254781018

254781018

GHMP kinase

GeneID in NCBI database:8210041Locus tag:CLIBASIA_04600
Protein GI in NCBI database:254781018Protein Accession:YP_003065431.1
Gene range:-(1018362, 1019375)Protein Length:337aa
Gene description:GHMP kinase
COG prediction:[I] Mevalonate kinase
KEGG prediction:GHMP kinase; K00869 mevalonate kinase [EC:2.7.1.36]
SEED prediction:Mevalonate kinase (EC 2.7.1.36)
Pathway involved in KEGG:Terpenoid backbone biosynthesis [PATH:las00900]
Subsystem involved in SEED:Isoprenoid Biosynthesis;
Mevalonate Branch of Isoprenoid Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED3 TM-Helix
HMMTOP4 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------
MKQQTSQTPHAHSIAPAKVILSGEYSSLYGASALAVAITFYLRALLTTIEPSLIRIINSQTIEYSFEACRLLGHQIDQRHRDFIAKKIPITSVLTHPNDLILYIFNRHLPHISCGISLDLHSTIPIGSGFGSSSAIISALSLALSSITHQPFCNKEKLIAETGYIERLQHGKTGIIDSTTIVMGGIIYINPPQIIKNETLVGEWWAINTGMPESSTGECVSFVEQHFSQSSIWSEFNAVTNEMMENIQKKDAEKTYKSVRVNQSLLESIGVVPETVGKFIRCIENNGGSAKIAGAGSIRGEKAGLVLVGGYNPEKLSSLYGYTCYKIKEDKNGTMLA
ccccccccccEEEEccEEEEEEcccEEEcccEEEEEEEcccEEEEEEEcccccEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccHHHHHHHHcccEEEEEcccccccccccccEEEEEcccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccEEEEcccccccccccEEEEEEcccHHHHHHHHHHHEEEEEEcccccccc
ccccccccccHccccccEEEEEEcEEEEEcccEEEEEEccEEEEEEEEcccccEEcccccEEccccccccccccccccccccHHcccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccEEEEcccEEEEEcccccccccccccEEEEEcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccEEcccccccccccEEEEEEcccHHHHHHHcccEEEEEcccccEEEcc
mkqqtsqtphahsiapaKVILSGEYSSLYGASALAVAITFYLRALLTTIEPSLIRIINSQTIEYSFEACRLLGHQIDQRHRDFiakkipitsvlthpnDLILYIFNRhlphiscgisldlhstipigsgfgsSSAIISALSLALSsithqpfcnkekLIAETGYIERlqhgktgiidsttivmggiiyinppqiiknetlVGEWWaintgmpesstgecVSFVEQHFSQSSIWSEFNAVTNEMMENIQKKDAEKTYKSVRVNQSLLESIGVVPETVGKFIRCIEnnggsakiagagsirgeKAGLVLVggynpeklsslygytcykikedkngtmla
mkqqtsqtphahsiapAKVILSGEYSSLYGASALAVAITFYLRALLTTIEPSLIRIINSQTIEYSFEACRLLGHQIDQRHRDFIAKkipitsvlthPNDLILYIFNRHLPHISCGISLDLHSTIPIGSGFGSSSAIISALSLALSSITHQPFCNKEKLIAETGYIERLQHGKTGIIDSTTIVMGGIIYINPPQIIKNETLVGEWWAINTGMPESSTGECVSFVEQHFSQSSIWSEFNAVTNEMMENIQKKDAEKTYKSVRVNQSLlesigvvpetVGKFIRCIENNGgsakiagagsiRGEKAGLVLVGGYNPEKLSSLYGYTCykikedkngtmla
MKQQTSQTPHAHSIAPAKVILSGEYSSLYGASALAVAITFYLRALLTTIEPSLIRIINSQTIEYSFEACRLLGHQIDQRHRDFIAKKIPITSVLTHPNDLILYIFNRHLPHISCGISLDLHSTIPigsgfgsssaiisalslalssITHQPFCNKEKLIAETGYIERLQHGKTGIIDSTTIVMGGIIYINPPQIIKNETLVGEWWAINTGMPESSTGECVSFVEQHFSQSSIWSEFNAVTNEMMENIQKKDAEKTYKSVRVNQSLLESIGVVPETVGKFIRCIENNggsakiagagsirgEKAGLVLVGGYNPEKLSSLYGYTCYKIKEDKNGTMLA
**************APAKVILSGEYSSLYGASALAVAITFYLRALLTTIEPSLIRIINSQTIEYSFEACRLLGHQIDQRHRDFIAKKIPITSVLTHPNDLILYIFNRHLPHISCGISLDLHSTIPIGSGFGSSSAIISALSLALSSITHQPFCNKEKLIAETGYIERLQHGKTGIIDSTTIVMGGIIYINPPQIIKNETLVGEWWAINTGMPESSTGECVSFVEQHFSQSSIWSEFNAVTNEMMENIQKKDAEKTYKSVRVNQSLLESIGVVPETVGKFIRCIENNGGSAKIAGAGSIRGEKAGLVLVGGYNPEKLSSLYGYTCYKIKEDKNGTMLA
************SIAPAKVILSGEYSSLYGASALAVAITFYLRALLTTIEPSLIRIINSQTIEYSFEACRLLGHQIDQRHRDFIAKKIPITSVLTHPNDLILYIFNRHLPHISCGISLDLHSTIPIGSGFGSSSAIISALSLALSSITHQPFCNKEKLIAETGYIERLQHGKTGIIDSTTIVMGGIIYINPPQIIKNETLVGEWWAINTGMPESSTGECVSFVEQHFSQSSIWSEFNAVTNEMMENIQKKDAEKTYKSVRVNQSLLESIGVVPETVGKFIRCIENNGGSAKIAGAGSIRGEKAGLVLVGGYNPEKLSSLYGYTCYKIKEDKNGTMLA
***********HSIAPAKVILSGEYSSLYGASALAVAITFYLRALLTTIEPSLIRIINSQTIEYSFEACRLLGHQIDQRHRDFIAKKIPITSVLTHPNDLILYIFNRHLPHISCGISLDLHSTIPIGSGFGSSSAIISALSLALSSITHQPFCNKEKLIAETGYIERLQHGKTGIIDSTTIVMGGIIYINPPQIIKNETLVGEWWAINTGMPESSTGECVSFVEQHFSQSSIWSEFNAVTNEMMENIQKKDAEKTYKSVRVNQSLLESIGVVPETVGKFIRCIENNGGSAKIAGAGSIRGEKAGLVLVGGYNPEKLSSLYGYTCYKIKEDKNGTMLA
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKQQTSQTPHAHSIAPAKVILSGEYSSLYGASALAVAITFYLRALLTTIEPSLIRIINSQTIEYSFEACRLLGHQIDQRHRDFIAKKIPITSVLTHPNDLILYIFNRHLPHISCGISLDLHSTIPIGSGFGSSSAIISALSLALSSITHQPFCNKEKLIAETGYIERLQHGKTGIIDSTTIVMGGIIYINPPQIIKNETLVGEWWAINTGMPESSTGECVSFVEQHFSQSSIWSEFNAVTNEMMENIQKKDAEKTYKSVRVNQSLLESIGVVPETVGKFIRCIENNGGSAKIAGAGSIRGEKAGLVLVGGYNPEKLSSLYGYTCYKIKEDKNGTMLA
MKQQTSQTPHAHSIAPAKVILSGEYSSLYGASALAVAITFYLRALLTTIEPSLIRIINSQTIEYSFEACRLLGHQIDQRHRDFIAKKIPITSVLTHPNDLILYIFNRHLPHISCGISLDLHSTIPIGSGFGSSSAIISALSLALSSITHQPFCNKEKLIAETGYIERLQHGKTGIIDSTTIVMGGIIYINPPQIIKNETLVGEWWAINTGMPESSTGECVSFVEQHFSQSSIWSEFNAVTNEMMENIQKKDAEKTYKSVRVNQSLLESIGVVPETVGKFIRCIENNGGSAKIAGAGSIRGEKAGLVLVGGYNPEKLSSLYGYTCYKIKEDKNGTMLA
MKQQTSQTPHAHSIAPAKVILSGEYSSLYGASALAVAITFYLRALLTTIEPSLIRIINSQTIEYSFEACRLLGHQIDQRHRDFIAKKIPITSVLTHPNDLILYIFNRHLPHISCGISLDLHSTIPIGSGFGSSSAIISALSLALSSITHQPFCNKEKLIAETGYIERLQHGKTGIIDSTTIVMGGIIYINPPQIIKNETLVGEWWAINTGMPESSTGECVSFVEQHFSQSSIWSEFNAVTNEMMENIQKKDAEKTYKSVRVNQSLLESIGVVPETVGKFIRCIENNGGSAKIAGAGSIRGEKAGLVLVGGYNPEKLSSLYGYTCYKIKEDKNGTMLA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target337 GHMP kinase [Candidatus Liberibacter asiaticus str. psy
254781017324 GHMP kinase [Candidatus Liberibacter asiaticus str 1e-04
254781020 337 isopentenyl pyrophosphate isomerase [Candidatus Li 0.014
>gi|254781017|ref|YP_003065430.1| GHMP kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 324 Back     alignment
 Score = 39.3 bits (90), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 67/293 (22%), Positives = 125/293 (42%), Gaps = 36/293 (12%)

Query: 15  APAKVILSGEYSSLYGASALAVAITFYLRALLTTIEPSLIRIINSQTIEYSFEACRLLGH 74
           AP  ++L GE+  L+G +AL  AI   +   LT  +  LI I +S            LG 
Sbjct: 12  APGSLVLMGEHGVLHGHAALVFAINKRVILYLTLRKDRLINIDSS------------LGQ 59

Query: 75  QIDQRHRDFIAKKIPITSVLTHPN-DLILYIFNRHLPHISCGISLDLHSTIPIGSGFGSS 133
                          +   + HP+   I+   N   P  SCG  L + S +    G GSS
Sbjct: 60  YCGS-----------LDLAMFHPSFSFIIMAINHIKP--SCGFDLKVISQLDSQLGLGSS 106

Query: 134 SAIISALSLALSSIT-HQPFCNKEKLIAETGYIERLQHGKTGIIDSTTIVMGGIIYINPP 192
           +AI  A++ AL ++  H+     E L      + ++Q   +GI  + +I  G I Y  P 
Sbjct: 107 AAITVAITAALLTLQYHKEPSPDEILTTAHAIVLKVQGISSGIDLAASIHGGLICYQMPK 166

Query: 193 QIIKNETLVGEWWAINTG--MPESSTGECVSFVEQHFSQ-----SSIWSEFNAVTNEMME 245
             I+    +     I +G   P +   + +S++E  + +       I++    ++    +
Sbjct: 167 YSIEKIDFIFPIHLIYSGYKTPTAQVLKKISYIEIEYPEINEINQKIYALMGKLSQISCQ 226

Query: 246 NIQKKDAEKTYKSVRVNQSLLESIGVVPETVGKFIRCIENNGG--SAKIAGAG 296
            ++ K+ +   +++   Q LLE++GV    + + +  +       ++KI+G+G
Sbjct: 227 ALRNKNLKVLAQAMNRQQGLLETLGVSDSKLSEIVWKLREQPHIMASKISGSG 279

>gi|254781020|ref|YP_003065433.1| isopentenyl pyrophosphate isomerase [Candidatus Liberibacter asiaticus str. psy62] Length = 337 Back     alignment
 Score = 32.0 bits (71), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 6/81 (7%)

Query: 187 IYINPPQIIKNETLVGEWWAINTGMPESSTGEC---VSFVEQHFSQSSIWSEFNAVTNEM 243
           I    P I +N+    +W  I+  +PE S  E    V F+ +  S   + S      N+M
Sbjct: 12  IVCKDPGIDRNKKFFDDWHLIHRALPEISFDEVDPSVEFLGKKLSFPLLISSMTGGNNKM 71

Query: 244 MENIQKK---DAEKTYKSVRV 261
           +E I +     AEKT  ++ V
Sbjct: 72  IERINRNLAIAAEKTKVAMAV 92

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target337 GHMP kinase [Candidatus Liberibacter asiaticus str. psy
315122511306 mevalonate kinase [Candidatus Liberibacter solanacearum 1 1e-112
146329462352 GHMP kinase family protein [Dichelobacter nodosus VCS17 1 1e-39
254513313360 ghmp kinase family protein [Rhodobacteraceae bacterium 1 1e-39
89094693327 mevalonate kinase, putative [Oceanospirillum sp. MED92] 1 1e-38
78486073349 GHMP kinase [Thiomicrospira crunogena XCL-2] Length = 3 1 2e-38
20429110378 mevalonate kinase [Paracoccus zeaxanthinifaciens] Lengt 1 5e-38
29653947340 putative phopshomevalonate kinase [Coxiella burnetii RS 1 1e-37
212212908340 mevalonate kinase [Coxiella burnetii CbuG_Q212] Length 1 2e-37
154707263340 mevalonate kinase [Coxiella burnetii Dugway 5J108-111] 1 3e-37
258544185353 conserved hypothetical protein [Cardiobacterium hominis 1 1e-34
>gi|315122511|ref|YP_004063000.1| mevalonate kinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 306 Back     alignment and organism information
 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 211/302 (69%), Positives = 250/302 (82%)

Query: 36  VAITFYLRALLTTIEPSLIRIINSQTIEYSFEACRLLGHQIDQRHRDFIAKKIPITSVLT 95
           + I+ YLR  LT IE  LIRI+N + IEYSFE CRL+  +IDQR+ D++A  I ITSVLT
Sbjct: 1   MTISLYLRVSLTIIESPLIRILNPKPIEYSFETCRLIAQKIDQRYSDYLAGNILITSVLT 60

Query: 96  HPNDLILYIFNRHLPHISCGISLDLHSTIPIGSGFGSSSAIISALSLALSSITHQPFCNK 155
             +DLILYIFNRH+  I  GISLDL S IPIG GFGSSSAIISALSLALS+IT +    K
Sbjct: 61  QIDDLILYIFNRHIRDIPHGISLDLDSKIPIGGGFGSSSAIISALSLALSAITGKTLQKK 120

Query: 156 EKLIAETGYIERLQHGKTGIIDSTTIVMGGIIYINPPQIIKNETLVGEWWAINTGMPESS 215
           EKLI ET YIERLQHGK+GIIDST IV GGI+Y+NP   IK+E L GEWWAINTG PESS
Sbjct: 121 EKLIDETSYIERLQHGKSGIIDSTAIVTGGIVYVNPSHTIKHENLPGEWWAINTGKPESS 180

Query: 216 TGECVSFVEQHFSQSSIWSEFNAVTNEMMENIQKKDAEKTYKSVRVNQSLLESIGVVPET 275
           TGECVSFV+Q+FS S+IW+EFNA+TN+MM+ +QK+D EK Y S+R NQSLL++IGVVP++
Sbjct: 181 TGECVSFVDQYFSHSNIWTEFNAITNQMMDGVQKQDEEKVYSSIRTNQSLLQAIGVVPQS 240

Query: 276 VGKFIRCIENNGGSAKIAGAGSIRGEKAGLVLVGGYNPEKLSSLYGYTCYKIKEDKNGTM 335
           V +FIR IEN GGSAKI+GAGS+RGE+AGLVLVGGYNP++L+ LYGYTC KIK +KNGTM
Sbjct: 241 VARFIRSIENKGGSAKISGAGSVRGEQAGLVLVGGYNPQELAILYGYTCNKIKGEKNGTM 300

Query: 336 LA 337
           LA
Sbjct: 301 LA 302


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|146329462|ref|YP_001209700.1| GHMP kinase family protein [Dichelobacter nodosus VCS1703A] Length = 352 Back     alignment and organism information
>gi|254513313|ref|ZP_05125378.1| ghmp kinase family protein [Rhodobacteraceae bacterium KLH11] Length = 360 Back     alignment and organism information
>gi|89094693|ref|ZP_01167629.1| mevalonate kinase, putative [Oceanospirillum sp. MED92] Length = 327 Back     alignment and organism information
>gi|78486073|ref|YP_391998.1| GHMP kinase [Thiomicrospira crunogena XCL-2] Length = 349 Back     alignment and organism information
>gi|20429110|emb|CAD24421.1| mevalonate kinase [Paracoccus zeaxanthinifaciens] Length = 378 Back     alignment and organism information
>gi|29653947|ref|NP_819639.1| putative phopshomevalonate kinase [Coxiella burnetii RSA 493] Length = 340 Back     alignment and organism information
>gi|212212908|ref|YP_002303844.1| mevalonate kinase [Coxiella burnetii CbuG_Q212] Length = 340 Back     alignment and organism information
>gi|154707263|ref|YP_001424028.1| mevalonate kinase [Coxiella burnetii Dugway 5J108-111] Length = 340 Back     alignment and organism information
>gi|258544185|ref|ZP_05704419.1| conserved hypothetical protein [Cardiobacterium hominis ATCC 15826] Length = 353 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target337 GHMP kinase [Candidatus Liberibacter asiaticus str. psy
TIGR00549273 TIGR00549, mevalon_kin, mevalonate kinase 3e-21
KOG1511397 KOG1511, KOG1511, KOG1511, Mevalonate kinase MVK/ERG12 2e-14
PRK03926302 PRK03926, PRK03926, mevalonate kinase; Provisional 2e-14
PTZ00298328 PTZ00298, PTZ00298, mevalonate kinase; Provisional 2e-05
COG1577307 COG1577, ERG12, Mevalonate kinase [Lipid metabolism] 3e-25
COG0153390 COG0153, GalK, Galactokinase [Carbohydrate transport an 1e-07
COG2605333 COG2605, COG2605, Predicted kinase related to galactoki 4e-05
TIGR00131386 TIGR00131, gal_kin, galactokinase 7e-04
pfam0028867 pfam00288, GHMP_kinases_N, GHMP kinases N terminal doma 1e-06
PLN02451370 PLN02451, PLN02451, homoserine kinase 1e-04
COG4542293 COG4542, PduX, Protein involved in propanediol utilizat 6e-04
COG0083299 COG0083, ThrB, Homoserine kinase [Amino acid transport 0.002
PLN02521 497 PLN02521, PLN02521, galactokinase 0.002
COG1829283 COG1829, COG1829, Predicted archaeal kinase (sugar kina 2e-05
PRK01212301 PRK01212, PRK01212, homoserine kinase; Provisional 2e-04
TIGR00191302 TIGR00191, thrB, homoserine kinase 0.001
PLN02677387 PLN02677, PLN02677, mevalonate kinase 0.003
>gnl|CDD|161922 TIGR00549, mevalon_kin, mevalonate kinase Back     alignment and domain information
>gnl|CDD|36724 KOG1511, KOG1511, KOG1511, Mevalonate kinase MVK/ERG12 [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|179677 PRK03926, PRK03926, mevalonate kinase; Provisional Back     alignment and domain information
>gnl|CDD|140319 PTZ00298, PTZ00298, mevalonate kinase; Provisional Back     alignment and domain information
>gnl|CDD|31765 COG1577, ERG12, Mevalonate kinase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|30502 COG0153, GalK, Galactokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|32597 COG2605, COG2605, Predicted kinase related to galactokinase and mevalonate kinase [General function prediction only] Back     alignment and domain information
>gnl|CDD|161727 TIGR00131, gal_kin, galactokinase Back     alignment and domain information
>gnl|CDD|144028 pfam00288, GHMP_kinases_N, GHMP kinases N terminal domain Back     alignment and domain information
>gnl|CDD|178070 PLN02451, PLN02451, homoserine kinase Back     alignment and domain information
>gnl|CDD|34189 COG4542, PduX, Protein involved in propanediol utilization, and related proteins (includes coumermycin biosynthetic protein), possible kinase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|30432 COG0083, ThrB, Homoserine kinase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|178136 PLN02521, PLN02521, galactokinase Back     alignment and domain information
>gnl|CDD|32014 COG1829, COG1829, Predicted archaeal kinase (sugar kinase superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|179248 PRK01212, PRK01212, homoserine kinase; Provisional Back     alignment and domain information
>gnl|CDD|129295 TIGR00191, thrB, homoserine kinase Back     alignment and domain information
>gnl|CDD|178281 PLN02677, PLN02677, mevalonate kinase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 337 GHMP kinase [Candidatus Liberibacter asiaticus str. psy
PRK03926302 mevalonate kinase; Provisional 100.0
PTZ00298328 mevalonate kinase; Provisional 100.0
COG1577307 ERG12 Mevalonate kinase [Lipid metabolism] 100.0
PRK05322387 galactokinase; Provisional 100.0
PRK05101382 galactokinase; Provisional 100.0
KOG1511397 consensus 100.0
PRK03817351 galactokinase; Provisional 100.0
PRK00555363 galactokinase; Provisional 100.0
COG0153390 GalK Galactokinase [Carbohydrate transport and metaboli 100.0
TIGR00131500 gal_kin galactokinase; InterPro: IPR000705 Galactokinas 100.0
PTZ00290468 galactokinase; Provisional 100.0
TIGR01220367 Pmev_kin_Gr_pos phosphomevalonate kinase; InterPro: IPR 100.0
COG2605333 Predicted kinase related to galactokinase and mevalonat 100.0
PRK13412974 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransf 100.0
KOG0631489 consensus 99.98
PRK01212293 homoserine kinase; Provisional 99.93
COG0083299 ThrB Homoserine kinase [Amino acid transport and metabo 99.9
PRK03188299 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Prov 99.9
PRK01123283 shikimate kinase; Provisional 99.89
PRK02534308 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Prov 99.88
PTZ00299336 homoserine kinase; Provisional 99.87
COG3890337 ERG8 Phosphomevalonate kinase [Lipid metabolism] 99.85
TIGR01219499 Pmev_kin_ERG8 phosphomevalonate kinase; InterPro: IPR01 99.8
PRK00343279 ipk 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; 99.8
KOG4519459 consensus 99.79
KOG4644948 consensus 99.76
TIGR00154322 ispE 4-diphosphocytidyl-2C-methyl-D-erythritol kinase; 99.7
TIGR01920273 Shik_kin_archae shikimate kinase; InterPro: IPR010189 S 99.67
COG1685278 Archaeal shikimate kinase [Amino acid transport and met 99.65
COG1829283 Predicted archaeal kinase (sugar kinase superfamily) [G 99.27
KOG2833395 consensus 99.15
COG1907312 Predicted archaeal sugar kinases [General function pred 98.98
TIGR00549345 mevalon_kin mevalonate kinase; InterPro: IPR006205 Meva 100.0
PRK00128281 ipk 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; 99.89
PRK04344284 consensus 99.88
PRK03009287 consensus 99.82
PRK01726312 consensus 99.81
PRK04943288 consensus 99.8
PRK03288283 consensus 99.79
COG1947289 IspE 4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosph 99.76
PRK04648295 consensus 99.76
PRK00650288 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Prov 99.76
PRK05905258 hypothetical protein; Provisional 99.69
COG4542293 PduX Protein involved in propanediol utilization, and r 99.34
TIGR00191359 thrB homoserine kinase; InterPro: IPR000870 Saccharomyc 99.9
COG3407329 MVD1 Mevalonate pyrophosphate decarboxylase [Lipid meta 99.42
TIGR01240325 mevDPdecarb diphosphomevalonate decarboxylase; InterPro 98.9
KOG1537355 consensus 98.65
PRK04181254 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Prov 99.65
pfam1050952 GalKase_gal_bdg Galactokinase galactose-binding signatu 99.33
pfam0028867 GHMP_kinases_N GHMP kinases N terminal domain. This fam 99.2
pfam0854482 GHMP_kinases_C GHMP kinases C terminal. This family inc 98.16
TIGR00144337 beta_RFAP_syn beta-ribofuranosylaminobenzene 5'-phospha 95.4
>PRK03926 mevalonate kinase; Provisional Back     alignment and domain information
>PTZ00298 mevalonate kinase; Provisional Back     alignment and domain information
>COG1577 ERG12 Mevalonate kinase [Lipid metabolism] Back     alignment and domain information
>PRK05322 galactokinase; Provisional Back     alignment and domain information
>PRK05101 galactokinase; Provisional Back     alignment and domain information
>KOG1511 consensus Back     alignment and domain information
>PRK03817 galactokinase; Provisional Back     alignment and domain information
>PRK00555 galactokinase; Provisional Back     alignment and domain information
>COG0153 GalK Galactokinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00131 gal_kin galactokinase; InterPro: IPR000705 Galactokinase catalyses the first reaction in the galactose metabolism pathway, the ATP-dependent phosphorylation of galactose, yielding galactose-1-phosphate , Back     alignment and domain information
>PTZ00290 galactokinase; Provisional Back     alignment and domain information
>TIGR01220 Pmev_kin_Gr_pos phosphomevalonate kinase; InterPro: IPR005917 Protein kinases are a group of enzymes that possess a catalytic subunit which transfers the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function Back     alignment and domain information
>COG2605 Predicted kinase related to galactokinase and mevalonate kinase [General function prediction only] Back     alignment and domain information
>PRK13412 fkp bifunctional fucokinase/L-fucose-1-P-guanylyltransferase; Provisional Back     alignment and domain information
>KOG0631 consensus Back     alignment and domain information
>PRK01212 homoserine kinase; Provisional Back     alignment and domain information
>COG0083 ThrB Homoserine kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK03188 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional Back     alignment and domain information
>PRK01123 shikimate kinase; Provisional Back     alignment and domain information
>PRK02534 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional Back     alignment and domain information
>PTZ00299 homoserine kinase; Provisional Back     alignment and domain information
>COG3890 ERG8 Phosphomevalonate kinase [Lipid metabolism] Back     alignment and domain information
>TIGR01219 Pmev_kin_ERG8 phosphomevalonate kinase; InterPro: IPR016005 Phosphomevalonate kinase (2 Back     alignment and domain information
>PRK00343 ipk 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional Back     alignment and domain information
>KOG4519 consensus Back     alignment and domain information
>KOG4644 consensus Back     alignment and domain information
>TIGR00154 ispE 4-diphosphocytidyl-2C-methyl-D-erythritol kinase; InterPro: IPR004424 4-diphosphocytidyl-2C-methyl-D-erythritol kinase is a member of the family of GHMP kinases that were previously designated as conserved hypothetical protein YchB or as isopentenyl monophosphate kinase Back     alignment and domain information
>TIGR01920 Shik_kin_archae shikimate kinase; InterPro: IPR010189 Shikimate kinase (2 Back     alignment and domain information
>COG1685 Archaeal shikimate kinase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG1829 Predicted archaeal kinase (sugar kinase superfamily) [General function prediction only] Back     alignment and domain information
>KOG2833 consensus Back     alignment and domain information
>COG1907 Predicted archaeal sugar kinases [General function prediction only] Back     alignment and domain information
>TIGR00549 mevalon_kin mevalonate kinase; InterPro: IPR006205 Mevalonate kinase (2 Back     alignment and domain information
>PRK00128 ipk 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional Back     alignment and domain information
>PRK04344 consensus Back     alignment and domain information
>PRK03009 consensus Back     alignment and domain information
>PRK01726 consensus Back     alignment and domain information
>PRK04943 consensus Back     alignment and domain information
>PRK03288 consensus Back     alignment and domain information
>COG1947 IspE 4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate synthase [Lipid metabolism] Back     alignment and domain information
>PRK04648 consensus Back     alignment and domain information
>PRK00650 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional Back     alignment and domain information
>PRK05905 hypothetical protein; Provisional Back     alignment and domain information
>COG4542 PduX Protein involved in propanediol utilization, and related proteins (includes coumermycin biosynthetic protein), possible kinase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR00191 thrB homoserine kinase; InterPro: IPR000870 Saccharomyces cerevisiae strains containing the erg8-1 mutation are temperature sensitive for growth due to a defect in phosphomevalonate kinase, an enzyme of isoprene and ergosterol biosynthesis Back     alignment and domain information
>COG3407 MVD1 Mevalonate pyrophosphate decarboxylase [Lipid metabolism] Back     alignment and domain information
>TIGR01240 mevDPdecarb diphosphomevalonate decarboxylase; InterPro: IPR005935 Synonyms: mevalonate diphosphate decarboxylase; pyrophosphomevalonate decarboxylase Back     alignment and domain information
>KOG1537 consensus Back     alignment and domain information
>PRK04181 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional Back     alignment and domain information
>pfam10509 GalKase_gal_bdg Galactokinase galactose-binding signature Back     alignment and domain information
>pfam00288 GHMP_kinases_N GHMP kinases N terminal domain Back     alignment and domain information
>pfam08544 GHMP_kinases_C GHMP kinases C terminal Back     alignment and domain information
>TIGR00144 beta_RFAP_syn beta-ribofuranosylaminobenzene 5'-phosphate synthase family; InterPro: IPR004422 This protein family contains several archaeal examples of beta-ribofuranosylaminobenzene 5-prime-phosphate synthase (beta-RFAP synthase), an enzyme involved in methanopterin biosynthesis Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target337 GHMP kinase [Candidatus Liberibacter asiaticus str. psy
1vis_A324 Crystal Structure Of Mevalonate Kinase Length = 324 1e-39
1kkh_A317 Crystal Structure Of The Methanococcus Jannaschii M 1e-39
1pie_A419 Crystal Structure Of Lactococcus Lactis Galactokina 3e-38
2cz9_A350 Crystal Structure Of Galactokinase From Pyrococcus 8e-38
1s4e_A352 Pyrococcus Furiosus Galactokinase In Complex With G 4e-36
1wuu_A399 Crystal Structure Of Human Galactokinase Complexed 1e-34
2r3v_A396 The Biochemical And Structural Basis For Feedback I 4e-34
1kvk_A395 The Structure Of Binary Complex Between A Mammalian 9e-34
2hfu_A332 Crystal Structure Of L. Major Mevalonate Kinase In 1e-31
2hfs_A332 Crystal Structure Of L. Major Mevalonate Kinase Len 2e-30
2oi2_A292 Streptococcus Pneumoniae Mevalonate Kinase In Compl 3e-28
2x7i_A308 Crystal Structure Of Mevalonate Kinase From Methici 6e-24
2a2d_A478 X-Ray Structure Of Human N-Acetyl Galactosamine Kin 3e-22
3k85_A357 Crystal Structure Of A D-Glycero-D-Manno-Heptose 1- 2e-18
3k17_A365 Crystal Structure Of A Lin0012 Protein From Listeri 3e-15
3gon_A335 Streptococcus Pneumoniae Phosphomevalonate Kinase I 5e-13
1k47_A337 Crystal Structure Of The Streptococcus Pneumoniae P 3e-12
2a2d_A478 X-Ray Structure Of Human N-Acetyl Galactosamine Kin 8e-08
2aj4_A548 Crystal Structure Of Saccharomyces Cerevisiae Galac 3e-06
2aj4_A 548 Crystal Structure Of Saccharomyces Cerevisiae Galac 1e-21
3hul_A298 Structure Of Putative Homoserine Kinase Thrb From L 5e-08
>gi|40890012|pdb|1VIS|A Chain A, Crystal Structure Of Mevalonate Kinase Length = 324 Back     alignment and structure
 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 64/299 (21%), Positives = 121/299 (40%), Gaps = 24/299 (8%)

Query: 16  PAKVILSGEYSSLYGASALAVAITFYLRALLTTIEPSLIRIINSQTIEYSFEACRLLGHQ 75
           P+KVIL GE++ +YG  A+++AI       +   +   I I+N   +  S          
Sbjct: 8   PSKVILFGEHAVVYGYRAISMAIDLTSTIEIKETQEDEI-ILNLNDLNKSLGLNLNEIKN 66

Query: 76  IDQRHRDFIAKKIPITSVLTHPNDLILYIFNRHLPHISCGISLDLHSTIPIGSGFGSSSA 135
           I+  +               +    I    +        G  +++ S IPI  G GSS++
Sbjct: 67  INPNN----------FGDFKYCLCAIKNTLDYLNIEPKTGFKINISSKIPISCGLGSSAS 116

Query: 136 IISALSLALSSITHQPFCNKEKLIAETGYIERLQHGKTGIIDSTTIVMGGIIYINPPQII 195
           I      A+S   ++     +++      +E+   GK  I D++TI   GI+ I   +  
Sbjct: 117 ITIGTIKAVSGFYNKEL-KDDEIAKLGYMVEKEIQGKASITDTSTITYKGILEIKNNKFR 175

Query: 196 KNE------TLVGEWWAINTGMPESSTGECVSFVEQHFSQSSIWSEFNAVTNEMMENIQK 249
           K +          ++  +     +  T E V+ V +  ++  I+ E + V +E    ++ 
Sbjct: 176 KIKGEFEEFLKNCKFLIVYAEKRKKKTAELVNEVAKIENKDEIFKEIDKVIDE---ALKI 232

Query: 250 KDAEKTYKSVRVNQSLLESIGVVPETVGKFIRCIENNGGSAKIAGAGSIRGEKAGLVLV 308
           K+ E   K +  N  LL+ + +    + + +      G  AK+ GAG   G    ++LV
Sbjct: 233 KNKEDFGKLMTKNHELLKKLNISTPKLDRIVDIGNRFGFGAKLTGAG---GGGCVIILV 288


>gi|20150886|pdb|1KKH|A Chain A, Crystal Structure Of The Methanococcus Jannaschii Mevalonate Kinase Length = 317 Back     alignment and structure
>gi|37927469|pdb|1PIE|A Chain A, Crystal Structure Of Lactococcus Lactis Galactokinase Complexed With Galactose Length = 419 Back     alignment and structure
gi|116666959|pdb|2CZ9|A Chain A, Crystal Structure Of Galactokinase From Pyrococcus Horikoshi Length = 350 Back     alignment and structure
>gi|47169015|pdb|1S4E|A Chain A, Pyrococcus Furiosus Galactokinase In Complex With Galactose, Adp And Magnesium Length = 352 Back     alignment and structure
>gi|58177238|pdb|1WUU|A Chain A, Crystal Structure Of Human Galactokinase Complexed With Mgamppnp And Galactose Length = 399 Back     alignment and structure
gi|192988174|pdb|2R3V|A Chain A, The Biochemical And Structural Basis For Feedback Inhibition Of Mevalonate Kinase And Isoprenoid Metabolism Length = 396 Back     alignment and structure
gi|20151083|pdb|1KVK|A Chain A, The Structure Of Binary Complex Between A Mammalian Mevalonate Kinase And Atp: Insights Into The Reaction Mechanism And Human Inherited Disease Length = 395 Back     alignment and structure
>gi|146387259|pdb|2HFU|A Chain A, Crystal Structure Of L. Major Mevalonate Kinase In Complex With R-Mevalonate Length = 332 Back     alignment and structure
>gi|146387257|pdb|2HFS|A Chain A, Crystal Structure Of L. Major Mevalonate Kinase Length = 332 Back     alignment and structure
gi|146386624|pdb|2OI2|A Chain A, Streptococcus Pneumoniae Mevalonate Kinase In Complex With Diphosphomevalonate Length = 292 Back     alignment and structure
>gi|301015707|pdb|2X7I|A Chain A, Crystal Structure Of Mevalonate Kinase From Methicillin- Resistant Staphylococcus Aureus Mrsa252 Length = 308 Back     alignment and structure
>gi|71042624|pdb|2A2D|A Chain A, X-Ray Structure Of Human N-Acetyl Galactosamine Kinase Complexed With Mn-Amppnp And N-Acetyl Glactosamine Length = 478 Back     alignment and structure
>gi|270346706|pdb|3K85|A Chain A, Crystal Structure Of A D-Glycero-D-Manno-Heptose 1-Phosphate Kinase From Bacteriodes Thetaiotaomicron Length = 357 Back     alignment and structure
>gi|260656454|pdb|3K17|A Chain A, Crystal Structure Of A Lin0012 Protein From Listeria Innocua Length = 365 Back     alignment and structure
gi|254574856|pdb|3GON|A Chain A, Streptococcus Pneumoniae Phosphomevalonate Kinase In Complex With Phosphomevalonate And Amppnp Length = 335 Back     alignment and structure
>gi|21465779|pdb|1K47|A Chain A, Crystal Structure Of The Streptococcus Pneumoniae Phosphomevalonate Kinase (Pmk) Length = 337 Back     alignment and structure
>gi|71042624|pdb|2A2D|A Chain A, X-Ray Structure Of Human N-Acetyl Galactosamine Kinase Complexed With Mn-Amppnp And N-Acetyl Glactosamine Length = 478 Back     alignment and structure
>gi|75766245|pdb|2AJ4|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Galactokinase In Complex With Galactose And Mg:amppnp Length = 548 Back     alignment and structure
>gi|75766245|pdb|2AJ4|A Chain A, Crystal Structure Of Saccharomyces Cerevisiae Galactokinase In Complex With Galactose And Mg:amppnp Length = 548 Back     alignment and structure
>gi|254221101|pdb|3HUL|A Chain A, Structure Of Putative Homoserine Kinase Thrb From Listeria Monocytogenes Length = 298 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target337 GHMP kinase [Candidatus Liberibacter asiaticus str. psy
1kkh_A317 Mevalonate kinase; mixed beta sheet, phosphate-binding 9e-25
2x7i_A308 Mevalonate kinase; transferase; HET: CIT; 2.20A {Staphy 1e-21
3k17_A365 LIN0012 protein; protein structure initiative II(PSI II 4e-21
2pg9_A337 Phosphomevalonate kinase; GHMP kinase superfamily, tran 7e-18
3k85_A357 D-glycero-D-manno-heptose 1-phosphate kinase; bacteriod 5e-15
2oi2_A292 Mevalonate kinase; enzyme-inhibitor complex, transferas 5e-15
2hfs_A332 Mevalonate kinase, putative; GHMP kinase, trypanosomati 9e-15
1wuu_A399 Galactokinase; galactosemia, GHMP superfamily, transfer 2e-07
2cz9_A350 Probable galactokinase; structural genomics, NPPSFA, na 8e-05
1kvk_A395 MK, mevalonate kinase; RMK, ATP, GHMP, transferase; HET 1e-24
1pie_A419 Galactokinase; galactose, galactosemia, transferase; HE 3e-15
2aj4_A 548 Galactokinase; galactosemia, transcription, transferase 6e-09
1h72_C296 HK, homoserine kinase; transferase, threonine biosynthe 2e-07
3hul_A298 HSK, HK, homoserine kinase; structural genomics, putati 8e-05
2a2c_A 478 N-acetylgalactosamine kinase; galactokinase, , transfer 3e-07
3lto_A323 Mevalonate diphosphate decarboxylase; protein structure 0.002
>1kkh_A Mevalonate kinase; mixed beta sheet, phosphate-binding loop, beta-alpha-beta, transferase; 2.40A {Methanocaldococcus jannaschii} SCOP: d.14.1.5 d.58.26.3 PDB: 1vis_A Length = 317 Back     alignment and structure
 Score =  109 bits (273), Expect = 9e-25
 Identities = 55/295 (18%), Positives = 107/295 (36%), Gaps = 18/295 (6%)

Query: 9   PHAHSI---APAKVILSGEYSSLYGASALAVAITFYLRALLTTIEPSLIRIINSQTIEYS 65
           P    +    P+KVIL GE++ +YG  A+++AI       +   +   I +  +      
Sbjct: 1   PRGSHMIIETPSKVILFGEHAVVYGYRAISMAIDLTSTIEIKETQEDEIILNLND----- 55

Query: 66  FEACRLLGHQIDQRHRDFIAKKIPITSVLTHPNDLILYIFNRHLPHISCGISLDLHSTIP 125
                 L   +     +             +    I    +        G  +++ S IP
Sbjct: 56  ------LNKSLGLNLNEIKNINPNNFGDFKYCLCAIKNTLDYLNIEPKTGFKINISSKIP 109

Query: 126 IGSGFGSSSAIISALSLALSSITHQPFCNKEKLIAETGYIERLQHGKTGIIDSTTIVMGG 185
           I  G GSS++I      A+S   ++     +++      +E+   GK  I D++TI   G
Sbjct: 110 ISCGLGSSASITIGTIKAVSGFYNKEL-KDDEIAKLGYMVEKEIQGKASITDTSTITYKG 168

Query: 186 IIYINPPQIIKNETLVGEWWAINTGMPESSTGE---CVSFVEQHFSQSSIWSEFNAVTNE 242
           I+ I   +  K +    E+      +   +          V +     +    F  +   
Sbjct: 169 ILEIKNNKFRKIKGEFEEFLKNCKFLIVYAEKRKKKTAELVNEVAKIENKDEIFKEIDKV 228

Query: 243 MMENIQKKDAEKTYKSVRVNQSLLESIGVVPETVGKFIRCIENNGGSAKIAGAGS 297
           + E ++ K+ E   K +  N  LL+ + +    + + +      G  AK+ GAG 
Sbjct: 229 IDEALKIKNKEDFGKLMTKNHELLKKLNISTPKLDRIVDIGNRFGFGAKLTGAGG 283


>2x7i_A Mevalonate kinase; transferase; HET: CIT; 2.20A {Staphylococcus aureus} Length = 308 Back     alignment and structure
>3k17_A LIN0012 protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics, NEW YORK SGX research center for structural genomics; HET: PGE; 2.10A {Listeria innocua} Length = 365 Back     alignment and structure
>3k85_A D-glycero-D-manno-heptose 1-phosphate kinase; bacteriodes thetaiotaomicron, protein structure initiative II(PSI II), nysgxrc; 2.28A {Bacteroides thetaiotaomicron} Length = 357 Back     alignment and structure
>2oi2_A Mevalonate kinase; enzyme-inhibitor complex, transferase; HET: DP6; 2.50A {Streptococcus pneumoniae} Length = 292 Back     alignment and structure
>2hfs_A Mevalonate kinase, putative; GHMP kinase, trypanosomatid parasite, transferase; 1.75A {Leishmania major} PDB: 2hfu_A* Length = 332 Back     alignment and structure
>1wuu_A Galactokinase; galactosemia, GHMP superfamily, transferase; HET: GLA ANP; 2.50A {Homo sapiens} SCOP: d.14.1.5 d.58.26.7 Length = 399 Back     alignment and structure
>2cz9_A Probable galactokinase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.50A {Pyrococcus horikoshii} PDB: 2dei_A* 2dej_A* 1s4e_A* Length = 350 Back     alignment and structure
>1kvk_A MK, mevalonate kinase; RMK, ATP, GHMP, transferase; HET: ATP; 2.40A {Rattus norvegicus} SCOP: d.14.1.5 d.58.26.3 PDB: 2r42_A* 2r3v_A Length = 395 Back     alignment and structure
>1pie_A Galactokinase; galactose, galactosemia, transferase; HET: GLA; 2.10A {Lactococcus lactis} SCOP: d.14.1.5 d.58.26.7 Length = 419 Back     alignment and structure
>2aj4_A Galactokinase; galactosemia, transcription, transferase; HET: GLA ANP; 2.40A {Saccharomyces cerevisiae} Length = 548 Back     alignment and structure
>1h72_C HK, homoserine kinase; transferase, threonine biosynthesis; HET: ANP; 1.8A {Methanococcus jannaschii} SCOP: d.14.1.5 d.58.26.1 PDB: 1fwl_A 1fwk_A* 1h73_A* 1h74_A* Length = 296 Back     alignment and structure
>3hul_A HSK, HK, homoserine kinase; structural genomics, putative homoserine kinase, THRB, amino-acid biosynthesis, ATP-binding, cytoplasm; 2.19A {Listeria monocytogenes} Length = 298 Back     alignment and structure
>2a2c_A N-acetylgalactosamine kinase; galactokinase, , transferase; HET: NG1 ADP; 1.65A {Homo sapiens} PDB: 2a2d_A* Length = 478 Back     alignment and structure
>3lto_A Mevalonate diphosphate decarboxylase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.27A {Legionella pneumophila} Length = 323 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target337 GHMP kinase [Candidatus Liberibacter asiaticus str. psy
1kvk_A395 MK, mevalonate kinase; RMK, ATP, GHMP, transferase; HET 100.0
1kkh_A317 Mevalonate kinase; mixed beta sheet, phosphate-binding 100.0
2a2c_A478 N-acetylgalactosamine kinase; galactokinase, , transfer 100.0
1wuu_A399 Galactokinase; galactosemia, GHMP superfamily, transfer 100.0
2hfs_A332 Mevalonate kinase, putative; GHMP kinase, trypanosomati 100.0
1pie_A419 Galactokinase; galactose, galactosemia, transferase; HE 100.0
3k17_A365 LIN0012 protein; protein structure initiative II(PSI II 100.0
2x7i_A308 Mevalonate kinase; transferase; HET: CIT; 2.20A {Staphy 100.0
3k85_A357 D-glycero-D-manno-heptose 1-phosphate kinase; bacteriod 100.0
2aj4_A548 Galactokinase; galactosemia, transcription, transferase 100.0
2cz9_A350 Probable galactokinase; structural genomics, NPPSFA, na 100.0
2pg9_A337 Phosphomevalonate kinase; GHMP kinase superfamily, tran 100.0
3hul_A298 HSK, HK, homoserine kinase; structural genomics, putati 99.95
1h72_C296 HK, homoserine kinase; transferase, threonine biosynthe 99.91
2v8p_A271 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; nucl 99.9
2hk2_A331 Diphosphomevalonate decarboxylase; mevalonate diphospha 99.87
2gs8_A317 Mevalonate pyrophosphate decarboxylase; structural geno 99.8
3lto_A323 Mevalonate diphosphate decarboxylase; protein structure 99.69
1fi4_A416 Mevalonate 5-diphosphate decarboxylase; mixed alpha/bet 99.61
3f0n_A414 Mevalonate pyrophosphate decarboxylase; cholesterol bio 99.36
2hke_A380 Diphosphomevalonate decarboxylase, putative; mevalonate 99.33
2oi2_A292 Mevalonate kinase; enzyme-inhibitor complex, transferas 100.0
2ww4_A283 4-diphosphocytidyl-2C-methyl-D-erythritol kinase; non-m 99.84
1uek_A275 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase 99.79
>1kvk_A MK, mevalonate kinase; RMK, ATP, GHMP, transferase; HET: ATP; 2.40A {Rattus norvegicus} SCOP: d.14.1.5 d.58.26.3 PDB: 2r42_A* 2r3v_A Back     alignment and structure
Probab=100.00  E-value=0  Score=344.43  Aligned_cols=325  Identities=18%  Similarity=0.181  Sum_probs=244.5

Q ss_pred             CEEEECCCEEEEECCCEEECCCEEEEEEECCCEEEEEEECCCCEEEEEECCCCCCC-CCCCCCCCCC-C---CCCCCCCC
Q ss_conf             08998581799974454407954899876672799999848982999955766675-3210012333-3---43321111
Q gi|254781018|r   10 HAHSIAPAKVILSGEYSSLYGASALAVAITFYLRALLTTIEPSLIRIINSQTIEYS-FEACRLLGHQ-I---DQRHRDFI   84 (337)
Q Consensus        10 ~~~~~APGKi~L~GEh~v~~G~~ai~~aI~~~~~v~i~~~~~~~~~~~s~~~~~~~-~~~~~~~~~~-~---~~~~~~~~   84 (337)
                      -.+++|||||+|+|||+||+|++||++|||+|+++.+++++++.+++.+....... +......... .   ...+....
T Consensus         5 ~~~vsAPGkv~L~GEH~d~~G~~vl~~AI~~~~~v~v~~~~~~~i~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   84 (395)
T 1kvk_A            5 VLLVSAPGKVILHGEHAVVHGKVALAVALNLRTFLVLRPQSNGKVSLNLPNVGIKQVWDVATLQLLDTGFLEQGDVPAPT   84 (395)
T ss_dssp             CEEEEEEEEEEEECTTGGGGTCCEEEEEEEEEEEEEEEECSSSEEEEEETTTTEEEEEEHHHHHTSCC------------
T ss_pred             EEEEEEEEEEEEEECCEEECCCCEEEEEECCCEEEEEEECCCCEEEEEECCCCCCCEECCCCCCCCCCCCCCCCCCCCCH
T ss_conf             29999755999981773666997799996265899999988987999966888651212110000123433345666530


Q ss_pred             CC-------------CCCHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHHHHHHHCCC
Q ss_conf             12-------------21033477788899999875115667887699998055410389853037899999999981877
Q gi|254781018|r   85 AK-------------KIPITSVLTHPNDLILYIFNRHLPHISCGISLDLHSTIPIGSGFGSSSAIISALSLALSSITHQP  151 (337)
Q Consensus        85 ~~-------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~i~i~s~iP~~~GLGSSaA~~va~~~al~~~~~~~  151 (337)
                      ..             ............................|+++.++|++|.++|||||||++||++.+++.++++.
T Consensus        85 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~i~i~S~iP~g~GLgSSaA~~va~~~al~~~~~~~  164 (395)
T 1kvk_A           85 LEQLEKLKKVAGLPRDCVGNEGLSLLAFLYLYLAICRKQRTLPSLDIMVWSELPPGAGLGSSAAYSVCVAAALLTACEEV  164 (395)
T ss_dssp             ----CHHHHHHTSSCCCSCTTHHHHHHHHHHHHHHHTTSSSCCCEEEEEEESSCTTSSSCHHHHHHHHHHHHHHHHTTSS
T ss_pred             HHHHHHHHHHCCCCHHHCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHCCC
T ss_conf             56788765430462010121103678899999999853788888699996447732476512899999999999984544


Q ss_pred             CCC--------------HHHHHHHHHHHHHCCCCCCCCHHHHHHHHCCCEEEECCCCCCCCCCCCCEEEEECCCCCCCHH
Q ss_conf             540--------------258999999864115778773457876532630240278520014788439997497145379
Q gi|254781018|r  152 FCN--------------KEKLIAETGYIERLQHGKTGIIDSTTIVMGGIIYINPPQIIKNETLVGEWWAINTGMPESSTG  217 (337)
Q Consensus       152 ~~~--------------~~~~~~~a~~~e~~~~~~~sg~D~~~~~~gg~~~~~~~~~~~~~~~~~~~~~i~~~~~~~st~  217 (337)
                      ...              .+++.++++.+|+.++|.+||+|++++.+|+.+.++..+.......+...+++..+....+|.
T Consensus       165 ~~~~~~~~~~~~~~~~~~~~i~~la~~~E~~~~g~~~G~d~~~~~~g~~~~~~~~~~~~~~~~~~~~l~l~~t~~~~~t~  244 (395)
T 1kvk_A          165 TNPLKDRGSIGSWPEEDLKSINKWAYEGERVIHGNPSGVDNSVSTWGGALRYQQGKMSSLKRLPALQILLTNTKVPRSTK  244 (395)
T ss_dssp             CCGGGGCCSEECCCHHHHHHHHHHHHHHHHHHHSSCCSHHHHHHHHCSEEEESSSCEEECSCCCCEEEEEEECCCCCCHH
T ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCHHHHHHHCCCEEEEECCCCCCCCCCCCCCEEEECCCCCCCHH
T ss_conf             44310000001111047999999999999886588850357787558837851244323456765205783268765027


Q ss_pred             HHHHHHHHHHCCC-----HHHHHHHHHHHHHHHHHHC-------CCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
Q ss_conf             9999999764120-----6899987654899999983-------872168999999599999718997799999999985
Q gi|254781018|r  218 ECVSFVEQHFSQS-----SIWSEFNAVTNEMMENIQK-------KDAEKTYKSVRVNQSLLESIGVVPETVGKFIRCIEN  285 (337)
Q Consensus       218 ~~~~~~~~~~~~~-----~~~~~~~~i~~~~~~al~~-------~d~~~l~~~~~~~~~ll~~l~vs~~~l~~l~~~~~~  285 (337)
                      +.+..++......     ..++++.+++.++.++++.       +|++.++++|+++|.++++++||+|++|+|++.+++
T Consensus       245 ~~~~~v~~~~~~~~~~~~~~~~~~~~i~~~~~~~l~~~~~~~~~~d~~~lg~lm~~~~~~l~~l~vs~peld~l~~~a~~  324 (395)
T 1kvk_A          245 ALVAGVRSRLIKFPEIMAPLLTSIDAISLECERVLGEMAAAPVPEQYLVLEELMDMNQHHLNALGVGHASLDQLCQVTAA  324 (395)
T ss_dssp             HHHHHHHHHHHHSHHHHHHHHHHHHHHHHHHHHHHHHHTTCCCHHHHHHHHHHHHHHHHHHHHHTCCCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHH
T ss_conf             88999999998646679999999999999999999988776651134558999998099887628998999999999985


Q ss_pred             CCCEEEECCCCCCCCCEEEEEEEECCCHHHH-H------HHCCCEEEEEEECCCCEEEC
Q ss_conf             7980895078867885089999857997999-9------74598699999879970929
Q gi|254781018|r  286 NGGSAKIAGAGSIRGEKAGLVLVGGYNPEKL-S------SLYGYTCYKIKEDKNGTMLA  337 (337)
Q Consensus       286 ~g~~ak~sGAG~~~Gg~~~~~l~~~~~~~~~-~------~~~~~~~~~~~~~~~G~~i~  337 (337)
                      .|+|+|+||||   ||+|.++|.++.+.++. .      +..+++++.++++.+|++|.
T Consensus       325 ~g~gaklsGAG---~GG~~ial~~~~~~~~~~~~~~~~~~~~g~~~~~~~i~~~Gv~i~  380 (395)
T 1kvk_A          325 HGLHSKLTGAG---GGGCGITLLKPGLERAKVEAAKQALTGCGFDCWETSIGAPGVSMH  380 (395)
T ss_dssp             TTCEEEECSSC---SSSEEEEEECTTCCHHHHHHHHHHHHHTTCEEEEEEESCCCSEEE
T ss_pred             CCCEEEEECCC---CCCEEEEEECCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCEEEE
T ss_conf             79689983667---756899997785049999999999997699699987289937995



>1kkh_A Mevalonate kinase; mixed beta sheet, phosphate-binding loop, beta-alpha-beta, transferase; 2.40A {Methanocaldococcus jannaschii} SCOP: d.14.1.5 d.58.26.3 PDB: 1vis_A Back     alignment and structure
>2a2c_A N-acetylgalactosamine kinase; galactokinase, , transferase; HET: NG1 ADP; 1.65A {Homo sapiens} PDB: 2a2d_A* Back     alignment and structure
>1wuu_A Galactokinase; galactosemia, GHMP superfamily, transferase; HET: GLA ANP; 2.50A {Homo sapiens} SCOP: d.14.1.5 d.58.26.7 Back     alignment and structure
>2hfs_A Mevalonate kinase, putative; GHMP kinase, trypanosomatid parasite, transferase; 1.75A {Leishmania major} PDB: 2hfu_A* Back     alignment and structure
>1pie_A Galactokinase; galactose, galactosemia, transferase; HET: GLA; 2.10A {Lactococcus lactis} SCOP: d.14.1.5 d.58.26.7 Back     alignment and structure
>3k17_A LIN0012 protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics, NEW YORK SGX research center for structural genomics; HET: PGE; 2.10A {Listeria innocua} Back     alignment and structure
>2x7i_A Mevalonate kinase; transferase; HET: CIT; 2.20A {Staphylococcus aureus} Back     alignment and structure
>3k85_A D-glycero-D-manno-heptose 1-phosphate kinase; bacteriodes thetaiotaomicron, protein structure initiative II(PSI II), nysgxrc; 2.28A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2aj4_A Galactokinase; galactosemia, transcription, transferase; HET: GLA ANP; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2cz9_A Probable galactokinase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.50A {Pyrococcus horikoshii} PDB: 2dei_A* 2dej_A* 1s4e_A* Back     alignment and structure
>3hul_A HSK, HK, homoserine kinase; structural genomics, putative homoserine kinase, THRB, amino-acid biosynthesis, ATP-binding, cytoplasm; 2.19A {Listeria monocytogenes} Back     alignment and structure
>1h72_C HK, homoserine kinase; transferase, threonine biosynthesis; HET: ANP; 1.8A {Methanococcus jannaschii} SCOP: d.14.1.5 d.58.26.1 PDB: 1fwl_A 1fwk_A* 1h73_A* 1h74_A* Back     alignment and structure
>2v8p_A 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; nucleotide-binding, isoprene biosynthesis, transferase, ATP-binding, non-mevalonate; HET: CDP ADP; 2.1A {Aquifex aeolicus} PDB: 2v2v_A* 2v2q_A* 2v34_A* 2v2z_A* 2vf3_A* Back     alignment and structure
>2hk2_A Diphosphomevalonate decarboxylase; mevalonate diphosphate decarboxylase, lyase; 2.30A {Staphylococcus aureus} PDB: 2hk3_A Back     alignment and structure
>2gs8_A Mevalonate pyrophosphate decarboxylase; structural genomics, PSI, protein structure initiative; HET: MSE; 1.50A {Streptococcus pyogenes m1 gas} Back     alignment and structure
>3lto_A Mevalonate diphosphate decarboxylase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.27A {Legionella pneumophila} Back     alignment and structure
>1fi4_A Mevalonate 5-diphosphate decarboxylase; mixed alpha/beta structure, ATP binding, cholesterol biosynthesis, structural genomics, PSI; 2.27A {Saccharomyces cerevisiae} SCOP: d.14.1.5 d.58.26.2 Back     alignment and structure
>3f0n_A Mevalonate pyrophosphate decarboxylase; cholesterol biosynthesis, lipid synthesis, lyase, steroid biosynthesis, sterol biosynthesis; 1.90A {Mus musculus} PDB: 3d4j_A Back     alignment and structure
>2hke_A Diphosphomevalonate decarboxylase, putative; mevalonate diphosphate decarboxylase, lyase; 1.80A {Trypanosoma brucei} Back     alignment and structure
>2oi2_A Mevalonate kinase; enzyme-inhibitor complex, transferase; HET: DP6; 2.50A {Streptococcus pneumoniae} Back     alignment and structure
>2ww4_A 4-diphosphocytidyl-2C-methyl-D-erythritol kinase; non-mevalonate pathway, isoprenoid biosynthesis, transferase; HET: ADP; 2.00A {Escherichia coli} PDB: 1oj4_A* Back     alignment and structure
>1uek_A 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase; non-mevalonate pathway, GHMP superfamily; 1.70A {Thermus thermophilus} SCOP: d.14.1.5 d.58.26.5 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 337 GHMP kinase [Candidatus Liberibacter asiaticus str. psy
d1kvka1225 d.14.1.5 (A:1-225) Mevalonate kinase {Rat (Rattus norve 1e-17
d1kkha1180 d.14.1.5 (A:1-180) Mevalonate kinase {Archaeon Methanoc 1e-14
d1k47a1194 d.14.1.5 (A:1-194) Phosphomevalonate kinase (PMK) {Stre 3e-10
d1piea1205 d.14.1.5 (A:9-213) Galactokinase {Lactococcus lactis [T 1e-08
d1s4ea1176 d.14.1.5 (A:5-180) Galactokinase {Archaeon Pyrococcus f 2e-08
d1wuua1215 d.14.1.5 (A:2-216) Galactokinase {Human (Homo sapiens) 1e-07
d1h72c1163 d.14.1.5 (C:5-167) Homoserine kinase {Archaeon Methanoc 5e-05
d1kvka2169 d.58.26.3 (A:226-394) Mevalonate kinase {Rat (Rattus no 9e-05
>d1kvka1 d.14.1.5 (A:1-225) Mevalonate kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 225 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ribosomal protein S5 domain 2-like
superfamily: Ribosomal protein S5 domain 2-like
family: GHMP Kinase, N-terminal domain
domain: Mevalonate kinase
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 84.6 bits (208), Expect = 1e-17
 Identities = 43/212 (20%), Positives = 77/212 (36%), Gaps = 32/212 (15%)

Query: 15  APAKVILSGEYSSLYGASALAVAITFYLRALLTTIEPSLIRIINSQ---TIEYSFEACRL 71
           AP KVIL GE++ ++G  ALAVA+      +L       + +          +     +L
Sbjct: 10  APGKVILHGEHAVVHGKVALAVALNLRTFLVLRPQSNGKVSLNLPNVGIKQVWDVATLQL 69

Query: 72  LG---HQIDQRHRDFIAKKIPITSVLTHPND------------LILYIFNRHLPHISCGI 116
           L     +        + +   +  V   P D            L LY+           +
Sbjct: 70  LDTGFLEQGDVPAPTLEQLEKLKKVAGLPRDCVGNEGLSLLAFLYLYLAICRKQRTLPSL 129

Query: 117 SLDLHSTIPIGSGFGSSSAIISALSLALSSITHQPFCNKE-------------KLIAETG 163
            + + S +P G+G GSS+A    ++ AL +   +     +             K I +  
Sbjct: 130 DIMVWSELPPGAGLGSSAAYSVCVAAALLTACEEVTNPLKDRGSIGSWPEEDLKSINKWA 189

Query: 164 Y-IERLQHGKTGIIDSTTIVMGGIIYINPPQI 194
           Y  ER+ HG    +D++    GG +     ++
Sbjct: 190 YEGERVIHGNPSGVDNSVSTWGGALRYQQGKM 221


>d1kkha1 d.14.1.5 (A:1-180) Mevalonate kinase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 180 Back     information, alignment and structure
>d1k47a1 d.14.1.5 (A:1-194) Phosphomevalonate kinase (PMK) {Streptococcus pneumoniae r6 [TaxId: 171101]} Length = 194 Back     information, alignment and structure
>d1piea1 d.14.1.5 (A:9-213) Galactokinase {Lactococcus lactis [TaxId: 1358]} Length = 205 Back     information, alignment and structure
>d1s4ea1 d.14.1.5 (A:5-180) Galactokinase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 176 Back     information, alignment and structure
>d1wuua1 d.14.1.5 (A:2-216) Galactokinase {Human (Homo sapiens) [TaxId: 9606]} Length = 215 Back     information, alignment and structure
>d1h72c1 d.14.1.5 (C:5-167) Homoserine kinase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 163 Back     information, alignment and structure
>d1kvka2 d.58.26.3 (A:226-394) Mevalonate kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target337 GHMP kinase [Candidatus Liberibacter asiaticus str. psy
d1wuua1215 Galactokinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1piea1205 Galactokinase {Lactococcus lactis [TaxId: 1358]} 100.0
d1kkha1180 Mevalonate kinase {Archaeon Methanococcus jannaschii [T 100.0
d1kvka1225 Mevalonate kinase {Rat (Rattus norvegicus) [TaxId: 1011 100.0
d1k47a1194 Phosphomevalonate kinase (PMK) {Streptococcus pneumonia 99.97
d1s4ea1176 Galactokinase {Archaeon Pyrococcus furiosus [TaxId: 226 99.97
d1h72c1163 Homoserine kinase {Archaeon Methanococcus jannaschii [T 99.74
d1oj4a1163 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase 99.33
d1ueka1148 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase 99.11
d1kvka2169 Mevalonate kinase {Rat (Rattus norvegicus) [TaxId: 1011 99.83
d1kkha2137 Mevalonate kinase {Archaeon Methanococcus jannaschii [T 99.74
d1h72c2133 Homoserine kinase {Archaeon Methanococcus jannaschii [T 97.97
d1k47a2135 Phosphomevalonate kinase (PMK) {Streptococcus pneumonia 99.62
d1ueka2120 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase 96.79
d1oj4a2120 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase 96.22
d1wuua2176 Galactokinase {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1s4ea2171 Galactokinase {Archaeon Pyrococcus furiosus [TaxId: 226 99.46
d1piea2