254780979

254780979

aspartyl/glutamyl-tRNA amidotransferase subunit B

GeneID in NCBI database:8210001Locus tag:CLIBASIA_04400
Protein GI in NCBI database:254780979Protein Accession:YP_003065392.1
Gene range:+(976267, 977769)Protein Length:500aa
Gene description:aspartyl/glutamyl-tRNA amidotransferase subunit B
COG prediction:[J] Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit (PET112 homolog)
KEGG prediction:gatB; aspartyl/glutamyl-tRNA amidotransferase subunit B (EC:6.3.5.-); K02434 aspartyl-tRNA(Asn)/glutamyl-tRNA (Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
SEED prediction:Aspartyl-tRNA(Asn) amidotransferase subunit B (EC 6.3.5.6) or Glutamyl-tRNA(Gln) amidotransferase subunit B (EC 6.3.5.7)
Pathway involved in KEGG:Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:tRNA aminoacylation, Glu and Gln;
tRNA aminoacylation, Asp and Asn
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500
MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLGIKE
ccccccccccHHHHccccccccEEEEEEEEEEEEcccccccccccccccccccccccHHccccccccccccHHHHHHHHHHHHHHccEEccEEEEccccccccccccccHHHHHccccccccEEEEEEcccccccccEEEEEEEEEEccHHccHHHHcccccEEEEEEccccccEEEEEcccccccHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEEEccccccccEEEEEccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccEEEccccccccccccccccccccEEEcHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHccccccccHHHHHHHHHHHHHHcHHHHHHHHccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccc
cccccccccccccccccccccEEEEEEEEEEEEEcccccccccccccccccccccccHHcccccccccHHcHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEccccccccEEEEEEEcccccccccEEEEEEEEEEccccccccHccccccccEEEcccccccEEEEccccccccHHHHHHHHHHHHHHHHHHccccccccccccEcccEEEEcccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEcccccccEEEEEEcccccccccccccccccEEEcHHHHHHHHHHcccccHHHHHHHHHHccccHHcHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHccccEEccHHHHHHHHHHHHHHcHHHHHHHcccccHHHHEHHHHHHHccccccHHHHHHHHHHHccccc
mvsldthvarsesltsgttgdwEVVIGIEVHAQLSVVSKLFsgasvnfgaepntqvsffdaampgmlpilngRCVQQAVMTGLGLNAHINKYSVFArknyfypdlpqgyqisqhdkpivgegkvsvsigpdksgqfrtiEVGIERIHLEqdagksihdqysavscidlnrSGVALMEIVtkpdmrssLEAKAFLTKLRSILRYLGtcdgnmeegsmradvnvsvcrpgeawgtrcevknvnsirFLGLAIEYEARRQIAILedgghirqetrlfdpsknetrslrtkedaldyryfsepdllpleiDEDFIRAIKKQipelpdakreRFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGVLnrsgksiedtpispnqlGELIDLIIDGTISGKIAKDIFNILwekggtpkEIVEELGLRQVTDLSAIEKVVDEVINsnpnnvariatkpnlVSWFVGQVMkntggkanpSIVQKMLKEKLGIKE
mvsldthvarsesltsgttgdwEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSvsigpdksgqfrTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIvtkpdmrssLEAKAFLTKLRSILRYLGTCDGnmeegsmradvnvSVCRPgeawgtrcevknvnSIRFLGLAIEYEARRQIAILedgghirqetrlfdpsknetrslrtkedaldyryfsepdllplEIDEDFIRAIKKqipelpdakrERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGVLNRSGksiedtpispnqLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVinsnpnnvariatkpnLVSWFVGQVMkntggkanpsivQKMLKEKLGIKE
MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLGIKE
***************SGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG***
****************GTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLGIKE
***LDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLGIKE
MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLGIKE
MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNVNSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLGIKE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target500 aspartyl/glutamyl-tRNA amidotransferase subunit B [Cand
315122519499 aspartyl/glutamyl-tRNA amidotransferase subunit B [Cand 1 0.0
150396169500 aspartyl/glutamyl-tRNA amidotransferase subunit B [Sino 1 0.0
15965067516 aspartyl/glutamyl-tRNA amidotransferase subunit B [Sino 1 0.0
307301138500 glutamyl-tRNA(Gln) amidotransferase, B subunit [Sinorhi 1 0.0
227821669500 aspartyl/glutamyl-tRNA amidotransferase subunit B [Sino 1 0.0
163759356501 aspartyl/glutamyl-tRNA amidotransferase subunit B [Hoef 1 0.0
190891550500 aspartyl/glutamyl-tRNA amidotransferase, B subunit [Rhi 1 0.0
116251842500 aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhiz 1 0.0
86357488500 aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhiz 1 0.0
327193635500 aspartyl/glutamyl-tRNA amidotransferase protein, B subu 1 0.0
>gi|315122519|ref|YP_004063008.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 499 Back     alignment and organism information
 Score =  912 bits (2356), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/499 (87%), Positives = 471/499 (94%)

Query: 1   MVSLDTHVARSESLTSGTTGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFD 60
           MVS+D HV+ S S  SG TGDWEVVIG+EVHAQLSV SKLFSGASV+FGA PNTQVSFFD
Sbjct: 1   MVSVDNHVSPSGSFISGATGDWEVVIGMEVHAQLSVRSKLFSGASVDFGAAPNTQVSFFD 60

Query: 61  AAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVG 120
           AAMPGMLPILN  CV+QAVMTGL  NAHIN+YSVFARKNYFYPDLPQGYQISQH++PIVG
Sbjct: 61  AAMPGMLPILNSDCVRQAVMTGLSFNAHINQYSVFARKNYFYPDLPQGYQISQHNEPIVG 120

Query: 121 EGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT 180
           EGKVSVS+GPDKSGQFRTIEVGIERIHLEQDAGKSIHDQY++VSCIDLNRSG+ALMEIVT
Sbjct: 121 EGKVSVSLGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYASVSCIDLNRSGIALMEIVT 180

Query: 181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGEAWGTRCEVKNV 240
            PDMRSSLEAKAFLTKLR+ILRYLGTCDGNMEEGSMRADVN+SVCRPG+++GTRCEVKNV
Sbjct: 181 NPDMRSSLEAKAFLTKLRTILRYLGTCDGNMEEGSMRADVNISVCRPGDSFGTRCEVKNV 240

Query: 241 NSIRFLGLAIEYEARRQIAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPD 300
           NSIRFLG AIEYEARRQIAILEDGGHI QETRLFD SKNETRSLRTKEDA DYRYF++PD
Sbjct: 241 NSIRFLGQAIEYEARRQIAILEDGGHIIQETRLFDHSKNETRSLRTKEDAHDYRYFADPD 300

Query: 301 LLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVNR 360
           LLPLEIDEDFIR IKKQ+PELPDAKRERFI EFGISLYDASVLVSDKSIADYFEKLAVNR
Sbjct: 301 LLPLEIDEDFIREIKKQLPELPDAKRERFITEFGISLYDASVLVSDKSIADYFEKLAVNR 360

Query: 361 DKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWE 420
           DKKI ANWVINDLLG LN+S K+IEDTPISP+QLGELIDLIIDGTISGKIAKDIFNILWE
Sbjct: 361 DKKIAANWVINDLLGGLNKSAKNIEDTPISPDQLGELIDLIIDGTISGKIAKDIFNILWE 420

Query: 421 KGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIATKPNLVSWFVGQVMKNTG 480
           KGG PK+IV++LGLRQVT++SAIE  VDEVINSNP+NVAR+A KPNLV WFVGQVMKNTG
Sbjct: 421 KGGHPKQIVDDLGLRQVTNISAIELAVDEVINSNPSNVARVAIKPNLVGWFVGQVMKNTG 480

Query: 481 GKANPSIVQKMLKEKLGIK 499
           GKANP IVQK++K+KLGIK
Sbjct: 481 GKANPGIVQKIVKDKLGIK 499


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150396169|ref|YP_001326636.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Sinorhizobium medicae WSM419] Length = 500 Back     alignment and organism information
>gi|15965067|ref|NP_385420.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Sinorhizobium meliloti 1021] Length = 516 Back     alignment and organism information
>gi|307301138|ref|ZP_07580907.1| glutamyl-tRNA(Gln) amidotransferase, B subunit [Sinorhizobium meliloti BL225C] Length = 500 Back     alignment and organism information
>gi|227821669|ref|YP_002825639.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Sinorhizobium fredii NGR234] Length = 500 Back     alignment and organism information
>gi|163759356|ref|ZP_02166442.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Hoeflea phototrophica DFL-43] Length = 501 Back     alignment and organism information
>gi|190891550|ref|YP_001978092.1| aspartyl/glutamyl-tRNA amidotransferase, B subunit [Rhizobium etli CIAT 652] Length = 500 Back     alignment and organism information
>gi|116251842|ref|YP_767680.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhizobium leguminosarum bv. viciae 3841] Length = 500 Back     alignment and organism information
>gi|86357488|ref|YP_469380.1| aspartyl/glutamyl-tRNA amidotransferase subunit B [Rhizobium etli CFN 42] Length = 500 Back     alignment and organism information
>gi|327193635|gb|EGE60518.1| aspartyl/glutamyl-tRNA amidotransferase protein, B subunit [Rhizobium etli CNPAF512] Length = 500 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target500 aspartyl/glutamyl-tRNA amidotransferase subunit B [Cand
PRK05477474 PRK05477, gatB, aspartyl/glutamyl-tRNA amidotransferase 0.0
TIGR00133478 TIGR00133, gatB, glutamyl-tRNA(Gln) and/or aspartyl-tRN 1e-150
KOG2438505 KOG2438, KOG2438, KOG2438, Glutamyl-tRNA amidotransfera 1e-140
PLN02751544 PLN02751, PLN02751, glutamyl-tRNA(Gln) amidotransferase 1e-138
COG0064483 COG0064, GatB, Asp-tRNAAsn/Glu-tRNAGln amidotransferase 0.0
pfam02934287 pfam02934, GatB_N, GatB/GatE catalytic domain 1e-136
smart00845147 smart00845, GatB_Yqey, GatB domain 1e-48
pfam02637148 pfam02637, GatB_Yqey, GatB domain 3e-47
PRK14703771 PRK14703, PRK14703, glutaminyl-tRNA synthetase/YqeY dom 1e-40
PRK04028630 PRK04028, PRK04028, glutamyl-tRNA(Gln) amidotransferase 2e-22
COG2511631 COG2511, GatE, Archaeal Glu-tRNAGln amidotransferase su 7e-23
TIGR00134620 TIGR00134, gatE_arch, glutamyl-tRNA(Gln) amidotransfera 2e-14
COG2511 631 COG2511, GatE, Archaeal Glu-tRNAGln amidotransferase su 3e-13
TIGR00134 620 TIGR00134, gatE_arch, glutamyl-tRNA(Gln) amidotransfera 2e-12
PRK04028 630 PRK04028, PRK04028, glutamyl-tRNA(Gln) amidotransferase 5e-12
>gnl|CDD|180111 PRK05477, gatB, aspartyl/glutamyl-tRNA amidotransferase subunit B; Validated Back     alignment and domain information
>gnl|CDD|161729 TIGR00133, gatB, glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B subunit Back     alignment and domain information
>gnl|CDD|37649 KOG2438, KOG2438, KOG2438, Glutamyl-tRNA amidotransferase subunit B [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178352 PLN02751, PLN02751, glutamyl-tRNA(Gln) amidotransferase Back     alignment and domain information
>gnl|CDD|30413 COG0064, GatB, Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit (PET112 homolog) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|145865 pfam02934, GatB_N, GatB/GatE catalytic domain Back     alignment and domain information
>gnl|CDD|129078 smart00845, GatB_Yqey, GatB domain Back     alignment and domain information
>gnl|CDD|145673 pfam02637, GatB_Yqey, GatB domain Back     alignment and domain information
>gnl|CDD|184797 PRK14703, PRK14703, glutaminyl-tRNA synthetase/YqeY domain fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|179718 PRK04028, PRK04028, glutamyl-tRNA(Gln) amidotransferase subunit E; Validated Back     alignment and domain information
>gnl|CDD|32581 COG2511, GatE, Archaeal Glu-tRNAGln amidotransferase subunit E (contains GAD domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129240 TIGR00134, gatE_arch, glutamyl-tRNA(Gln) amidotransferase, subunit E Back     alignment and domain information
>gnl|CDD|32581 COG2511, GatE, Archaeal Glu-tRNAGln amidotransferase subunit E (contains GAD domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129240 TIGR00134, gatE_arch, glutamyl-tRNA(Gln) amidotransferase, subunit E Back     alignment and domain information
>gnl|CDD|179718 PRK04028, PRK04028, glutamyl-tRNA(Gln) amidotransferase subunit E; Validated Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 500 aspartyl/glutamyl-tRNA amidotransferase subunit B [Cand
PRK05477479 gatB aspartyl/glutamyl-tRNA amidotransferase subunit B; 100.0
COG0064483 GatB Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit 100.0
PRK04028631 glutamyl-tRNA(Gln) amidotransferase subunit E; Validate 100.0
KOG2438505 consensus 100.0
TIGR00133523 gatB glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amido 100.0
COG2511631 GatE Archaeal Glu-tRNAGln amidotransferase subunit E (c 100.0
TIGR00134631 gatE_arch glutamyl-tRNA(Gln) amidotransferase, subunit 100.0
pfam02934287 GatB_N GatB/GatE catalytic domain. This domain is found 100.0
pfam02637148 GatB_Yqey GatB domain. This domain is found in GatB. It 100.0
smart00845147 GatB_Yqey GatB domain. This domain is found in GatB and 100.0
pfam09424143 YqeY Yqey-like protein. The function of this domain fou 97.81
pfam0116269 consensus 99.84
pfam04558164 tRNA_synt_1c_R1 Glutaminyl-tRNA synthetase, non-specifi 97.25
KOG1148 764 consensus 96.79
COG1610148 Uncharacterized conserved protein [Function unknown] 96.05
>PRK05477 gatB aspartyl/glutamyl-tRNA amidotransferase subunit B; Validated Back     alignment and domain information
>COG0064 GatB Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit (PET112 homolog) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04028 glutamyl-tRNA(Gln) amidotransferase subunit E; Validated Back     alignment and domain information
>KOG2438 consensus Back     alignment and domain information
>TIGR00133 gatB glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, B subunit; InterPro: IPR004413 In many species, Gln-tRNA ligase is missing Back     alignment and domain information
>COG2511 GatE Archaeal Glu-tRNAGln amidotransferase subunit E (contains GAD domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00134 gatE_arch glutamyl-tRNA(Gln) amidotransferase, subunit E; InterPro: IPR004414 The aspartyl-tRNA(Asn) amidotransferase, B subunit or designated here gatB_rel, is found only in the archaea Back     alignment and domain information
>pfam02934 GatB_N GatB/GatE catalytic domain Back     alignment and domain information
>pfam02637 GatB_Yqey GatB domain Back     alignment and domain information
>smart00845 GatB_Yqey GatB domain Back     alignment and domain information
>pfam09424 YqeY Yqey-like protein Back     alignment and domain information
>pfam01162 consensus Back     alignment and domain information
>pfam04558 tRNA_synt_1c_R1 Glutaminyl-tRNA synthetase, non-specific RNA binding region part 1 Back     alignment and domain information
>KOG1148 consensus Back     alignment and domain information
>COG1610 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target500 aspartyl/glutamyl-tRNA amidotransferase subunit B [Cand
3h0l_B478 Structure Of Trna-Dependent Amidotransferase Gatcab 1e-152
3al0_B482 Crystal Structure Of The Glutamine Transamidosome F 1e-145
2df4_B483 Structure Of Trna-Dependent Amidotransferase Gatcab 1e-142
3kfu_F466 Crystal Structure Of The Transamidosome Length = 46 1e-106
2d6f_C 619 Crystal Structure Of Glu-Trna(Gln) Amidotransferase 2e-36
1zq1_C 633 Structure Of Gatde Trna-Dependent Amidotransferase 6e-28
2d6f_C619 Crystal Structure Of Glu-Trna(Gln) Amidotransferase 6e-27
1zq1_C633 Structure Of Gatde Trna-Dependent Amidotransferase 2e-25
2hz7_A851 Crystal Structure Of The Glutaminyl-Trna Synthetase 2e-17
gi|254574884|pdb|3H0L|B Chain B, Structure Of Trna-Dependent Amidotransferase Gatcab From Aquifex Aeolicus Length = 478 Back     alignment and structure
 Score =  545 bits (1403), Expect = e-152,   Method: Composition-based stats.
 Identities = 226/480 (47%), Positives = 329/480 (68%), Gaps = 10/480 (2%)

Query: 19  TGDWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQA 78
              +E VIG+E+H Q+   +K+F G  V FGAEPNT V      MPG LPI+N R V+ A
Sbjct: 2   NEKYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPVCLGMPGALPIVNKRAVEYA 61

Query: 79  VMTGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRT 138
           +   L LN  +++ SVFARK+YFYPDLP+GYQISQ++KP+   G V +++   +      
Sbjct: 62  IRASLALNCEVHEESVFARKHYFYPDLPKGYQISQYEKPLATNGWVELNLPNGEK----- 116

Query: 139 IEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLR 198
            +V I R+H+E+DAGK+IH+     + +DLNR+G  LMEIVT+PD+R+  EA+ FL KLR
Sbjct: 117 KKVRIRRLHIEEDAGKNIHEGD--KTLVDLNRAGTPLMEIVTEPDIRTPEEARLFLEKLR 174

Query: 199 SILRYLGTCDGNMEEGSMRADVNVSVCRP-GEAWGTRCEVKNVNSIRFLGLAIEYEARRQ 257
           +I+RY G    +ME+G +R D+NVS+     + +GTR E+KNVNS RF+  A+EYE  RQ
Sbjct: 175 NIMRYAGVSKADMEKGQLRCDINVSIRPKGSKEFGTRVEIKNVNSFRFVQKALEYEIERQ 234

Query: 258 IAILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQ 317
           I ++E+GG + QETR FDP   +T  +RTKE+A DYRYF +PDL+PL++ +++I  IKK 
Sbjct: 235 INVVEEGGEVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLKVKKEWIEEIKKN 294

Query: 318 IPELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEKLAVN-RDKKIVANWVINDLLGV 376
           +PELPD + ER I E+G+S Y+A +LV+ K + D+FE+   + ++ K + NW+INDLLG+
Sbjct: 295 MPELPDQRFERLIKEYGLSEYEAGILVNHKEVGDFFEEAVRHFKEPKGIVNWLINDLLGL 354

Query: 377 LNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQ 436
           L   G SIE++P+ P  L EL+ LI +  IS KI K++   + E G TP +IVEE GL+Q
Sbjct: 355 LRDKGISIEESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKTPSQIVEEKGLKQ 414

Query: 437 VTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEK 495
           +TD + I+++V ++   +P  V R+   +  L+ +FVGQVM+ T GKANP +V K+++E 
Sbjct: 415 ITDENQIKELVKKIFEKHPKEVERLKQGEEKLIGFFVGQVMRETRGKANPQVVNKVIREL 474


gi|307776356|pdb|3AL0|B Chain B, Crystal Structure Of The Glutamine Transamidosome From Thermotoga Maritima In The Glutamylation State. Length = 482 Back     alignment and structure
>gi|112490472|pdb|2DF4|B Chain B, Structure Of Trna-Dependent Amidotransferase Gatcab Complexed With Mn2+ Length = 483 Back     alignment and structure
>gi|304445801|pdb|3KFU|F Chain F, Crystal Structure Of The Transamidosome Length = 466 Back     alignment and structure
gi|112490414|pdb|2D6F|C Chain C, Crystal Structure Of Glu-Trna(Gln) Amidotransferase In The Complex With Trna(Gln) Length = 619 Back     alignment and structure
gi|82407623|pdb|1ZQ1|C Chain C, Structure Of Gatde Trna-Dependent Amidotransferase From Pyrococcus Abyssi Length = 633 Back     alignment and structure
gi|112490414|pdb|2D6F|C Chain C, Crystal Structure Of Glu-Trna(Gln) Amidotransferase In The Complex With Trna(Gln) Length = 619 Back     alignment and structure
gi|82407623|pdb|1ZQ1|C Chain C, Structure Of Gatde Trna-Dependent Amidotransferase From Pyrococcus Abyssi Length = 633 Back     alignment and structure
>gi|146386870|pdb|2HZ7|A Chain A, Crystal Structure Of The Glutaminyl-Trna Synthetase From Deinococcus Radiodurans Length = 851 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target500 aspartyl/glutamyl-tRNA amidotransferase subunit B [Cand
3h0l_B478 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subuni 1e-169
3al0_B482 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase; prote 1e-160
3ip4_B483 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subuni 1e-149
3kfu_F466 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase; ASPRS 1e-155
1zq1_C 633 Glutamyl-tRNA(Gln) amidotransferase subunit E; X-RAY, 3 1e-68
2d6f_C 619 Glutamyl-tRNA(Gln) amidotransferase subunit E; ligase, 2e-63
1zq1_C633 Glutamyl-tRNA(Gln) amidotransferase subunit E; X-RAY, 3 4e-63
2d6f_C619 Glutamyl-tRNA(Gln) amidotransferase subunit E; ligase, 2e-65
2hz7_A851 Glutaminyl-tRNA synthetase; rossmann fold, GLNRS core, 3e-67
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carr 0.001
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threonine pr 0.003
>3h0l_B Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_B 3h0r_B* Length = 478 Back     alignment and structure
 Score =  589 bits (1521), Expect = e-169
 Identities = 227/479 (47%), Positives = 331/479 (69%), Gaps = 10/479 (2%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
            +E VIG+E+H Q+   +K+F G  V FGAEPNT V      MPG LPI+N R V+ A+ 
Sbjct: 4   KYEAVIGLEIHVQMDTKTKMFCGCKVEFGAEPNTNVCPVCLGMPGALPIVNKRAVEYAIR 63

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
             L LN  +++ SVFARK+YFYPDLP+GYQISQ++KP+   G V +++   +       +
Sbjct: 64  ASLALNCEVHEESVFARKHYFYPDLPKGYQISQYEKPLATNGWVELNLPNGEKK-----K 118

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           V I R+H+E+DAGK+IH+     + +DLNR+G  LMEIVT+PD+R+  EA+ FL KLR+I
Sbjct: 119 VRIRRLHIEEDAGKNIHE--GDKTLVDLNRAGTPLMEIVTEPDIRTPEEARLFLEKLRNI 176

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           +RY G    +ME+G +R D+NVS+   G + +GTR E+KNVNS RF+  A+EYE  RQI 
Sbjct: 177 MRYAGVSKADMEKGQLRCDINVSIRPKGSKEFGTRVEIKNVNSFRFVQKALEYEIERQIN 236

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
           ++E+GG + QETR FDP   +T  +RTKE+A DYRYF +PDL+PL++ +++I  IKK +P
Sbjct: 237 VVEEGGEVVQETRTFDPQTGKTYPMRTKEEAEDYRYFPDPDLVPLKVKKEWIEEIKKNMP 296

Query: 320 ELPDAKRERFIGEFGISLYDASVLVSDKSIADYFEK-LAVNRDKKIVANWVINDLLGVLN 378
           ELPD + ER I E+G+S Y+A +LV+ K + D+FE+ +   ++ K + NW+INDLLG+L 
Sbjct: 297 ELPDQRFERLIKEYGLSEYEAGILVNHKEVGDFFEEAVRHFKEPKGIVNWLINDLLGLLR 356

Query: 379 RSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNILWEKGGTPKEIVEELGLRQVT 438
             G SIE++P+ P  L EL+ LI +  IS KI K++   + E G TP +IVEE GL+Q+T
Sbjct: 357 DKGISIEESPVKPEHLAELVKLIKEKVISTKIGKEVIKEMVETGKTPSQIVEEKGLKQIT 416

Query: 439 DLSAIEKVVDEVINSNPNNVARI-ATKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKL 496
           D + I+++V ++   +P  V R+   +  L+ +FVGQVM+ T GKANP +V K+++E +
Sbjct: 417 DENQIKELVKKIFEKHPKEVERLKQGEEKLIGFFVGQVMRETRGKANPQVVNKVIRELV 475


>3al0_B Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase; protein-RNA complex, ligase-RNA complex; HET: GSU; 3.37A {Thermotoga maritima} Length = 482 Back     alignment and structure
>3ip4_B Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; multi protein complex, ligase, ATP-binding, nucleotide- binding; 1.90A {Staphylococcus aureus subsp} PDB: 2df4_B 2dqn_B* 2g5h_B 2g5i_B* 2f2a_B Length = 483 Back     alignment and structure
>3kfu_F Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase; ASPRS, gatcab, ATP-binding, aminoacyl-tRNA synthetase, ligas nucleotide-binding, protein biosynthesis, ligase-RNA comple; HET: H2U 5MU PSU; 3.00A {Thermus thermophilus} Length = 466 Back     alignment and structure
>1zq1_C Glutamyl-tRNA(Gln) amidotransferase subunit E; X-RAY, 3D structure, asparaginase 1 family, GATD subfamily, lyase; 3.00A {Pyrococcus abyssi} SCOP: a.182.1.2 d.74.4.1 d.128.1.5 Length = 633 Back     alignment and structure
>2d6f_C Glutamyl-tRNA(Gln) amidotransferase subunit E; ligase, ligase/RNA complex; 3.15A {Methanothermobacterthermautotrophicus} SCOP: a.182.1.2 d.74.4.1 d.128.1.5 Length = 619 Back     alignment and structure
>1zq1_C Glutamyl-tRNA(Gln) amidotransferase subunit E; X-RAY, 3D structure, asparaginase 1 family, GATD subfamily, lyase; 3.00A {Pyrococcus abyssi} SCOP: a.182.1.2 d.74.4.1 d.128.1.5 Length = 633 Back     alignment and structure
>2d6f_C Glutamyl-tRNA(Gln) amidotransferase subunit E; ligase, ligase/RNA complex; 3.15A {Methanothermobacterthermautotrophicus} SCOP: a.182.1.2 d.74.4.1 d.128.1.5 Length = 619 Back     alignment and structure
>2hz7_A Glutaminyl-tRNA synthetase; rossmann fold, GLNRS core, class I aminoacyl-tRNA synthetase, ligase; 2.30A {Deinococcus radiodurans} Length = 851 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor; HET: BK3; 1.98A {Cryptosporidium parvum iowa II} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target500 aspartyl/glutamyl-tRNA amidotransferase subunit B [Cand
3ip4_B483 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subuni 100.0
3h0l_B478 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subuni 100.0
3al0_B482 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase; prote 100.0
2d6f_C619 Glutamyl-tRNA(Gln) amidotransferase subunit E; ligase, 100.0
1zq1_C633 Glutamyl-tRNA(Gln) amidotransferase subunit E; X-RAY, 3 100.0
3kfu_F466 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase; ASPRS 100.0
2hz7_A851 Glutaminyl-tRNA synthetase; rossmann fold, GLNRS core, 100.0
1ng6_A148 Hypothetical protein YQEY; structural genomics, domain 98.01
>3ip4_B Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; multi protein complex, ligase, ATP-binding, nucleotide- binding; 1.90A {Staphylococcus aureus subsp} PDB: 2df4_B 2dqn_B* 2g5h_B 2g5i_B* 2f2a_B Back     alignment and structure
Probab=100.00  E-value=0  Score=1328.43  Aligned_cols=471  Identities=44%  Similarity=0.758  Sum_probs=458.3

Q ss_pred             CCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCEECCCCEEECCCE
Q ss_conf             80338989997888689865558842468987652061302689888737899999999987782976244201311321
Q gi|254780979|r   21 DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNY  100 (500)
Q Consensus        21 ~~e~vIGLEiH~qL~t~tKlFc~c~~~~~~~pNt~v~~~~~g~PG~lP~lN~~av~~ai~~~~al~~~i~~~~~fdRK~Y  100 (500)
                      +||+||||||||||+|+|||||+|+++|+++|||+|||||+|+|||||+||++||++|+++|+||||+|+++++||||||
T Consensus         2 ~~~~viGlEiH~qL~t~~KlF~~~~~~~~~~pN~~v~~~~~~~pG~lP~lN~~av~~a~~~~~al~~~i~~~~~fdRK~y   81 (483)
T 3ip4_B            2 HFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNY   81 (483)
T ss_dssp             CEEEEEEEEEEEECCCSBCSSSSSBSSCCSSTTCSCCTTTTTCTTCCCCCBHHHHHHHHHHHHHTTCEECSEECCEEEEC
T ss_pred             CCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCHHCEECCCCC
T ss_conf             96158899998882899676789998678998767686122699987656999999999999984985341024344444


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCEEEEEEEEEEEEEECCCCCCCCCCCCCEEEEECCCCCCEEEEEE
Q ss_conf             23767888201445442015338999706777774103798423666520231001156787148866157861257630
Q gi|254780979|r  101 FYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT  180 (500)
Q Consensus       101 fYpDlpkgyQiTQ~~~Pi~~~G~l~~~~~~~~~~~~~~~~v~I~~i~lEED~gk~~h~~~~~~slvD~NRaGvPLiEIVT  180 (500)
                      |||||||||||||++.|||.||+|++.++..      .++|+|.||||||||||++|+  +++|++||||||+|||||||
T Consensus        82 fypdlp~gyQiTq~~~pi~~~G~i~~~~~~~------~k~i~I~~i~lEEDagk~~~~--~~~~~~D~NR~GvPLiEIvT  153 (483)
T 3ip4_B           82 FYPDNPKAYQISQFDQPIGENGYIDIEVDGE------TKRIGITRLHMEEDAGKSTHK--GEYSLVDLNRQGTPLIEIVS  153 (483)
T ss_dssp             CBTTBTTSEEEECSSSCSEEEEEEEECSSSS------CEEEEEEEEEEEECCCEEEEE--TTEEEEECTTTTCEEEEEEE
T ss_pred             CCCCCCHHHHHHCCCCCCCCCEEEEEECCCC------CEEECCCEEEEEECCCCCCCC--CCCEEEECCCCCCCEEEEEC
T ss_conf             4898981354642766678750780112786------128650248872135755568--99607843578986579970


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEECCCCCCCCCCCC-CCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             3652778999999999999986420456764322011257543213766-678862223540246599999999999999
Q gi|254780979|r  181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPGE-AWGTRCEVKNVNSIRFLGLAIEYEARRQIA  259 (500)
Q Consensus       181 ~Pd~~s~~ea~~~~~~l~~ilr~~gisd~~meeGslR~DvNVSi~~~~~-~~GtRvEIKNlnS~~~i~~AI~yEi~RQ~~  259 (500)
                      +|||+||+||++|+++||+||||+|+|||+||+|+||||||||||+.|. .|||||||||||||++|++||+||+.||++
T Consensus       154 ~Pd~~s~~ea~~~~~~l~~ilr~~gv~~~~me~GsiR~DvNVSi~~~g~~~~G~RvEIKNlnS~~~I~~AI~~Ei~RQ~~  233 (483)
T 3ip4_B          154 EPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEE  233 (483)
T ss_dssp             CSCBCSHHHHHHHHHHHHHHHHHHTSCCCCGGGTSEEEEEEEEEEETTSCCCCCEEEEECCCSHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCHHHHHHHHHHHHHHHH
T ss_conf             59977899999999999999997176556644565435540332678887776358874477838999999999999999


Q ss_pred             HHHCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHCCCCHHH
Q ss_conf             73139800344323375543366530356677778332778773126999999988530248368988643202688999
Q gi|254780979|r  260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIPELPDAKRERFIGEFGISLYD  339 (500)
Q Consensus       260 ll~~G~~v~qETR~~d~~~~~T~~mR~KE~a~DYRyfPEPDLPpi~is~e~i~~i~~~lPelP~~~~~rl~~~yGLs~~d  339 (500)
                      +|++|+.|.||||+||+.+++|++||+||+++||||||||||||+.|+++||+.++.+|||||+++++||+++|||+.++
T Consensus       234 ~le~G~~v~qeTR~~d~~~~~T~~mR~Ke~a~DYRy~PEpDLppi~I~~e~ie~ik~~lPeLP~~~~~rl~~~~gl~~~~  313 (483)
T 3ip4_B          234 ELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIPELPDERKAKYVNELGLPAYD  313 (483)
T ss_dssp             HHHHTCCCCEEEEEECTTTSCEEEEEEECSCCCCCCEECTTSCCEECCHHHHHHHHTTCCCCHHHHHHHHHHTSCCCHHH
T ss_pred             HHHCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHHHCCCHHH
T ss_conf             98669971243412355443466313567653245667888787658899999999868999799999999870999899


Q ss_pred             HHHHHHHHHHHHHHHHHH-CCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHH
Q ss_conf             888764113678988640-2430245777765457887643387400064898999999988863873147899999999
Q gi|254780979|r  340 ASVLVSDKSIADYFEKLA-VNRDKKIVANWVINDLLGVLNRSGKSIEDTPISPNQLGELIDLIIDGTISGKIAKDIFNIL  418 (500)
Q Consensus       340 A~~L~~~~~la~~FE~v~-~~~~pk~~Anwi~~el~~~ln~~~~~~~~~~i~p~~laeLi~li~~g~Is~~~aK~il~~l  418 (500)
                      |.+|+.++.+++||+++. .+.+|+.+|||+++++.+.+|+.+..+.+++++|++|++|+.++++|+||.++||++|..|
T Consensus       314 a~~l~~~~~l~~~fe~~~~~~~~~k~~anwl~~el~~~l~~~~~~~~~~~i~~~~l~~Li~li~~g~Is~~~aK~il~~l  393 (483)
T 3ip4_B          314 AHVLTLTKEMSDFFESTIEHGADVKLTSNWLMGGVNEYLNKNQVELLDTKLTPENLAGMIKLIEDGTMSSKIAKKVFPEL  393 (483)
T ss_dssp             HHHHTSSHHHHHHHHHHHTTTCCHHHHHHHHHTHHHHHHHHTTCCGGGSSCCHHHHHHHHHHHHHTSSCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHH
T ss_conf             88875218888888998861562789999999999999875267543379899999999999864974488999999999


Q ss_pred             HHCCCCHHHHHHHCCCEECCCHHHHHHHHHHHHHHCHHHHHHHH-CCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHC
Q ss_conf             81799988999963987618988999999999983999899752-72132265899999972897788999999999707
Q gi|254780979|r  419 WEKGGTPKEIVEELGLRQVTDLSAIEKVVDEVINSNPNNVARIA-TKPNLVSWFVGQVMKNTGGKANPSIVQKMLKEKLG  497 (500)
Q Consensus       419 ~~~~~~p~~iie~~gL~~isD~~eL~~iv~eVI~~np~~V~~~k-gk~ka~gfLvGqVMK~tkGkAdpk~v~~lL~e~L~  497 (500)
                      +.++++|.++++++||.|+||+++|+++|++||++||++|++|+ ||++++|||||||||+|||||||+.|+++|+++|+
T Consensus       394 ~~~~~s~~eiiee~gl~qisDe~eLe~ii~eVi~~n~~~Ve~~k~Gk~ka~gfLmGqVMK~tkGkAdpk~v~elL~e~L~  473 (483)
T 3ip4_B          394 AAKGGNAKQIMEDNGLVQISDEATLLKFVNEALDNNEQSVEDYKNGKGKAMGFLVGQIMKASKGQANPQLVNQLLKQELD  473 (483)
T ss_dssp             HHHCCCHHHHHHTTTCCCBCCHHHHHHHHHHHHHHCHHHHHHHHTTCSCHHHHHHHHHHHHTTSCBCHHHHHHHHHHHHH
T ss_pred             HHCCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHCHHHHHHHHCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHH
T ss_conf             85699999999975996048999999999999997999999997565877867999999996798799999999999999


Q ss_pred             CC
Q ss_conf             88
Q gi|254780979|r  498 IK  499 (500)
Q Consensus       498 ~k  499 (500)
                      -+
T Consensus       474 k~  475 (483)
T 3ip4_B          474 KR  475 (483)
T ss_dssp             HT
T ss_pred             HH
T ss_conf             98



>3h0l_B Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_B 3h0r_B* Back     alignment and structure
>3al0_B Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase; protein-RNA complex, ligase-RNA complex; HET: GSU; 3.37A {Thermotoga maritima} Back     alignment and structure
>2d6f_C Glutamyl-tRNA(Gln) amidotransferase subunit E; ligase, ligase/RNA complex; 3.15A {Methanothermobacterthermautotrophicus} SCOP: a.182.1.2 d.74.4.1 d.128.1.5 Back     alignment and structure
>1zq1_C Glutamyl-tRNA(Gln) amidotransferase subunit E; X-RAY, 3D structure, asparaginase 1 family, GATD subfamily, lyase; 3.00A {Pyrococcus abyssi} SCOP: a.182.1.2 d.74.4.1 d.128.1.5 Back     alignment and structure
>3kfu_F Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase; ASPRS, gatcab, ATP-binding, aminoacyl-tRNA synthetase, ligas nucleotide-binding, protein biosynthesis, ligase-RNA comple; HET: H2U 5MU PSU; 3.00A {Thermus thermophilus} Back     alignment and structure
>2hz7_A Glutaminyl-tRNA synthetase; rossmann fold, GLNRS core, class I aminoacyl-tRNA synthetase, ligase; 2.30A {Deinococcus radiodurans} Back     alignment and structure
>1ng6_A Hypothetical protein YQEY; structural genomics, domain GATB/YQEY, PFAM02637, DUF186, PSI, protein structure initiative; 1.40A {Bacillus subtilis} SCOP: a.182.1.1 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 500 aspartyl/glutamyl-tRNA amidotransferase subunit B [Cand
d2f2ab2290 d.128.1.5 (B:4-293) Aspartyl/glutamyl-tRNA(Asn/Gln) ami 1e-102
d2d6fc3319 d.128.1.5 (C:1-270,C:396-444) Glutamyl-tRNA(Gln) amidot 6e-70
d1zq1c3321 d.128.1.5 (C:5-276,C:408-456) Glutamyl-tRNA(Gln) amidot 3e-67
d2f2ab1107 a.182.1.2 (B:294-400) Aspartyl/glutamyl-tRNA(Asn/Gln) a 1e-29
d1zq1c156 a.182.1.2 (C:457-512) Glutamyl-tRNA(Gln) amidotransfera 5e-17
d2d6fc159 a.182.1.2 (C:445-503) Glutamyl-tRNA(Gln) amidotransfera 4e-15
>d2f2ab2 d.128.1.5 (B:4-293) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, N-terminal domain {Staphylococcus aureus [TaxId: 1280]} Length = 290 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Glutamine synthetase/guanido kinase
superfamily: Glutamine synthetase/guanido kinase
family: GatB/GatE catalytic domain-like
domain: Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, N-terminal domain
species: Staphylococcus aureus [TaxId: 1280]
 Score =  364 bits (936), Expect = e-102
 Identities = 140/298 (46%), Positives = 192/298 (64%), Gaps = 9/298 (3%)

Query: 23  EVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTG 82
           E VIG+EVH +L   SK+FS +  +FGAEPN+  +  D A PG+LP++N R V  A+   
Sbjct: 1   ETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAA 60

Query: 83  LGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVG 142
           + LN  I   S F RKNYFYPD P+ YQISQ D+PI   G + + +  +         +G
Sbjct: 61  MALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEVDGETK------RIG 114

Query: 143 IERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSILR 202
           I R+H+E+DAGKS H      S +DLNR G  L+EIV++PD+RS  EA A+L KLRSI++
Sbjct: 115 ITRLHMEEDAGKSTH--KGEYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSIIQ 172

Query: 203 YLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIAIL 261
           Y G  D  MEEGS+R D N+S+   G E +GT+ E+KN+NS  ++   +EYE +RQ   L
Sbjct: 173 YTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEEEL 232

Query: 262 EDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQIP 319
            +GG I QETR FD S  +T  +R KE + DYRYF EPD++PL ID+ +   +++ IP
Sbjct: 233 LNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTIP 290


>d2d6fc3 d.128.1.5 (C:1-270,C:396-444) Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE {Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 319 Back     information, alignment and structure
>d1zq1c3 d.128.1.5 (C:5-276,C:408-456) Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE {Pyrococcus abyssi [TaxId: 29292]} Length = 321 Back     information, alignment and structure
>d2f2ab1 a.182.1.2 (B:294-400) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Length = 107 Back     information, alignment and structure
>d1zq1c1 a.182.1.2 (C:457-512) Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE, C-terminal domain {Pyrococcus abyssi [TaxId: 29292]} Length = 56 Back     information, alignment and structure
>d2d6fc1 a.182.1.2 (C:445-503) Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE, C-terminal domain {Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 59 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target500 aspartyl/glutamyl-tRNA amidotransferase subunit B [Cand
d2f2ab2290 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subuni 100.0
d2d6fc3319 Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE {Me 100.0
d1zq1c3321 Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE {Py 100.0
d2f2ab1107 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subuni 99.87
d1zq1c156 Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE, C- 99.02
d2d6fc159 Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE, C- 98.97
d1ng6a_148 Hypothetical protein YqeY {Bacillus subtilis [TaxId: 14 97.92
d1zq1c3321 Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE {Py 91.67
>d2d6fc3 d.128.1.5 (C:1-270,C:396-444) Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1zq1c3 d.128.1.5 (C:5-276,C:408-456) Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2f2ab1 a.182.1.2 (B:294-400) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, C-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1zq1c1 a.182.1.2 (C:457-512) Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE, C-terminal domain {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2d6fc1 a.182.1.2 (C:445-503) Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE, C-terminal domain {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ng6a_ a.182.1.1 (A:) Hypothetical protein YqeY {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zq1c3 d.128.1.5 (C:5-276,C:408-456) Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 500 aspartyl/glutamyl-tRNA amidotransferase subunit B
3ip4_B_1-292292 (B:1-292) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotra 1e-114
3h0l_B_1-296296 (B:1-296) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotra 1e-112
1zq1_C_1-280_408-456329 (C:1-280,C:408-456) Glutamyl-tRNA(Gln) amidotransf 3e-85
2d6f_C_1-273_395-445324 (C:1-273,C:395-445) Glutamyl-tRNA(Gln) amidotransf 9e-85
2hz7_A_378-387_511-851351 (A:378-387,A:511-851) Glutaminyl-tRNA synthetase; 2e-62
3h0l_B_297-478182 (B:297-478) Aspartyl/glutamyl-tRNA(Asn/Gln) amidot 4e-48
2d6f_C_446-619174 (C:446-619) Glutamyl-tRNA(Gln) amidotransferase su 3e-43
1zq1_C_457-633177 (C:457-633) Glutamyl-tRNA(Gln) amidotransferase su 2e-42
3ip4_B_293-411119 (B:293-411) Aspartyl/glutamyl-tRNA(Asn/Gln) amidot 1e-40
3ip4_B_412-48372 (B:412-483) Aspartyl/glutamyl-tRNA(Asn/Gln) amidot 1e-15
1ng6_A_93-14856 (A:93-148) Hypothetical protein YQEY; structural g 3e-10
>3ip4_B (B:1-292) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; multi protein complex, ligase, ATP-binding, nucleotide- binding; 1.90A {Staphylococcus aureus subsp} PDB: 2df4_B 2dqn_B* 2g5h_B 2g5i_B* 2f2a_BLength = 292 Back     alignment and structure
 Score =  405 bits (1042), Expect = e-114
 Identities = 140/299 (46%), Positives = 192/299 (64%), Gaps = 9/299 (3%)

Query: 21  DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVM 80
            +E VIG+EVH +L   SK+FS +  +FGAEPN+  +  D A PG+LP++N R V  A+ 
Sbjct: 2   HFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMR 61

Query: 81  TGLGLNAHINKYSVFARKNYFYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIE 140
             + LN  I   S F RKNYFYPD P+ YQISQ D+PI   G + + +         T  
Sbjct: 62  AAMALNMEIATESKFDRKNYFYPDNPKAYQISQFDQPIGENGYIDIEV------DGETKR 115

Query: 141 VGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVTKPDMRSSLEAKAFLTKLRSI 200
           +GI R+H+E+DAGKS H      S +DLNR G  L+EIV++PD+RS  EA A+L KLRSI
Sbjct: 116 IGITRLHMEEDAGKSTHKGE--YSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRSI 173

Query: 201 LRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIA 259
           ++Y G  D  MEEGS+R D N+S+   G E +GT+ E+KN+NS  ++   +EYE +RQ  
Sbjct: 174 IQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEE 233

Query: 260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI 318
            L +GG I QETR FD S  +T  +R KE + DYRYF EPD++PL ID+ +   +++ I
Sbjct: 234 ELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTI 292


>3h0l_B (B:1-296) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_B 3h0r_B*Length = 296 Back     alignment and structure
>1zq1_C (C:1-280,C:408-456) Glutamyl-tRNA(Gln) amidotransferase subunit E; X-RAY, 3D structure, asparaginase 1 family, GATD subfamily, lyase; 3.00A {Pyrococcus abyssi}Length = 329 Back     alignment and structure
>2d6f_C (C:1-273,C:395-445) Glutamyl-tRNA(Gln) amidotransferase subunit E; ligase, ligase/RNA complex; 3.15A {Methanothermobacterthermautotrophicus}Length = 324 Back     alignment and structure
>2hz7_A (A:378-387,A:511-851) Glutaminyl-tRNA synthetase; rossmann fold, GLNRS core, class I aminoacyl-tRNA synthetase, ligase; 2.30A {Deinococcus radiodurans}Length = 351 Back     alignment and structure
>3h0l_B (B:297-478) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_B 3h0r_B*Length = 182 Back     alignment and structure
>2d6f_C (C:446-619) Glutamyl-tRNA(Gln) amidotransferase subunit E; ligase, ligase/RNA complex; 3.15A {Methanothermobacterthermautotrophicus}Length = 174 Back     alignment and structure
>1zq1_C (C:457-633) Glutamyl-tRNA(Gln) amidotransferase subunit E; X-RAY, 3D structure, asparaginase 1 family, GATD subfamily, lyase; 3.00A {Pyrococcus abyssi}Length = 177 Back     alignment and structure
>3ip4_B (B:293-411) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; multi protein complex, ligase, ATP-binding, nucleotide- binding; 1.90A {Staphylococcus aureus subsp} PDB: 2df4_B 2dqn_B* 2g5h_B 2g5i_B* 2f2a_BLength = 119 Back     alignment and structure
>3ip4_B (B:412-483) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; multi protein complex, ligase, ATP-binding, nucleotide- binding; 1.90A {Staphylococcus aureus subsp} PDB: 2df4_B 2dqn_B* 2g5h_B 2g5i_B* 2f2a_BLength = 72 Back     alignment and structure
>1ng6_A (A:93-148) Hypothetical protein YQEY; structural genomics, domain GATB/YQEY, PFAM02637, DUF186, PSI, protein structure initiative; 1.40A {Bacillus subtilis}Length = 56 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target500 aspartyl/glutamyl-tRNA amidotransferase subunit B [Cand
3ip4_B_1-292292 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase s 100.0
3h0l_B_1-296296 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase s 100.0
1zq1_C_1-280_408-456329 Glutamyl-tRNA(Gln) amidotransferase subunit E; X-R 100.0
2d6f_C_1-273_395-445324 Glutamyl-tRNA(Gln) amidotransferase subunit E; lig 100.0
2hz7_A_378-387_511-851351 Glutaminyl-tRNA synthetase; rossmann fold, GLNRS c 100.0
3h0l_B_297-478182 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase s 100.0
2d6f_C_446-619174 Glutamyl-tRNA(Gln) amidotransferase subunit E; lig 99.97
1zq1_C_457-633177 Glutamyl-tRNA(Gln) amidotransferase subunit E; X-R 99.97
3ip4_B_293-411119 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase s 99.92
3ip4_B_412-48372 Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase s 99.63
1ng6_A_93-14856 Hypothetical protein YQEY; structural genomics, do 99.02
2hz7_A_378-387_511-851351 Glutaminyl-tRNA synthetase; rossmann fold, GLNRS c 91.24
>3ip4_B (B:1-292) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; multi protein complex, ligase, ATP-binding, nucleotide- binding; 1.90A {Staphylococcus aureus subsp} PDB: 2df4_B 2dqn_B* 2g5h_B 2g5i_B* 2f2a_B Back     alignment and structure
Probab=100.00  E-value=0  Score=951.27  Aligned_cols=290  Identities=48%  Similarity=0.807  Sum_probs=282.8

Q ss_pred             CCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCCHHHHHHHHHHHHHHCCEECCCCEEECCCE
Q ss_conf             80338989997888689865558842468987652061302689888737899999999987782976244201311321
Q gi|254780979|r   21 DWEVVIGIEVHAQLSVVSKLFSGASVNFGAEPNTQVSFFDAAMPGMLPILNGRCVQQAVMTGLGLNAHINKYSVFARKNY  100 (500)
Q Consensus        21 ~~e~vIGLEiH~qL~t~tKlFc~c~~~~~~~pNt~v~~~~~g~PG~lP~lN~~av~~ai~~~~al~~~i~~~~~fdRK~Y  100 (500)
                      +||+|||||||+||+|+|||||+|+++|+++|||+|||||+|+||+||+||++||++|+++|+||||+|++.++||||||
T Consensus         2 ~ye~vIGLEIH~qL~T~tKlFc~c~~~~~~~pNt~vc~v~~g~PG~lP~lN~~av~~Ai~~a~aL~c~I~~~s~FdRK~Y   81 (292)
T 3ip4_B            2 HFETVIGLEVHVELKTDSKMFSPSPAHFGAEPNSNTNVIDLAYPGVLPVVNKRAVDWAMRAAMALNMEIATESKFDRKNY   81 (292)
T ss_dssp             CEEEEEEEEEEEECCCSBCSSSSSBSSCCSSTTCSCCTTTTTCTTCCCCCBHHHHHHHHHHHHHTTCEECSEECCEEEEC
T ss_pred             CCCEEEEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCEECCCCC
T ss_conf             96248889988883799686789998788997767786223799988656999999999999983998362315513324


Q ss_pred             ECCCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCEEEEEEEEEEEEEECCCCCCCCCCCCCEEEEECCCCCCEEEEEE
Q ss_conf             23767888201445442015338999706777774103798423666520231001156787148866157861257630
Q gi|254780979|r  101 FYPDLPQGYQISQHDKPIVGEGKVSVSIGPDKSGQFRTIEVGIERIHLEQDAGKSIHDQYSAVSCIDLNRSGVALMEIVT  180 (500)
Q Consensus       101 fYpDlpkgyQiTQ~~~Pi~~~G~l~~~~~~~~~~~~~~~~v~I~~i~lEED~gk~~h~~~~~~slvD~NRaGvPLiEIVT  180 (500)
                      |||||||||||||++.|||.||+|+++.+++      .++|+|.||||||||||++|+  ++.|+|||||||+|||||||
T Consensus        82 fYpDlPkgYQiTQ~~~Pi~~~G~i~i~~~~~------~k~i~I~rihlEEDagK~~h~--~~~slvD~NRaGvPLiEIVT  153 (292)
T 3ip4_B           82 FYPDNPKAYQISQFDQPIGENGYIDIEVDGE------TKRIGITRLHMEEDAGKSTHK--GEYSLVDLNRQGTPLIEIVS  153 (292)
T ss_dssp             CBTTBTTSEEEECSSSCSEEEEEEEECSSSS------CEEEEEEEEEEEECCCEEEEE--TTEEEEECTTTTCEEEEEEE
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCEEEEECCCC------CEEEEEEEEEEEECCCCCCCC--CCCEEEEECCCCCCCEEEEE
T ss_conf             3899986533114656657772581313777------459854357875021343335--77548861479984035641


Q ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCEEECCCCCCCCCCC-CCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             365277899999999999998642045676432201125754321376-6678862223540246599999999999999
Q gi|254780979|r  181 KPDMRSSLEAKAFLTKLRSILRYLGTCDGNMEEGSMRADVNVSVCRPG-EAWGTRCEVKNVNSIRFLGLAIEYEARRQIA  259 (500)
Q Consensus       181 ~Pd~~s~~ea~~~~~~l~~ilr~~gisd~~meeGslR~DvNVSi~~~~-~~~GtRvEIKNlnS~~~i~~AI~yEi~RQ~~  259 (500)
                      +|||+||+||++|+++|+++|||+|+|||+||+|+||||||||||+.| .+||+||||||||||++|++||+||+.||++
T Consensus       154 ~Pd~~s~~eA~~~~~~l~~il~~~gvsd~~me~GslR~DvNVSi~~~g~~~~g~RvEIKNlnS~~~i~~Ai~~E~~RQ~~  233 (292)
T 3ip4_B          154 EPDIRSPKEAYAYLEKLRSIIQYTGVSDVKMEEGSLRCDANISLRPYGQEKFGTKAELKNLNSFNYVRKGLEYEEKRQEE  233 (292)
T ss_dssp             CSCBCSHHHHHHHHHHHHHHHHHHTSCCCCGGGTSEEEEEEEEEEETTSCCCCCEEEEECCCSHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHH
T ss_conf             36868899999999999987642461024545575146645233777866676258874377708999999999999999


Q ss_pred             HHHCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHC
Q ss_conf             73139800344323375543366530356677778332778773126999999988530
Q gi|254780979|r  260 ILEDGGHIRQETRLFDPSKNETRSLRTKEDALDYRYFSEPDLLPLEIDEDFIRAIKKQI  318 (500)
Q Consensus       260 ll~~G~~v~qETR~~d~~~~~T~~mR~KE~a~DYRyfPEPDLPpi~is~e~i~~i~~~l  318 (500)
                      +|+.|+.|.||||+||+.++.|++||+||++.||||||||||||+.|+++||++++++|
T Consensus       234 ~l~~g~~i~qeTr~~d~~~~~T~~mR~KE~~~DYryfpepdlppi~i~~~~i~~i~~~l  292 (292)
T 3ip4_B          234 ELLNGGEIGQETRRFDESTGKTILMRVKEGSDDYRYFPEPDIVPLYIDDAWKERVRQTI  292 (292)
T ss_dssp             HHHHTCCCCEEEEEECTTTSCEEEEEEECSCCCCCCEECTTSCCEECCHHHHHHHHTTC
T ss_pred             HHHCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHC
T ss_conf             98679965244411244453357502466653124444766687667599999898668



>3h0l_B (B:1-296) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_B 3h0r_B* Back     alignment and structure
>1zq1_C (C:1-280,C:408-456) Glutamyl-tRNA(Gln) amidotransferase subunit E; X-RAY, 3D structure, asparaginase 1 family, GATD subfamily, lyase; 3.00A {Pyrococcus abyssi} Back     alignment and structure
>2d6f_C (C:1-273,C:395-445) Glutamyl-tRNA(Gln) amidotransferase subunit E; ligase, ligase/RNA complex; 3.15A {Methanothermobacterthermautotrophicus} Back     alignment and structure
>2hz7_A (A:378-387,A:511-851) Glutaminyl-tRNA synthetase; rossmann fold, GLNRS core, class I aminoacyl-tRNA synthetase, ligase; 2.30A {Deinococcus radiodurans} Back     alignment and structure
>3h0l_B (B:297-478) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; multi protein complex, ligase, protein biosynthesis; HET: ADP; 2.30A {Aquifex aeolicus} PDB: 3h0m_B 3h0r_B* Back     alignment and structure
>2d6f_C (C:446-619) Glutamyl-tRNA(Gln) amidotransferase subunit E; ligase, ligase/RNA complex; 3.15A {Methanothermobacterthermautotrophicus} Back     alignment and structure
>1zq1_C (C:457-633) Glutamyl-tRNA(Gln) amidotransferase subunit E; X-RAY, 3D structure, asparaginase 1 family, GATD subfamily, lyase; 3.00A {Pyrococcus abyssi} Back     alignment and structure
>3ip4_B (B:293-411) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; multi protein complex, ligase, ATP-binding, nucleotide- binding; 1.90A {Staphylococcus aureus subsp} PDB: 2df4_B 2dqn_B* 2g5h_B 2g5i_B* 2f2a_B Back     alignment and structure
>3ip4_B (B:412-483) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; multi protein complex, ligase, ATP-binding, nucleotide- binding; 1.90A {Staphylococcus aureus subsp} PDB: 2df4_B 2dqn_B* 2g5h_B 2g5i_B* 2f2a_B Back     alignment and structure
>1ng6_A (A:93-148) Hypothetical protein YQEY; structural genomics, domain GATB/YQEY, PFAM02637, DUF186, PSI, protein structure initiative; 1.40A {Bacillus subtilis} Back     alignment and structure
>2hz7_A (A:378-387,A:511-851) Glutaminyl-tRNA synthetase; rossmann fold, GLNRS core, class I aminoacyl-tRNA synthetase, ligase; 2.30A {Deinococcus radiodurans} Back     alignment and structure