999999999999997899999937986145678899999999


Q ss_pred             HHHHHHHHHHHHCCCCCC-CCCHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             988877653331031002-4310245543210000146666653023333320001223345789999999999998639
Q gi|254780978|r  322 ASSNLARYDGVRYGLRVE-GKDILEMYENTRSIGFGQEVKHRIMIGTYVLSSRCYDSHYLRARKIRTLIKRDFTEAFEQG  400 (493)
Q Consensus       322 ~~~~l~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~a~~~r~~~~~~~~~~~~~~  400 (493)
                      +..++..|++..+..... ..++.+++...+...++++++.++..+.......+.+..+.++++.+..+++.+.++|. +
T Consensus       317 ~~~~l~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~f~-~  395 (485)
T d2f2aa1         317 ASSNLSRFDGIRYGYHSKEAHSLEELYKMSRSEGFGKEVKRRIFLGTFALSSGYYDAYYKKSQKVRTLIKNDFDKVFE-N  395 (485)
T ss_dssp             HHHHTTTCSSSSSSCCCSSCCSHHHHHHHHHHHHSCHHHHHHHHHHHHHHSTTTTTTTHHHHHHHHHHHHHHHHHHTT-T
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHC-C
T ss_conf             998898744233110123314799999874342038899999986456532235899999999999887778999874-6


Q ss_pred             CCEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCEEEEEEECCCCCHHHHHHHHHHH
Q ss_conf             98999179989998776334673257887643789999987898376840355999837999951899879999999999
Q gi|254780978|r  401 VDVILTPTTPTSAFPLGKEENNSGSMGHIYNDVFTVAVNMAGLPAISVPAALCEKKMPLGLQLIGQPFREETLFSVGQII  480 (493)
Q Consensus       401 ~D~lI~Pt~~~~a~~~~~~~~~~~~~~~~~~~~~t~~~N~~G~PaisiP~G~~~~GLPvGiQiig~~~~D~~lL~~a~~~  480 (493)
                      +|+||+||++.+|+++++....  ....+....||.++|++|+|+++||+|++ +|||+||||||++|+|++||++|++|
T Consensus       396 ~D~ll~Pt~~~~a~~~~~~~~~--~~~~~~~~~~t~~~Nl~G~PaisvP~G~~-dGlPvGlQiig~~~~D~~LL~~A~~~  472 (485)
T d2f2aa1         396 YDVVVGPTAPTTAFNLGEEIDD--PLTMYANDLLTTPVNLAGLPGISVPCGQS-NGRPIGLQFIGKPFDEKTLYRVAYQY  472 (485)
T ss_dssp             CSEEEEESSSSSCCBTTTSTTC--HHHHHGGGTTTHHHHHHTCCEEEEEEEEE-TTEEEEEEEECSTTCHHHHHHHHHHH
T ss_pred             CCEEEECCCCCCCCCCCCCCCC--HHHHHHHHHHHHHHHHHCCCEEEEECCCC-CCCCEEEEEECCCCCHHHHHHHHHHH
T ss_conf             9999957978777886544477--88876400899999997899299978789-99887688889999999999999999


Q ss_pred             HHHHCCCCCC
Q ss_conf             9992577978
Q gi|254780978|r  481 EKEAGYFRPH  490 (493)
Q Consensus       481 E~~~~~~~pp  490 (493)
                      |++++|++-+
T Consensus       473 E~~~~~~~~~  482 (485)
T d2f2aa1         473 ETQYNLHDVY  482 (485)
T ss_dssp             HHHSCCTTTG
T ss_pred             HHHCCCCCCC
T ss_conf             9607977479



>d2gi3a1 c.117.1.1 (A:1-475) Glutamyl-tRNA(Gln) amidotransferase subunit A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m22a_ c.117.1.1 (A:) Peptide amidase Pam {Stenotrophomonas maltophilia [TaxId: 40324]} Back     information, alignment and structure