254781017

254781017

GHMP kinase

GeneID in NCBI database:8210040Locus tag:CLIBASIA_04595
Protein GI in NCBI database:254781017Protein Accession:YP_003065430.1
Gene range:-(1017407, 1018381)Protein Length:324aa
Gene description:GHMP kinase
COG prediction:[I] Mevalonate kinase
KEGG prediction:GHMP kinase; K00869 mevalonate kinase [EC:2.7.1.36]
SEED prediction:Mevalonate kinase (EC 2.7.1.36)
Pathway involved in KEGG:Terpenoid backbone biosynthesis [PATH:las00900]
Subsystem involved in SEED:Isoprenoid Biosynthesis;
Mevalonate Branch of Isoprenoid Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOP4 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS3 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320----
MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSHSTSLYR
cccccccEEEEccEEEEEEcccEEEccccEEEEEEcccEEEEEEEccccEEEEEEEcccccccccccccccHHHHHHHHHHHccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccHHHHHHHcccEEEEEEccccEEEEcccccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccEEEEEcccccccEEEEEEccccHHHHHHHHHHHHHHccccEEEEcccccccccc
cccHcccEEEEcccEEEEEccEEEEccccEEEEEEccEEEEEEEEcccccEEEEcccccccccccccccHHHHHHHHHHHHHHccccccEEEEEccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccccccHEEccccEEEEEcccccccccccccEEEEEEccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccEEccccccccEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEcccccccc
mgqclhkicvsapgslvlmgehgvlHGHAALVFAINKRVILYLTLRKDRLinidsslgqycgsldlamfhpsFSFIIMAINHikpscgfdLKVISQLDsqlglgssAAITVAITAALLTLqyhkepspdeiLTTAHAIVLKVQGISSGIDLAASIHGglicyqmpkysiekidfifpihliysgyktptaQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLreqphimaskisgsglgDCVIAlgkgdlnslpyqsvnchmhakgidivpitpshstslyr
MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKgidivpitpshstslyr
MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVIsqldsqlglgssaaitvaitaalltlQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISyieieypeineinQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSHSTSLYR
*****HK***SAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPS*******
MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSHSTSLYR
****LHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSHSTSLYR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSHSTSLYR
MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSHSTSLYR
MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITPSHSTSLYR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target324 GHMP kinase [Candidatus Liberibacter asiaticus str. psy
254781018337 GHMP kinase [Candidatus Liberibacter asiaticus str 0.006
>gi|254781018|ref|YP_003065431.1| GHMP kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 337 Back     alignment
 Score = 33.5 bits (75), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 67/293 (22%), Positives = 125/293 (42%), Gaps = 36/293 (12%)

Query: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSS------------LGQ 59
           AP  ++L GE+  L+G +AL  AI   +   LT  +  LI I +S            LG 
Sbjct: 15  APAKVILSGEYSSLYGASALAVAITFYLRALLTTIEPSLIRIINSQTIEYSFEACRLLGH 74

Query: 60  YCGS-----------LDLAMFHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSS 106
                          +   + HP+   I+   N   P  SCG  L + S +    G GSS
Sbjct: 75  QIDQRHRDFIAKKIPITSVLTHPN-DLILYIFNRHLPHISCGISLDLHSTIPIGSGFGSS 133

Query: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK 166
           +AI  A++ AL ++  H+     E L      + ++Q   +GI  + +I  G I Y  P 
Sbjct: 134 SAIISALSLALSSIT-HQPFCNKEKLIAETGYIERLQHGKTGIIDSTTIVMGGIIYINPP 192

Query: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQ 226
             I+    +     I +G   P +   + +S++E  + +       I++    ++    +
Sbjct: 193 QIIKNETLVGEWWAINTG--MPESSTGECVSFVEQHFSQ-----SSIWSEFNAVTNEMME 245

Query: 227 ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSG 279
            ++ K+ +   +++   Q LLE++GV    + + +  +       ++KI+G+G
Sbjct: 246 NIQKKDAEKTYKSVRVNQSLLESIGVVPETVGKFIRCIENNGG--SAKIAGAG 296

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target324 GHMP kinase [Candidatus Liberibacter asiaticus str. psy
315122512327 mevalonate kinase [Candidatus Liberibacter solanacearum 1 1e-119
78486074295 GHMP kinase [Thiomicrospira crunogena XCL-2] Length = 2 1 2e-49
89094694309 GHMP kinase [Oceanospirillum sp. MED92] Length = 309 1 2e-47
29653946313 mevalonate kinase [Coxiella burnetii RSA 493] Length = 1 1e-42
20429111305 phosphomevalonate kinase [Paracoccus zeaxanthinifaciens 1 1e-42
153207704313 mevalonate kinase [Coxiella burnetii 'MSU Goat Q177'] L 1 1e-42
258545075301 mevalonate kinase [Cardiobacterium hominis ATCC 15826] 1 8e-40
254513339316 putative mevalonate kinase [Rhodobacteraceae bacterium 1 2e-33
284162110292 mevalonate kinase [Archaeoglobus profundus DSM 5631] Le 1 5e-32
146329469303 GHMP kinase family protein [Dichelobacter nodosus VCS17 1 4e-30
>gi|315122512|ref|YP_004063001.1| mevalonate kinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 327 Back     alignment and organism information
 Score =  432 bits (1112), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 227/325 (69%), Positives = 268/325 (82%), Gaps = 3/325 (0%)

Query: 1   MGQCLHKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQY 60
           MGQCL KI V+APGS+VLMGEH VL+G AALVFAI+KR+ L LTLRKDRLINI+SSLGQY
Sbjct: 1   MGQCLQKIRVNAPGSIVLMGEHAVLYGQAALVFAIDKRISLCLTLRKDRLININSSLGQY 60

Query: 61  CGSLDLAMFHPSFSFIIMAINHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTL 120
           CGSLDL M HPSFSFII A+ +IKP  GFDL++ S++D +LGLGSSAAIT +ITAALLTL
Sbjct: 61  CGSLDLPMSHPSFSFIITALEYIKPESGFDLEITSEIDCRLGLGSSAAITASITAALLTL 120

Query: 121 QYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQM---PKYSIEKIDFIFP 177
           QY K+P  +EI   A+ IVLK QG +SGIDLAASI+GGLI Y+M    +YSIE + +  P
Sbjct: 121 QYQKKPPKEEIFKKAYDIVLKTQGKASGIDLAASIYGGLIFYRMSELSEYSIEHVSYNLP 180

Query: 178 IHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQALRNKNLKVLA 237
           IHL+YSGYKTPT+QVL KIS +EIEYP I +INQ IYALMG+LS+IS  ALR+ N+K+LA
Sbjct: 181 IHLVYSGYKTPTSQVLNKISQVEIEYPAIKKINQTIYALMGELSEISLHALRDGNIKLLA 240

Query: 238 QAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPY 297
           QAMNRQQGLLETLGVSD  LS+IVW+LREQ  +MA+KISGSGLGDCVIALG+     L Y
Sbjct: 241 QAMNRQQGLLETLGVSDPTLSDIVWRLREQSLVMAAKISGSGLGDCVIALGESRSQFLFY 300

Query: 298 QSVNCHMHAKGIDIVPITPSHSTSL 322
            S++C MH+KGI I PIT S+ST L
Sbjct: 301 PSIDCSMHSKGIYIAPITSSYSTHL 325


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|78486074|ref|YP_391999.1| GHMP kinase [Thiomicrospira crunogena XCL-2] Length = 295 Back     alignment and organism information
>gi|89094694|ref|ZP_01167630.1| GHMP kinase [Oceanospirillum sp. MED92] Length = 309 Back     alignment and organism information
>gi|29653946|ref|NP_819638.1| mevalonate kinase [Coxiella burnetii RSA 493] Length = 313 Back     alignment and organism information
>gi|20429111|emb|CAD24422.1| phosphomevalonate kinase [Paracoccus zeaxanthinifaciens] Length = 305 Back     alignment and organism information
>gi|153207704|ref|ZP_01946351.1| mevalonate kinase [Coxiella burnetii 'MSU Goat Q177'] Length = 313 Back     alignment and organism information
>gi|258545075|ref|ZP_05705309.1| mevalonate kinase [Cardiobacterium hominis ATCC 15826] Length = 301 Back     alignment and organism information
>gi|254513339|ref|ZP_05125404.1| putative mevalonate kinase [Rhodobacteraceae bacterium KLH11] Length = 316 Back     alignment and organism information
>gi|284162110|ref|YP_003400733.1| mevalonate kinase [Archaeoglobus profundus DSM 5631] Length = 292 Back     alignment and organism information
>gi|146329469|ref|YP_001209401.1| GHMP kinase family protein [Dichelobacter nodosus VCS1703A] Length = 303 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target324 GHMP kinase [Candidatus Liberibacter asiaticus str. psy
TIGR00549273 TIGR00549, mevalon_kin, mevalonate kinase 2e-36
PRK03926302 PRK03926, PRK03926, mevalonate kinase; Provisional 3e-34
KOG1511397 KOG1511, KOG1511, KOG1511, Mevalonate kinase MVK/ERG12 7e-20
COG0153390 COG0153, GalK, Galactokinase [Carbohydrate transport an 2e-12
PTZ00298328 PTZ00298, PTZ00298, mevalonate kinase; Provisional 4e-11
COG3890337 COG3890, ERG8, Phosphomevalonate kinase [Lipid metaboli 1e-10
PLN02677387 PLN02677, PLN02677, mevalonate kinase 3e-08
PRK03817351 PRK03817, PRK03817, galactokinase; Provisional 6e-04
COG2605333 COG2605, COG2605, Predicted kinase related to galactoki 0.001
COG1577307 COG1577, ERG12, Mevalonate kinase [Lipid metabolism] 7e-42
TIGR01220358 TIGR01220, Pmev_kin_Gr_pos, phosphomevalonate kinase, E 4e-13
KOG0631 489 KOG0631, KOG0631, KOG0631, Galactokinase [Carbohydrate 0.002
pfam0028867 pfam00288, GHMP_kinases_N, GHMP kinases N terminal doma 1e-06
COG1907312 COG1907, COG1907, Predicted archaeal sugar kinases [Gen 2e-04
pfam0854482 pfam08544, GHMP_kinases_C, GHMP kinases C terminal 3e-04
COG0083299 COG0083, ThrB, Homoserine kinase [Amino acid transport 0.001
>gnl|CDD|161922 TIGR00549, mevalon_kin, mevalonate kinase Back     alignment and domain information
>gnl|CDD|179677 PRK03926, PRK03926, mevalonate kinase; Provisional Back     alignment and domain information
>gnl|CDD|36724 KOG1511, KOG1511, KOG1511, Mevalonate kinase MVK/ERG12 [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|30502 COG0153, GalK, Galactokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|140319 PTZ00298, PTZ00298, mevalonate kinase; Provisional Back     alignment and domain information
>gnl|CDD|33679 COG3890, ERG8, Phosphomevalonate kinase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|178281 PLN02677, PLN02677, mevalonate kinase Back     alignment and domain information
>gnl|CDD|179653 PRK03817, PRK03817, galactokinase; Provisional Back     alignment and domain information
>gnl|CDD|32597 COG2605, COG2605, Predicted kinase related to galactokinase and mevalonate kinase [General function prediction only] Back     alignment and domain information
>gnl|CDD|31765 COG1577, ERG12, Mevalonate kinase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|130287 TIGR01220, Pmev_kin_Gr_pos, phosphomevalonate kinase, ERG8-type, Gram-positive branch Back     alignment and domain information
>gnl|CDD|35850 KOG0631, KOG0631, KOG0631, Galactokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|144028 pfam00288, GHMP_kinases_N, GHMP kinases N terminal domain Back     alignment and domain information
>gnl|CDD|32091 COG1907, COG1907, Predicted archaeal sugar kinases [General function prediction only] Back     alignment and domain information
>gnl|CDD|149558 pfam08544, GHMP_kinases_C, GHMP kinases C terminal Back     alignment and domain information
>gnl|CDD|30432 COG0083, ThrB, Homoserine kinase [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 324 GHMP kinase [Candidatus Liberibacter asiaticus str. psy
PRK03926302 mevalonate kinase; Provisional 100.0
PTZ00298328 mevalonate kinase; Provisional 100.0
COG1577307 ERG12 Mevalonate kinase [Lipid metabolism] 100.0
PRK03817351 galactokinase; Provisional 100.0
PRK05322387 galactokinase; Provisional 100.0
PRK00555363 galactokinase; Provisional 100.0
KOG1511397 consensus 100.0
PRK05101382 galactokinase; Provisional 100.0
COG0153390 GalK Galactokinase [Carbohydrate transport and metaboli 100.0
PTZ00290468 galactokinase; Provisional 100.0
TIGR01220367 Pmev_kin_Gr_pos phosphomevalonate kinase; InterPro: IPR 100.0
TIGR00131500 gal_kin galactokinase; InterPro: IPR000705 Galactokinas 100.0
COG2605333 Predicted kinase related to galactokinase and mevalonat 100.0
PRK13412974 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransf 100.0
KOG0631489 consensus 100.0
COG3890337 ERG8 Phosphomevalonate kinase [Lipid metabolism] 99.97
PRK01212293 homoserine kinase; Provisional 99.97
TIGR01219499 Pmev_kin_ERG8 phosphomevalonate kinase; InterPro: IPR01 99.97
PRK03188299 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Prov 99.95
PRK04344284 consensus 99.95
PRK02534308 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Prov 99.95
PRK00128281 ipk 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; 99.95
COG0083299 ThrB Homoserine kinase [Amino acid transport and metabo 99.95
PTZ00299336 homoserine kinase; Provisional 99.94
KOG4519459 consensus 99.94
TIGR00191359 thrB homoserine kinase; InterPro: IPR000870 Saccharomyc 99.94
PRK01123283 shikimate kinase; Provisional 99.93
PRK03009287 consensus 99.89
PRK01726312 consensus 99.89
PRK00343279 ipk 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; 99.89
PRK04943288 consensus 99.88
PRK04648295 consensus 99.85
KOG4644948 consensus 99.82
COG1685278 Archaeal shikimate kinase [Amino acid transport and met 99.77
TIGR01920273 Shik_kin_archae shikimate kinase; InterPro: IPR010189 S 99.76
COG3407329 MVD1 Mevalonate pyrophosphate decarboxylase [Lipid meta 99.55
COG1907312 Predicted archaeal sugar kinases [General function pred 99.49
KOG2833395 consensus 99.35
TIGR01240325 mevDPdecarb diphosphomevalonate decarboxylase; InterPro 99.24
TIGR00144337 beta_RFAP_syn beta-ribofuranosylaminobenzene 5'-phospha 98.26
TIGR00549345 mevalon_kin mevalonate kinase; InterPro: IPR006205 Meva 100.0
COG1947289 IspE 4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosph 99.88
PRK03288283 consensus 99.87
PRK00650288 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Prov 99.84
TIGR00154322 ispE 4-diphosphocytidyl-2C-methyl-D-erythritol kinase; 99.79
PRK05905258 hypothetical protein; Provisional 99.79
PRK04181254 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Prov 99.76
COG1829283 Predicted archaeal kinase (sugar kinase superfamily) [G 99.38
COG4542293 PduX Protein involved in propanediol utilization, and r 99.27
pfam0028867 GHMP_kinases_N GHMP kinases N terminal domain. This fam 99.34
pfam1050952 GalKase_gal_bdg Galactokinase galactose-binding signatu 98.82
pfam0854482 GHMP_kinases_C GHMP kinases C terminal. This family inc 98.81
KOG1537355 consensus 98.49
>PRK03926 mevalonate kinase; Provisional Back     alignment and domain information
>PTZ00298 mevalonate kinase; Provisional Back     alignment and domain information
>COG1577 ERG12 Mevalonate kinase [Lipid metabolism] Back     alignment and domain information
>PRK03817 galactokinase; Provisional Back     alignment and domain information
>PRK05322 galactokinase; Provisional Back     alignment and domain information
>PRK00555 galactokinase; Provisional Back     alignment and domain information
>KOG1511 consensus Back     alignment and domain information
>PRK05101 galactokinase; Provisional Back     alignment and domain information
>COG0153 GalK Galactokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PTZ00290 galactokinase; Provisional Back     alignment and domain information
>TIGR01220 Pmev_kin_Gr_pos phosphomevalonate kinase; InterPro: IPR005917 Protein kinases are a group of enzymes that possess a catalytic subunit which transfers the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function Back     alignment and domain information
>TIGR00131 gal_kin galactokinase; InterPro: IPR000705 Galactokinase catalyses the first reaction in the galactose metabolism pathway, the ATP-dependent phosphorylation of galactose, yielding galactose-1-phosphate , Back     alignment and domain information
>COG2605 Predicted kinase related to galactokinase and mevalonate kinase [General function prediction only] Back     alignment and domain information
>PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional Back     alignment and domain information
>KOG0631 consensus Back     alignment and domain information
>COG3890 ERG8 Phosphomevalonate kinase [Lipid metabolism] Back     alignment and domain information
>PRK01212 homoserine kinase; Provisional Back     alignment and domain information
>TIGR01219 Pmev_kin_ERG8 phosphomevalonate kinase; InterPro: IPR016005 Phosphomevalonate kinase (2 Back     alignment and domain information
>PRK03188 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional Back     alignment and domain information
>PRK04344 consensus Back     alignment and domain information
>PRK02534 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional Back     alignment and domain information
>PRK00128 ipk 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional Back     alignment and domain information
>COG0083 ThrB Homoserine kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00299 homoserine kinase; Provisional Back     alignment and domain information
>KOG4519 consensus Back     alignment and domain information
>TIGR00191 thrB homoserine kinase; InterPro: IPR000870 Saccharomyces cerevisiae strains containing the erg8-1 mutation are temperature sensitive for growth due to a defect in phosphomevalonate kinase, an enzyme of isoprene and ergosterol biosynthesis Back     alignment and domain information
>PRK01123 shikimate kinase; Provisional Back     alignment and domain information
>PRK03009 consensus Back     alignment and domain information
>PRK01726 consensus Back     alignment and domain information
>PRK00343 ipk 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional Back     alignment and domain information
>PRK04943 consensus Back     alignment and domain information
>PRK04648 consensus Back     alignment and domain information
>KOG4644 consensus Back     alignment and domain information
>COG1685 Archaeal shikimate kinase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>TIGR01920 Shik_kin_archae shikimate kinase; InterPro: IPR010189 Shikimate kinase (2 Back     alignment and domain information
>COG3407 MVD1 Mevalonate pyrophosphate decarboxylase [Lipid metabolism] Back     alignment and domain information
>COG1907 Predicted archaeal sugar kinases [General function prediction only] Back     alignment and domain information
>KOG2833 consensus Back     alignment and domain information
>TIGR01240 mevDPdecarb diphosphomevalonate decarboxylase; InterPro: IPR005935 Synonyms: mevalonate diphosphate decarboxylase; pyrophosphomevalonate decarboxylase Back     alignment and domain information
>TIGR00144 beta_RFAP_syn beta-ribofuranosylaminobenzene 5'-phosphate synthase family; InterPro: IPR004422 This protein family contains several archaeal examples of beta-ribofuranosylaminobenzene 5-prime-phosphate synthase (beta-RFAP synthase), an enzyme involved in methanopterin biosynthesis Back     alignment and domain information
>TIGR00549 mevalon_kin mevalonate kinase; InterPro: IPR006205 Mevalonate kinase (2 Back     alignment and domain information
>COG1947 IspE 4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate synthase [Lipid metabolism] Back     alignment and domain information
>PRK03288 consensus Back     alignment and domain information
>PRK00650 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional Back     alignment and domain information
>TIGR00154 ispE 4-diphosphocytidyl-2C-methyl-D-erythritol kinase; InterPro: IPR004424 4-diphosphocytidyl-2C-methyl-D-erythritol kinase is a member of the family of GHMP kinases that were previously designated as conserved hypothetical protein YchB or as isopentenyl monophosphate kinase Back     alignment and domain information
>PRK05905 hypothetical protein; Provisional Back     alignment and domain information
>PRK04181 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional Back     alignment and domain information
>COG1829 Predicted archaeal kinase (sugar kinase superfamily) [General function prediction only] Back     alignment and domain information
>COG4542 PduX Protein involved in propanediol utilization, and related proteins (includes coumermycin biosynthetic protein), possible kinase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>pfam00288 GHMP_kinases_N GHMP kinases N terminal domain Back     alignment and domain information
>pfam10509 GalKase_gal_bdg Galactokinase galactose-binding signature Back     alignment and domain information
>pfam08544 GHMP_kinases_C GHMP kinases C terminal Back     alignment and domain information
>KOG1537 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target324 GHMP kinase [Candidatus Liberibacter asiaticus str. psy
1s4e_A352 Pyrococcus Furiosus Galactokinase In Complex With G 2e-37
1pie_A419 Crystal Structure Of Lactococcus Lactis Galactokina 2e-35
2cz9_A350 Crystal Structure Of Galactokinase From Pyrococcus 4e-35
2hfu_A332 Crystal Structure Of L. Major Mevalonate Kinase In 5e-35
2hfs_A332 Crystal Structure Of L. Major Mevalonate Kinase Len 2e-34
2r3v_A396 The Biochemical And Structural Basis For Feedback I 5e-31
2x7i_A308 Crystal Structure Of Mevalonate Kinase From Methici 6e-29
2oi2_A292 Streptococcus Pneumoniae Mevalonate Kinase In Compl 2e-27
1kvk_A395 The Structure Of Binary Complex Between A Mammalian 4e-24
2a2d_A478 X-Ray Structure Of Human N-Acetyl Galactosamine Kin 4e-16
3gon_A335 Streptococcus Pneumoniae Phosphomevalonate Kinase I 1e-15
3k17_A365 Crystal Structure Of A Lin0012 Protein From Listeri 3e-15
1k47_A337 Crystal Structure Of The Streptococcus Pneumoniae P 1e-14
1kkh_A317 Crystal Structure Of The Methanococcus Jannaschii M 3e-37
1vis_A324 Crystal Structure Of Mevalonate Kinase Length = 324 4e-37
1wuu_A399 Crystal Structure Of Human Galactokinase Complexed 2e-24
3k85_A357 Crystal Structure Of A D-Glycero-D-Manno-Heptose 1- 5e-13
2aj4_A 548 Crystal Structure Of Saccharomyces Cerevisiae Galac 7e-14
2aj4_A548 Crystal Structure Of Saccharomyces Cerevisiae Galac 1e-09
>gi|47169015|pdb|1S4E|A Chain A, Pyrococcus Furiosus Galactokinase In Complex With Galactose, Adp And Magnesium Length = 352 Back     alignment and structure
 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 61/354 (17%), Positives = 105/354 (29%), Gaps = 42/354 (11%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
           KI V +PG + L+GEH           AI+   I+         + + S       +  L
Sbjct: 3   KITVKSPGRVNLIGEHTDYTYGYVXPXAIDLYTIITAEKYD--KVQLYSEHFNEEKTFTL 60

Query: 67  AMFHP---SFSFIIMAI----NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLT 119
                      ++   +           G   K+   L    GL SSA+  V I   L  
Sbjct: 61  DNLTKEGSWIDYVKGVLWVLIQEGYKIGGLKGKITGDLPLGAGLSSSASFEVGILEVLNQ 120

Query: 120 LQYHKEPSPDEILTTAHAIVLKVQGISSGI-DLAASIHGGL---ICYQMPKYSIEKIDFI 175
           L Y+    P +    A     +  G+  GI D  A + G     I         E I F 
Sbjct: 121 L-YNLNIDPLKKALLAKKAENEFVGVPCGILDQFAVVFGKKDNVIFLDTQTLQYEYIPFP 179

Query: 176 FPIHLIYSGYKTPTAQVLKKISYIEI-----------------------EYPEINEINQK 212
             + ++             + +  +                        + P ++     
Sbjct: 180 KDVSVLVFYTGVKRELASSEYAERKRIAEESLRILGKESSKEVTEKDLGKLPPLHRKFFS 239

Query: 213 IYALMGKLSQISCQALRNKNLKVLAQAMNRQQGLL-ETLGVSDSKLSEIVWKLREQPHIM 271
                         AL+  +++ + + +      L E   VS  +L   V K  E     
Sbjct: 240 YIVRENARVLEVRDALKEGDIEKVGKILTTAHWDLAENYRVSCEELDFFVKKAXEL-GAY 298

Query: 272 ASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDI---VPITPSHSTSL 322
            ++++G+G G   IAL   D       ++     AK         + PS    +
Sbjct: 299 GARLTGAGFGGSAIALVDKDKAKTIGDAILREYLAKFSWKAKYFVVKPSDGVGV 352


>gi|37927469|pdb|1PIE|A Chain A, Crystal Structure Of Lactococcus Lactis Galactokinase Complexed With Galactose Length = 419 Back     alignment and structure
gi|116666959|pdb|2CZ9|A Chain A, Crystal Structure Of Galactokinase From Pyrococcus Horikoshi Length = 350 Back     alignment and structure
>gi|146387259|pdb|2HFU|A Chain A, Crystal Structure Of L. Major Mevalonate Kinase In Complex With R-Mevalonate Length = 332 Back     alignment and structure
>gi|146387257|pdb|2HFS|A Chain A, Crystal Structure Of L. Major Mevalonate Kinase Length = 332 Back     alignment and structure
gi|192988174|pdb|2R3V|A Chain A, The Biochemical And Structural Basis For Feedback Inhibition Of Mevalonate Kinase And Isoprenoid Metabolism Length = 396 Back     alignment and structure
>gi|301015707|pdb|2X7I|A Chain A, Crystal Structure Of Mevalonate Kinase From Methicillin- Resistant Staphylococcus Aureus Mrsa252 Length = 308 Back     alignment and structure
gi|146386624|pdb|2OI2|A Chain A, Streptococcus Pneumoniae Mevalonate Kinase In Complex With Diphosphomevalonate Length = 292 Back     alignment and structure
gi|20151083|pdb|1KVK|A Chain A, The Structure Of Binary Complex Between A Mammalian Mevalonate Kinase And Atp: Insights Into The Reaction Mechanism And Human Inherited Disease Length = 395 Back     alignment and structure
>gi|71042624|pdb|2A2D|A Chain A, X-Ray Structure Of Human N-Acetyl Galactosamine Kinase Complexed With Mn-Amppnp And N-Acetyl Glactosamine Length = 478 Back     alignment and structure
gi|254574856|pdb|3GON|A Chain A, Streptococcus Pneumoniae Phosphomevalonate Kinase In Complex With Phosphomevalonate And Amppnp Length = 335 Back     alignment and structure
>gi|260656454|pdb|3K17|A Chain A, Crystal Structure Of A Lin0012 Protein From Listeria Innocua Length = 365 Back     alignment and structure
>gi|21465779|pdb|1K47|A Chain A, Crystal Structure Of The Streptococcus Pneumoniae Phosphomevalonate Kinase (Pmk) Length = 337 Back     alignment and structure
>gi|20150886|pdb|1KKH|A Chain A, Crystal Structure Of The Methanococcus Jannaschii Mevalonate Kinase Length = 317 Back     alignment and structure
>gi|40890012|pdb|1VIS|A Chain A, Crystal Structure Of Mevalonate Kinase Length = 324 Back     alignment and structure
>gi|58177238|pdb|1WUU|A Chain A, Crystal Structure Of Human Galactokinase Complexed With Mgamppnp And Galactose Length = 399 Back     alignment and structure
>gi|270346706|pdb|3K85|A Chain A, Crystal Structure Of A D-Glycero-D-Manno-Heptose 1-Phosphate Kinase From Bacteriodes Thetaiotaomicron Length = 357 Back     alignment and structure
>gi|75766245|pdb|2AJ4|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Galactokinase In Complex With Galactose And Mg:amppnp Length = 548 Back     alignment and structure
>gi|75766245|pdb|2AJ4|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Galactokinase In Complex With Galactose And Mg:amppnp Length = 548 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target324 GHMP kinase [Candidatus Liberibacter asiaticus str. psy
1kvk_A395 MK, mevalonate kinase; RMK, ATP, GHMP, transferase; HET 1e-32
2x7i_A308 Mevalonate kinase; transferase; HET: CIT; 2.20A {Staphy 5e-32
3k17_A365 LIN0012 protein; protein structure initiative II(PSI II 2e-31
1kkh_A317 Mevalonate kinase; mixed beta sheet, phosphate-binding 2e-31
2pg9_A337 Phosphomevalonate kinase; GHMP kinase superfamily, tran 5e-28
2hfs_A332 Mevalonate kinase, putative; GHMP kinase, trypanosomati 7e-25
2oi2_A292 Mevalonate kinase; enzyme-inhibitor complex, transferas 9e-25
1pie_A419 Galactokinase; galactose, galactosemia, transferase; HE 9e-23
1wuu_A399 Galactokinase; galactosemia, GHMP superfamily, transfer 2e-22
3k85_A357 D-glycero-D-manno-heptose 1-phosphate kinase; bacteriod 4e-19
2cz9_A350 Probable galactokinase; structural genomics, NPPSFA, na 2e-18
2aj4_A 548 Galactokinase; galactosemia, transcription, transferase 2e-11
2aj4_A548 Galactokinase; galactosemia, transcription, transferase 0.002
2a2c_A478 N-acetylgalactosamine kinase; galactokinase, , transfer 2e-05
2a2c_A478 N-acetylgalactosamine kinase; galactokinase, , transfer 2e-09
3lto_A323 Mevalonate diphosphate decarboxylase; protein structure 8e-04
>1kvk_A MK, mevalonate kinase; RMK, ATP, GHMP, transferase; HET: ATP; 2.40A {Rattus norvegicus} SCOP: d.14.1.5 d.58.26.3 PDB: 2r42_A* 2r3v_A Length = 395 Back     alignment and structure
 Score =  135 bits (339), Expect = 1e-32
 Identities = 83/369 (22%), Positives = 131/369 (35%), Gaps = 62/369 (16%)

Query: 7   KICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDL 66
            + VSAPG ++L GEH V+HG  AL  A+N R  L L  + +  ++++          D+
Sbjct: 5   VLLVSAPGKVILHGEHAVVHGKVALAVALNLRTFLVLRPQSNGKVSLNLPNVGIKQVWDV 64

Query: 67  AMFHPSFSFIIMAINHIKPSC--------------------------------------- 87
           A      +  +   +   P+                                        
Sbjct: 65  ATLQLLDTGFLEQGDVPAPTLEQLEKLKKVAGLPRDCVGNEGLSLLAFLYLYLAICRKQR 124

Query: 88  ---GFDLKVISQLDSQLGLGSSAAITVAITAALLTL--------------QYHKEPSPDE 130
                D+ V S+L    GLGSSAA +V + AALLT                   E     
Sbjct: 125 TLPSLDIMVWSELPPGAGLGSSAAYSVCVAAALLTACEEVTNPLKDRGSIGSWPEEDLKS 184

Query: 131 ILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTPTA 190
           I   A+     + G  SG+D + S  GG + YQ  K S  K      I L  +     T 
Sbjct: 185 INKWAYEGERVIHGNPSGVDNSVSTWGGALRYQQGKMSSLKRLPALQILLTNTKVPRSTK 244

Query: 191 QVLKKISYIEIEYP----EINEINQKIYALMGKLSQISCQALRNKNLKVLAQAMNRQQGL 246
            ++  +    I++P     +      I     ++      A   +   VL + M+  Q  
Sbjct: 245 ALVAGVRSRLIKFPEIMAPLLTSIDAISLECERVLGEMAAAPVPEQYLVLEELMDMNQHH 304

Query: 247 LETLGVSDSKLSEIVWKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHA 306
           L  LGV  + L ++        H + SK++G+G G C I L K  L     ++    +  
Sbjct: 305 LNALGVGHASLDQLCQVTAA--HGLHSKLTGAGGGGCGITLLKPGLERAKVEAAKQALTG 362

Query: 307 KGIDIVPIT 315
            G D    +
Sbjct: 363 CGFDCWETS 371


>2x7i_A Mevalonate kinase; transferase; HET: CIT; 2.20A {Staphylococcus aureus} Length = 308 Back     alignment and structure
>3k17_A LIN0012 protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics, NEW YORK SGX research center for structural genomics; HET: PGE; 2.10A {Listeria innocua} Length = 365 Back     alignment and structure
>1kkh_A Mevalonate kinase; mixed beta sheet, phosphate-binding loop, beta-alpha-beta, transferase; 2.40A {Methanocaldococcus jannaschii} SCOP: d.14.1.5 d.58.26.3 PDB: 1vis_A Length = 317 Back     alignment and structure
>2hfs_A Mevalonate kinase, putative; GHMP kinase, trypanosomatid parasite, transferase; 1.75A {Leishmania major} PDB: 2hfu_A* Length = 332 Back     alignment and structure
>2oi2_A Mevalonate kinase; enzyme-inhibitor complex, transferase; HET: DP6; 2.50A {Streptococcus pneumoniae} Length = 292 Back     alignment and structure
>1pie_A Galactokinase; galactose, galactosemia, transferase; HET: GLA; 2.10A {Lactococcus lactis} SCOP: d.14.1.5 d.58.26.7 Length = 419 Back     alignment and structure
>1wuu_A Galactokinase; galactosemia, GHMP superfamily, transferase; HET: GLA ANP; 2.50A {Homo sapiens} SCOP: d.14.1.5 d.58.26.7 Length = 399 Back     alignment and structure
>3k85_A D-glycero-D-manno-heptose 1-phosphate kinase; bacteriodes thetaiotaomicron, protein structure initiative II(PSI II), nysgxrc; 2.28A {Bacteroides thetaiotaomicron} Length = 357 Back     alignment and structure
>2cz9_A Probable galactokinase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.50A {Pyrococcus horikoshii} PDB: 2dei_A* 2dej_A* 1s4e_A* Length = 350 Back     alignment and structure
>2aj4_A Galactokinase; galactosemia, transcription, transferase; HET: GLA ANP; 2.40A {Saccharomyces cerevisiae} Length = 548 Back     alignment and structure
>2aj4_A Galactokinase; galactosemia, transcription, transferase; HET: GLA ANP; 2.40A {Saccharomyces cerevisiae} Length = 548 Back     alignment and structure
>2a2c_A N-acetylgalactosamine kinase; galactokinase, , transferase; HET: NG1 ADP; 1.65A {Homo sapiens} PDB: 2a2d_A* Length = 478 Back     alignment and structure
>2a2c_A N-acetylgalactosamine kinase; galactokinase, , transferase; HET: NG1 ADP; 1.65A {Homo sapiens} PDB: 2a2d_A* Length = 478 Back     alignment and structure
>3lto_A Mevalonate diphosphate decarboxylase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.27A {Legionella pneumophila} Length = 323 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target324 GHMP kinase [Candidatus Liberibacter asiaticus str. psy
1kvk_A395 MK, mevalonate kinase; RMK, ATP, GHMP, transferase; HET 100.0
2hfs_A332 Mevalonate kinase, putative; GHMP kinase, trypanosomati 100.0
2x7i_A308 Mevalonate kinase; transferase; HET: CIT; 2.20A {Staphy 100.0
2cz9_A350 Probable galactokinase; structural genomics, NPPSFA, na 100.0
3k17_A365 LIN0012 protein; protein structure initiative II(PSI II 100.0
1pie_A419 Galactokinase; galactose, galactosemia, transferase; HE 100.0
2oi2_A292 Mevalonate kinase; enzyme-inhibitor complex, transferas 100.0
1wuu_A399 Galactokinase; galactosemia, GHMP superfamily, transfer 100.0
2pg9_A337 Phosphomevalonate kinase; GHMP kinase superfamily, tran 100.0
1kkh_A317 Mevalonate kinase; mixed beta sheet, phosphate-binding 100.0
2a2c_A478 N-acetylgalactosamine kinase; galactokinase, , transfer 100.0
3k85_A357 D-glycero-D-manno-heptose 1-phosphate kinase; bacteriod 100.0
2aj4_A548 Galactokinase; galactosemia, transcription, transferase 100.0
3hul_A298 HSK, HK, homoserine kinase; structural genomics, putati 99.97
1h72_C296 HK, homoserine kinase; transferase, threonine biosynthe 99.97
2v8p_A271 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; nucl 99.93
1uek_A275 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase 99.9
2hk2_A331 Diphosphomevalonate decarboxylase; mevalonate diphospha 99.89
2ww4_A283 4-diphosphocytidyl-2C-methyl-D-erythritol kinase; non-m 99.88
2gs8_A317 Mevalonate pyrophosphate decarboxylase; structural geno 99.85
3lto_A323 Mevalonate diphosphate decarboxylase; protein structure 99.79
1fi4_A416 Mevalonate 5-diphosphate decarboxylase; mixed alpha/bet 99.7
3f0n_A414 Mevalonate pyrophosphate decarboxylase; cholesterol bio 99.58
2hke_A380 Diphosphomevalonate decarboxylase, putative; mevalonate 99.54
>1kvk_A MK, mevalonate kinase; RMK, ATP, GHMP, transferase; HET: ATP; 2.40A {Rattus norvegicus} SCOP: d.14.1.5 d.58.26.3 PDB: 2r42_A* 2r3v_A Back     alignment and structure
Probab=100.00  E-value=0  Score=392.04  Aligned_cols=312  Identities=28%  Similarity=0.338  Sum_probs=251.3

Q ss_pred             CEEEEECCEEEEEECCCEEECCCEEEEEEECCEEEEEEEECCCCEEEEEECCCCCCCCCCHHH-----------------
Q ss_conf             789997170499974353308942898776772899999868984999953644446566120-----------------
Q gi|254781017|r    6 HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLDLAM-----------------   68 (324)
Q Consensus         6 ~ki~~~aPGKv~L~GEh~v~~G~~ai~~aI~~~~~~~~~~~~~~~i~i~~~~~~~~~~~~~~~-----------------   68 (324)
                      +.+.|||||||+|+|||+||+|++||++|||+|+++.+++++++.+.+++.........+...                 
T Consensus         4 ~~~~vsAPGkv~L~GEH~d~~G~~vl~~AI~~~~~v~v~~~~~~~i~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   83 (395)
T 1kvk_A            4 EVLLVSAPGKVILHGEHAVVHGKVALAVALNLRTFLVLRPQSNGKVSLNLPNVGIKQVWDVATLQLLDTGFLEQGDVPAP   83 (395)
T ss_dssp             SCEEEEEEEEEEEECTTGGGGTCCEEEEEEEEEEEEEEEECSSSEEEEEETTTTEEEEEEHHHHHTSCC-----------
T ss_pred             CEEEEEEEEEEEEEECCEEECCCCEEEEEECCCEEEEEEECCCCEEEEEECCCCCCCEECCCCCCCCCCCCCCCCCCCCC
T ss_conf             72999975599998177366699779999626589999998898799996688865121211000012343334566653


Q ss_pred             ------------------CCC------HHHHHHHHH-HHHCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCC
Q ss_conf             ------------------150------899999999-9718778738999826875354887402456655677764045
Q gi|254781017|r   69 ------------------FHP------SFSFIIMAI-NHIKPSCGFDLKVISQLDSQLGLGSSAAITVAITAALLTLQYH  123 (324)
Q Consensus        69 ------------------~~~------~~~~i~~~l-~~~~~~~g~~i~i~s~iP~g~GLGSSaa~~va~~~al~~~~~~  123 (324)
                                        ...      .+..+...+ .......|+++.++|++|.|+|||||||++||++.|++.+. +
T Consensus        84 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~i~i~S~iP~g~GLgSSaA~~va~~~al~~~~-~  162 (395)
T 1kvk_A           84 TLEQLEKLKKVAGLPRDCVGNEGLSLLAFLYLYLAICRKQRTLPSLDIMVWSELPPGAGLGSSAAYSVCVAAALLTAC-E  162 (395)
T ss_dssp             -----CHHHHHHTSSCCCSCTTHHHHHHHHHHHHHHHTTSSSCCCEEEEEEESSCTTSSSCHHHHHHHHHHHHHHHHT-T
T ss_pred             HHHHHHHHHHHCCCCHHHCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHH-C
T ss_conf             056788765430462010121103678899999999853788888699996447732476512899999999999984-5


Q ss_pred             CC---------------CCCHHHHHHHHHHHHHHCCCCCCHHHHHHHCCCEEEEEECCCEEEEEECCCCCCEEECCCCCC
Q ss_conf             66---------------660145578888776521468875447766298589985275156730477752676584179
Q gi|254781017|r  124 KE---------------PSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKIDFIFPIHLIYSGYKTP  188 (324)
Q Consensus       124 ~~---------------~~~~~i~~lA~~~E~~~~g~~sG~D~~a~~~Gg~i~~~~~~~~~~~~~~~~~l~l~~tg~~~~  188 (324)
                      ..               .+.++++++|+.+|+.++|++||+|+.++.+|+.++++..+...........+++++|+.+++
T Consensus       163 ~~~~~~~~~~~~~~~~~~~~~~i~~la~~~E~~~~g~~~G~d~~~~~~g~~~~~~~~~~~~~~~~~~~~l~l~~t~~~~~  242 (395)
T 1kvk_A          163 EVTNPLKDRGSIGSWPEEDLKSINKWAYEGERVIHGNPSGVDNSVSTWGGALRYQQGKMSSLKRLPALQILLTNTKVPRS  242 (395)
T ss_dssp             SSCCGGGGCCSEECCCHHHHHHHHHHHHHHHHHHHSSCCSHHHHHHHHCSEEEESSSCEEECSCCCCEEEEEEECCCCCC
T ss_pred             CCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHCCCEEEEECCCCCCCCCCCCCCEEEECCCCCCC
T ss_conf             44443100000011110479999999999998865888503577875588378512443234567652057832687650


Q ss_pred             HHHHHHHHHHHHHHCCCHHHHHHHHHHHHCCCCHHHHHHH-------CCCCHHHHHHHHHHHHHHHHHHCCCCHHHHHHH
Q ss_conf             8999988899886082348999999984033207889873-------048644568999998999986167877999999
Q gi|254781017|r  189 TAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQAL-------RNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIV  261 (324)
Q Consensus       189 T~~~v~~v~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~al-------~~~d~~~l~~lm~~~~~~L~~lgvs~~~l~~li  261 (324)
                      |++++..|...+.+++..   ...+.+.+..++.++.+++       ..+|++.||++|+++|..|+++++|+|++++++
T Consensus       243 t~~~~~~v~~~~~~~~~~---~~~~~~~~~~i~~~~~~~l~~~~~~~~~~d~~~lg~lm~~~~~~l~~l~vs~peld~l~  319 (395)
T 1kvk_A          243 TKALVAGVRSRLIKFPEI---MAPLLTSIDAISLECERVLGEMAAAPVPEQYLVLEELMDMNQHHLNALGVGHASLDQLC  319 (395)
T ss_dssp             HHHHHHHHHHHHHHSHHH---HHHHHHHHHHHHHHHHHHHHHHTTCCCHHHHHHHHHHHHHHHHHHHHHTCCCHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHH
T ss_conf             278899999999864667---99999999999999999999887766511345589999980998876289989999999


Q ss_pred             HHHHHCCCCEEEECCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCCEEEEEEC-CCCCCCC
Q ss_conf             9999719945997268997548999846653268999999999977978999414-5456445
Q gi|254781017|r  262 WKLREQPHIMASKISGSGLGDCVIALGKGDLNSLPYQSVNCHMHAKGIDIVPITP-SHSTSLY  323 (324)
Q Consensus       262 ~~~~~~~g~~~aklsGAG~GG~~i~l~~~~~~~~~~~~~~~~~~~~g~~~~~~~~-~~~~~~~  323 (324)
                      +.+++. | +|+|+||||||||+++|++++..+++++.+.+++...|++.+.++. .+|..+|
T Consensus       320 ~~a~~~-g-~gaklsGAG~GG~~ial~~~~~~~~~~~~~~~~~~~~g~~~~~~~i~~~Gv~i~  380 (395)
T 1kvk_A          320 QVTAAH-G-LHSKLTGAGGGGCGITLLKPGLERAKVEAAKQALTGCGFDCWETSIGAPGVSMH  380 (395)
T ss_dssp             HHHHHT-T-CEEEECSSCSSSEEEEEECTTCCHHHHHHHHHHHHHTTCEEEEEEESCCCSEEE
T ss_pred             HHHHHC-C-CEEEEECCCCCCEEEEEECCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCEEEE
T ss_conf             999857-9-689983667756899997785049999999999997699699987289937995



>2hfs_A Mevalonate kinase, putative; GHMP kinase, trypanosomatid parasite, transferase; 1.75A {Leishmania major} PDB: 2hfu_A* Back     alignment and structure
>2x7i_A Mevalonate kinase; transferase; HET: CIT; 2.20A {Staphylococcus aureus} Back     alignment and structure
>2cz9_A Probable galactokinase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.50A {Pyrococcus horikoshii} PDB: 2dei_A* 2dej_A* 1s4e_A* Back     alignment and structure
>3k17_A LIN0012 protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics, NEW YORK SGX research center for structural genomics; HET: PGE; 2.10A {Listeria innocua} Back     alignment and structure
>1pie_A Galactokinase; galactose, galactosemia, transferase; HET: GLA; 2.10A {Lactococcus lactis} SCOP: d.14.1.5 d.58.26.7 Back     alignment and structure
>2oi2_A Mevalonate kinase; enzyme-inhibitor complex, transferase; HET: DP6; 2.50A {Streptococcus pneumoniae} Back     alignment and structure
>1wuu_A Galactokinase; galactosemia, GHMP superfamily, transferase; HET: GLA ANP; 2.50A {Homo sapiens} SCOP: d.14.1.5 d.58.26.7 Back     alignment and structure
>1kkh_A Mevalonate kinase; mixed beta sheet, phosphate-binding loop, beta-alpha-beta, transferase; 2.40A {Methanocaldococcus jannaschii} SCOP: d.14.1.5 d.58.26.3 PDB: 1vis_A Back     alignment and structure
>2a2c_A N-acetylgalactosamine kinase; galactokinase, , transferase; HET: NG1 ADP; 1.65A {Homo sapiens} PDB: 2a2d_A* Back     alignment and structure
>3k85_A D-glycero-D-manno-heptose 1-phosphate kinase; bacteriodes thetaiotaomicron, protein structure initiative II(PSI II), nysgxrc; 2.28A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2aj4_A Galactokinase; galactosemia, transcription, transferase; HET: GLA ANP; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3hul_A HSK, HK, homoserine kinase; structural genomics, putative homoserine kinase, THRB, amino-acid biosynthesis, ATP-binding, cytoplasm; 2.19A {Listeria monocytogenes} Back     alignment and structure
>1h72_C HK, homoserine kinase; transferase, threonine biosynthesis; HET: ANP; 1.8A {Methanococcus jannaschii} SCOP: d.14.1.5 d.58.26.1 PDB: 1fwl_A 1fwk_A* 1h73_A* 1h74_A* Back     alignment and structure
>2v8p_A 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; nucleotide-binding, isoprene biosynthesis, transferase, ATP-binding, non-mevalonate; HET: CDP ADP; 2.1A {Aquifex aeolicus} PDB: 2v2v_A* 2v2q_A* 2v34_A* 2v2z_A* 2vf3_A* Back     alignment and structure
>1uek_A 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase; non-mevalonate pathway, GHMP superfamily; 1.70A {Thermus thermophilus} SCOP: d.14.1.5 d.58.26.5 Back     alignment and structure
>2hk2_A Diphosphomevalonate decarboxylase; mevalonate diphosphate decarboxylase, lyase; 2.30A {Staphylococcus aureus} PDB: 2hk3_A Back     alignment and structure
>2ww4_A 4-diphosphocytidyl-2C-methyl-D-erythritol kinase; non-mevalonate pathway, isoprenoid biosynthesis, transferase; HET: ADP; 2.00A {Escherichia coli} PDB: 1oj4_A* Back     alignment and structure
>2gs8_A Mevalonate pyrophosphate decarboxylase; structural genomics, PSI, protein structure initiative; HET: MSE; 1.50A {Streptococcus pyogenes m1 gas} Back     alignment and structure
>3lto_A Mevalonate diphosphate decarboxylase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.27A {Legionella pneumophila} Back     alignment and structure
>1fi4_A Mevalonate 5-diphosphate decarboxylase; mixed alpha/beta structure, ATP binding, cholesterol biosynthesis, structural genomics, PSI; 2.27A {Saccharomyces cerevisiae} SCOP: d.14.1.5 d.58.26.2 Back     alignment and structure
>3f0n_A Mevalonate pyrophosphate decarboxylase; cholesterol biosynthesis, lipid synthesis, lyase, steroid biosynthesis, sterol biosynthesis; 1.90A {Mus musculus} PDB: 3d4j_A Back     alignment and structure
>2hke_A Diphosphomevalonate decarboxylase, putative; mevalonate diphosphate decarboxylase, lyase; 1.80A {Trypanosoma brucei} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 324 GHMP kinase [Candidatus Liberibacter asiaticus str. psy
d1kkha1180 d.14.1.5 (A:1-180) Mevalonate kinase {Archaeon Methanoc 4e-20
d1k47a1194 d.14.1.5 (A:1-194) Phosphomevalonate kinase (PMK) {Stre 2e-18
d1kvka1225 d.14.1.5 (A:1-225) Mevalonate kinase {Rat (Rattus norve 8e-18
d1wuua1215 d.14.1.5 (A:2-216) Galactokinase {Human (Homo sapiens) 2e-11
d1s4ea1176 d.14.1.5 (A:5-180) Galactokinase {Archaeon Pyrococcus f 2e-11
d1piea1205 d.14.1.5 (A:9-213) Galactokinase {Lactococcus lactis [T 9e-11
d1kvka2169 d.58.26.3 (A:226-394) Mevalonate kinase {Rat (Rattus no 1e-12
d1kkha2137 d.58.26.3 (A:181-317) Mevalonate kinase {Archaeon Metha 1e-08
d1k47a2135 d.58.26.4 (A:195-329) Phosphomevalonate kinase (PMK) {S 2e-07
d1wuua2176 d.58.26.7 (A:217-392) Galactokinase {Human (Homo sapien 3e-06
d1h72c1163 d.14.1.5 (C:5-167) Homoserine kinase {Archaeon Methanoc 3e-06
d1piea2183 d.58.26.7 (A:214-396) Galactokinase {Lactococcus lactis 9e-06
>d1kkha1 d.14.1.5 (A:1-180) Mevalonate kinase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 180 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ribosomal protein S5 domain 2-like
superfamily: Ribosomal protein S5 domain 2-like
family: GHMP Kinase, N-terminal domain
domain: Mevalonate kinase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]
 Score = 92.6 bits (229), Expect = 4e-20
 Identities = 44/180 (24%), Positives = 84/180 (46%), Gaps = 16/180 (8%)

Query: 6   HKICVSAPGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSSLGQYCGSLD 65
             + +  P  ++L GEH V++G+ A+  AI+    + +   ++  I ++ +       L+
Sbjct: 4   SHMIIETPSKVILFGEHAVVYGYRAISMAIDLTSTIEIKETQEDEIILNLNDLNKSLGLN 63

Query: 66  LAMF-------HPSFSFIIMAIN------HIKPSCGFDLKVISQLDSQLGLGSSAAITVA 112
           L             F + + AI       +I+P  GF + + S++    GLGSSA+IT+ 
Sbjct: 64  LNEIKNINPNNFGDFKYCLCAIKNTLDYLNIEPKTGFKINISSKIPISCGLGSSASITIG 123

Query: 113 ITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPKYSIEKI 172
              A+    Y+KE   DEI    + +  ++QG +S  D +   + G++  +  K+   KI
Sbjct: 124 TIKAVSGF-YNKELKDDEIAKLGYMVEKEIQGKASITDTSTITYKGILEIKNNKF--RKI 180


>d1k47a1 d.14.1.5 (A:1-194) Phosphomevalonate kinase (PMK) {Streptococcus pneumoniae r6 [TaxId: 171101]} Length = 194 Back     information, alignment and structure
>d1kvka1 d.14.1.5 (A:1-225) Mevalonate kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 225 Back     information, alignment and structure
>d1wuua1 d.14.1.5 (A:2-216) Galactokinase {Human (Homo sapiens) [TaxId: 9606]} Length = 215 Back     information, alignment and structure
>d1s4ea1 d.14.1.5 (A:5-180) Galactokinase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 176 Back     information, alignment and structure
>d1piea1 d.14.1.5 (A:9-213) Galactokinase {Lactococcus lactis [TaxId: 1358]} Length = 205 Back     information, alignment and structure
>d1kvka2 d.58.26.3 (A:226-394) Mevalonate kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d1kkha2 d.58.26.3 (A:181-317) Mevalonate kinase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 137 Back     information, alignment and structure
>d1k47a2 d.58.26.4 (A:195-329) Phosphomevalonate kinase (PMK) {Streptococcus pneumoniae r6 [TaxId: 171101]} Length = 135 Back     information, alignment and structure
>d1wuua2 d.58.26.7 (A:217-392) Galactokinase {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1h72c1 d.14.1.5 (C:5-167) Homoserine kinase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 163 Back     information, alignment and structure
>d1piea2 d.58.26.7 (A:214-396) Galactokinase {Lactococcus lactis [TaxId: 1358]} Length = 183 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target324 GHMP kinase [Candidatus Liberibacter asiaticus str. psy
d1piea1205 Galactokinase {Lactococcus lactis [TaxId: 1358]} 100.0
d1kvka1225 Mevalonate kinase {Rat (Rattus norvegicus) [TaxId: 1011 100.0
d1kkha1180 Mevalonate kinase {Archaeon Methanococcus jannaschii [T 100.0
d1wuua1215 Galactokinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1s4ea1176 Galactokinase {Archaeon Pyrococcus furiosus [TaxId: 226 100.0
d1k47a1194 Phosphomevalonate kinase (PMK) {Streptococcus pneumonia 100.0
d1h72c1163 Homoserine kinase {Archaeon Methanococcus jannaschii [T 99.87
d1oj4a1163 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase 99.5
d1ueka1148 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase 99.43
d1fi4a1188 Mevalonate 5-diphosphate decarboxylase {Baker's yeast ( 98.82
d1kvka2169 Mevalonate kinase {Rat (Rattus norvegicus) [TaxId: 1011 99.94
d1kkha2137 Mevalonate kinase {Archaeon Methanococcus jannaschii [T 99.84
d1k47a2135 Phosphomevalonate kinase (PMK) {Streptococcus pneumonia 99.84
d1h72c2133 Homoserine kinase {Archaeon Methanococcus jannaschii [T 98.09
d1ueka2120 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase 97.51
d1piea2183 Galactokinase {Lactococcus lactis [TaxId: 1358]} 99.83
d1wuua2176 Galactokinase {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1s4ea2171 Galactokinase {Archaeon Pyrococcus furiosus [TaxId: 226 99.81
d1oj4a2120 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase 96.15
>d1piea1 d.14.1.5 (A:9-213) Galactokinase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure