254781019

254781019

hydroxymethylglutaryl-coenzyme A synthase

GeneID in NCBI database:8210042Locus tag:CLIBASIA_04605
Protein GI in NCBI database:254781019Protein Accession:YP_003065432.1
Gene range:-(1019338, 1020528)Protein Length:396aa
Gene description:hydroxymethylglutaryl-coenzyme A synthase
COG prediction:[I] 3-hydroxy-3-methylglutaryl CoA synthase
KEGG prediction:hydroxymethylglutaryl-coenzyme A synthase; K01641 hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
SEED prediction:Hydroxymethylglutaryl-CoA synthase (EC 2.3.3.10)
Pathway involved in KEGG:Butanoate metabolism [PATH:las00650]
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation [PATH:las00280]
Terpenoid backbone biosynthesis [PATH:las00900]
Subsystem involved in SEED:Isoprenoid Biosynthesis;
Mevalonate Branch of Isoprenoid Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390------
MAIGIEDISFYTTNQYLDLSVIAEKYRLDVAKFYVGIGQERMSVLNPDEDIVTMAAAAALPIMQNQDKNLIDTLFFATESSVDQSKSAAIWLHKLLGLNSSCRVVELKQACYSATCALHMACALVAKSPERKVLIVASDVARYDLGSSGEPTQGCGAVAILISSQTSILEIEDITGIYTNDCMDFWRPNYRRTALVDGKYSTKIYLQSLEAVWHDYQKNKGHDFNDFQYFCYHQPFTRMAEKAHIRLSKIVHQNLSVAEIEKAIGITTLYNRLIGNSYTASLYIALISLLDHSSENLAGKRVGFFSYGSGCVAEFFSGIVQKNYRKKSHQKRHQHIINSRIPISYQVYCDLHQDIIPSVEGNCTIPHTTTGPFRLATIQNHKRIYETTNFPDPSCS
ccEEEEEEEEEcccccccHHHHHHHHcccHHHHHHHccccEEEEccccccHHHHHHHHHHHHHccccHHHccEEEEEccccccccccHHHHHHHHHccccccEEEEEHHHHHHHHHHHHHHHHHHHHccccEEEEEEHHHHHccccccccccccccEEEEEEcccccccccccccccccccccccccccccccEEEccHHHHHHHHHHHHHHHHHHHHHccccHHHccEEEEcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccEEEEEEEcccHHHcccEEEEEHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHccccccccccccccccccEEEEEEEccEEEEEEccccccccc
ccEEEEEEEEEccccEEcHHHHHHHcccccccEEEcccccccccccccHHHHHHHHHHHHHHHHcccHHHccEEEEEccccccHHHHHHHHHHHHHcccccccEEEHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccEEEccccccccccccHHHHHEEEcccccHEEEcccccEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHEEHccccHHHHHHHHHHHHHHccHHHHHHHHHHHcccccEccccccccHHHHHHHHHHHHHHccHHHccccEEEEEEEccccHEEEEEEEEccccHHHHcHHHHHHHHHccccccHHHHHHHHHHHHccccccccccccccccEEEHcHHHHHEEEEEccccccccc
MAIGIEDISFYTTNQYLDLSVIAEKYRLDVAKFYVGIgqermsvlnpdeDIVTMAAAAALPIMQNQDKNLIDTLFFATESSVDQSKSAAIWLHKLLGLNSSCRVVELKQACYSATCALHMACALVAKSPERKVLIVASDvarydlgssgeptqgcGAVAILISSQTSileieditgiytndcmdfwrpnyrrtalvdgkysTKIYLQSLEAVWHDYqknkghdfndfqyfcyhqpftrMAEKAHIRLSKIVHQNLSVAEIEKAIGITTLYNRLIGNSYTASLYIALISLLdhssenlagkrvgffsygsgcvaEFFSGivqknyrkkshQKRHQHIINSRIPISYQVYCDLhqdiipsvegnctiphtttgpfrLATIQNHKRiyettnfpdpscs
maigiedisfyttnQYLDLSVIAEKYRLDVAKFYVGIGQERMSVLNPDEDIVTMAAAAALPIMQNQDKNLIDTLFFATESSVDQSKSAAIWLHKLLGLNSSCRVVELKQACYSATCALHMACALVAKSPERKVLIVASDVARYDLGssgeptqgcGAVAILISSQTSILEIEDITGIYTNDCMDFWRPNYRRTALVDGKYSTKIYLQSLEAVWHDYQKNKGHDFNDFQYFCYHQPFTRMAEKAHIRLSKIVHQNLSVAEIEKAIGITTLYNRLIGNSYTASLYIALISLLDHSSENLAGKRVGFFSYGSGCVAEFFSGIVQKNYRKKSHQKRHQHIINSRIPISYQVYCDLHQDIIPSVEGNCTIPHTTTGPFRLATIQNHKRIyettnfpdpscs
MAIGIEDISFYTTNQYLDLSVIAEKYRLDVAKFYVGIGQERMSVLNPDEDIVTMAAAAALPIMQNQDKNLIDTLFFATESSVDQSKSAAIWLHKLLGLNSSCRVVELKQACYSATCALHMACALVAKSPERKVLIVASDVARYDLGSSGEPTQGCGAVAILISSQTSILEIEDITGIYTNDCMDFWRPNYRRTALVDGKYSTKIYLQSLEAVWHDYQKNKGHDFNDFQYFCYHQPFTRMAEKAHIRLSKIVHQNLSVAEIEKAIGITTLYNRLIGNSYTASLYIALISLLDHSSENLAGKRVGFFSYGSGCVAEFFSGIVQKNYRKKSHQKRHQHIINSRIPISYQVYCDLHQDIIPSVEGNCTIPHTTTGPFRLATIQNHKRIYETTNFPDPSCS
MAIGIEDISFYTTNQYLDLSVIAEKYRLDVAKFYVGIGQERMSVLNPDEDIVTMAAAAALPIMQNQDKNLIDTLFFATESSVDQSKSAAIWLHKLLGLNSSCRVVELKQACYSATCALHMACALVAKSPERKVLIVASDVARYDLGSSGEPTQGCGAVAILISSQTSILEIEDITGIYTNDCMDFWRPNYRRTALVDGKYSTKIYLQSLEAVWHDYQKNKGHDFNDFQYFCYHQPFTRMAEKAHIRLSKIVHQNLSVAEIEKAIGITTLYNRLIGNSYTASLYIALISLLDHSSENLAGKRVGFFSYGSGCVAEFFSGIVQKNYRKKSH*KRHQHIINSRIPISYQVYCDLHQDIIP*VEGNCTIPHTTTGPFRLATIQNHKRIYETT********
MAIGIEDISFYTTNQYLDLSVIAEKYRLDVAKFYVGIGQERMSVLNPDEDIVTMAAAAALPIMQNQDKNLIDTLFFATESSVDQSKSAAIWLHKLLGLNSSCRVVELKQACYSATCALHMACALVAKSPERKVLIVASDVARYDLGSSGEPTQGCGAVAILISSQTSILEIEDITGIYTNDCMDFWRPNYRRTALVDGKYSTKIYLQSLEAVWHDYQKNKGHDFNDFQYFCYHQPFTRMAEKAHIRLSKIVHQNLSVAEIEKAIGITTLYNRLIGNSYTASLYIALISLLDHSSENLAGKRVGFFSYGSGCVAEFFSGIVQKN***********HIINSRIPISYQVYCDLHQDIIPSVEGNCTIPHTTTGPFRLATIQNHKRIYETT********
MAIGIEDISFYTTNQYLDLSVIAEKYRLDVAKFYVGIGQERMSVLNPDEDIVTMAAAAALPIMQNQDKNLIDTLFFATESSVDQSKSAAIWLHKLLGLNSSCRVVELKQACYSATCALHMACALVAKSPERKVLIVASDVARYDLGSSGEPTQGCGAVAILISSQTSILEIEDITGIYTNDCMDFWRPNYRRTALVDGKYSTKIYLQSLEAVWHDYQKNKGHDFNDFQYFCYHQPFTRMAEKAHIRLSKIVHQNLSVAEIEKAIGITTLYNRLIGNSYTASLYIALISLLDHSSENLAGKRVGFFSYGSGCVAEFFSGIVQKNYRKKSHQKRHQHIINSRIPISYQVYCDLHQDIIPSVEGNCTIPHTTTGPFRLATIQNHKRIYETTN*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIGIEDISFYTTNQYLDLSVIAEKYRLDVAKFYVGIGQERMSVLNPDEDIVTMAAAAALPIMQNQDKNLIDTLFFATESSVDQSKSAAIWLHKLLGLNSSCRVVELKQACYSATCALHMACALVAKSPERKVLIVASDVARYDLGSSGEPTQGCGAVAILISSQTSILEIEDITGIYTNDCMDFWRPNYRRTALVDGKYSTKIYLQSLEAVWHDYQKNKGHDFNDFQYFCYHQPFTRMAEKAHIRLSKIVHQNLSVAEIEKAIGITTLYNRLIGNSYTASLYIALISLLDHSSENLAGKRVGFFSYGSGCVAEFFSGIVQKNYRKKSHQKRHQHIINSRIPISYQVYCDLHQDIIPSVEGNCTIPHTTTGPFRLATIQNHKRIYETTNFPDPSCS
MAIGIEDISFYTTNQYLDLSVIAEKYRLDVAKFYVGIGQERMSVLNPDEDIVTMAAAAALPIMQNQDKNLIDTLFFATESSVDQSKSAAIWLHKLLGLNSSCRVVELKQACYSATCALHMACALVAKSPERKVLIVASDVARYDLGSSGEPTQGCGAVAILISSQTSILEIEDITGIYTNDCMDFWRPNYRRTALVDGKYSTKIYLQSLEAVWHDYQKNKGHDFNDFQYFCYHQPFTRMAEKAHIRLSKIVHQNLSVAEIEKAIGITTLYNRLIGNSYTASLYIALISLLDHSSENLAGKRVGFFSYGSGCVAEFFSGIVQKNYRKKSHQKRHQHIINSRIPISYQVYCDLHQDIIPSVEGNCTIPHTTTGPFRLATIQNHKRIYETTNFPDPSCS
MAIGIEDISFYTTNQYLDLSVIAEKYRLDVAKFYVGIGQERMSVLNPDEDIVTMAAAAALPIMQNQDKNLIDTLFFATESSVDQSKSAAIWLHKLLGLNSSCRVVELKQACYSATCALHMACALVAKSPERKVLIVASDVARYDLGSSGEPTQGCGAVAILISSQTSILEIEDITGIYTNDCMDFWRPNYRRTALVDGKYSTKIYLQSLEAVWHDYQKNKGHDFNDFQYFCYHQPFTRMAEKAHIRLSKIVHQNLSVAEIEKAIGITTLYNRLIGNSYTASLYIALISLLDHSSENLAGKRVGFFSYGSGCVAEFFSGIVQKNYRKKSHQKRHQHIINSRIPISYQVYCDLHQDIIPSVEGNCTIPHTTTGPFRLATIQNHKRIYETTNFPDPSCS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target396 hydroxymethylglutaryl-coenzyme A synthase [Candidatus L
315122510401 hydroxymethylglutaryl-CoA synthase [Candidatus Liberiba 1 0.0
89094692388 Hydroxymethylglutaryl-coenzyme A synthase [Oceanospiril 1 1e-132
9695275389 3-hydroxy-3-methylglutaryl CoA synthase [Streptomyces s 1 1e-112
289470274391 HMG-CoA synthase [Streptomyces sp. SN-1061M] Length = 3 1 1e-111
20429109388 HMG-CoA synthase [Paracoccus zeaxanthinifaciens] Length 1 1e-109
78486060389 hydroxymethylglutaryl-coenzyme A synthase [Thiomicrospi 1 1e-108
254513375393 hydroxymethylglutaryl-CoA synthase [Rhodobacteraceae ba 1 1e-108
312190953391 HMG-CoA synthase [Streptomyces cinnamonensis] Length = 1 1e-108
54024181403 putative 3-hydroxy-3-methylglutaryl-CoA synthase [Nocar 1 1e-108
295047690420 putative 3-hydroxy-3-methylglutaryl-CoA synthase [Strep 1 1e-107
>gi|315122510|ref|YP_004062999.1| hydroxymethylglutaryl-CoA synthase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 401 Back     alignment and organism information
 Score =  700 bits (1807), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/390 (83%), Positives = 362/390 (92%)

Query: 1   MAIGIEDISFYTTNQYLDLSVIAEKYRLDVAKFYVGIGQERMSVLNPDEDIVTMAAAAAL 60
           MAIGIEDISFYTTNQYLDLSVIA+K+ +D+ KFY GIGQERMSVL+PDEDIVTMAAAAAL
Sbjct: 1   MAIGIEDISFYTTNQYLDLSVIADKHCVDIGKFYHGIGQERMSVLHPDEDIVTMAAAAAL 60

Query: 61  PIMQNQDKNLIDTLFFATESSVDQSKSAAIWLHKLLGLNSSCRVVELKQACYSATCALHM 120
           PI++NQDK+LI TLFFATESS+DQSKSA IWLHKLLGL S+CRVVELKQACYSATCALHM
Sbjct: 61  PIIKNQDKDLISTLFFATESSIDQSKSAGIWLHKLLGLQSACRVVELKQACYSATCALHM 120

Query: 121 ACALVAKSPERKVLIVASDVARYDLGSSGEPTQGCGAVAILISSQTSILEIEDITGIYTN 180
           ACALVAK P+RKVLI+ASDVARYDLGSSGEPTQGCGAVAIL+SSQ SILEIED TGIYT+
Sbjct: 121 ACALVAKIPQRKVLIIASDVARYDLGSSGEPTQGCGAVAILVSSQASILEIEDTTGIYTS 180

Query: 181 DCMDFWRPNYRRTALVDGKYSTKIYLQSLEAVWHDYQKNKGHDFNDFQYFCYHQPFTRMA 240
           DCMDFWRPNYR TALVDGKYSTKIYLQSL+A W DYQKN GHDF+ FQYFCYHQPFTRMA
Sbjct: 181 DCMDFWRPNYRSTALVDGKYSTKIYLQSLKAAWQDYQKNNGHDFSQFQYFCYHQPFTRMA 240

Query: 241 EKAHIRLSKIVHQNLSVAEIEKAIGITTLYNRLIGNSYTASLYIALISLLDHSSENLAGK 300
           EKAHI LSK V +N+S +EIEK IG T +YNRLIGNSYTASLY++ ISLLDHSS+NLAGK
Sbjct: 241 EKAHIHLSKTVGKNISTSEIEKHIGKTMIYNRLIGNSYTASLYLSFISLLDHSSQNLAGK 300

Query: 301 RVGFFSYGSGCVAEFFSGIVQKNYRKKSHQKRHQHIINSRIPISYQVYCDLHQDIIPSVE 360
           R+GFFSYGSGC+AEFFSGI+QK+Y KKSH++ HQ+IINSRIPI+YQ+Y DLHQDI+ S E
Sbjct: 301 RIGFFSYGSGCIAEFFSGIIQKDYHKKSHKEHHQNIINSRIPITYQLYYDLHQDIVVSAE 360

Query: 361 GNCTIPHTTTGPFRLATIQNHKRIYETTNF 390
           G+CTIPHTTTGPFRLATI+NHKRIYE TNF
Sbjct: 361 GDCTIPHTTTGPFRLATIKNHKRIYEETNF 390


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|89094692|ref|ZP_01167628.1| Hydroxymethylglutaryl-coenzyme A synthase [Oceanospirillum sp. MED92] Length = 388 Back     alignment and organism information
>gi|9695275|dbj|BAB07795.1| 3-hydroxy-3-methylglutaryl CoA synthase [Streptomyces sp. CL190] Length = 389 Back     alignment and organism information
>gi|289470274|gb|ADC96649.1| HMG-CoA synthase [Streptomyces sp. SN-1061M] Length = 391 Back     alignment and organism information
>gi|20429109|emb|CAD24420.1| HMG-CoA synthase [Paracoccus zeaxanthinifaciens] Length = 388 Back     alignment and organism information
>gi|78486060|ref|YP_391985.1| hydroxymethylglutaryl-coenzyme A synthase [Thiomicrospira crunogena XCL-2] Length = 389 Back     alignment and organism information
>gi|254513375|ref|ZP_05125440.1| hydroxymethylglutaryl-CoA synthase [Rhodobacteraceae bacterium KLH11] Length = 393 Back     alignment and organism information
>gi|312190953|gb|ADQ43378.1| HMG-CoA synthase [Streptomyces cinnamonensis] Length = 391 Back     alignment and organism information
>gi|54024181|ref|YP_118423.1| putative 3-hydroxy-3-methylglutaryl-CoA synthase [Nocardia farcinica IFM 10152] Length = 403 Back     alignment and organism information
>gi|295047690|dbj|BAJ05879.1| putative 3-hydroxy-3-methylglutaryl-CoA synthase [Streptomyces sp. SANK 60405] Length = 420 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target396 hydroxymethylglutaryl-coenzyme A synthase [Candidatus L
TIGR01835379 TIGR01835, HMG-CoA-S_prok, 3-hydroxy-3-methylglutaryl C 1e-138
TIGR00748345 TIGR00748, HMG_CoA_syn_Arc, hydroxymethylglutaryl-CoA s 2e-18
COG3425377 COG3425, PksG, 3-hydroxy-3-methylglutaryl CoA synthase 2e-92
cd00827324 cd00827, init_cond_enzymes, "initiating" condensing enz 5e-52
KOG1393462 KOG1393, KOG1393, KOG1393, Hydroxymethylglutaryl-CoA sy 1e-43
TIGR01833454 TIGR01833, HMG-CoA-S_euk, 3-hydroxy-3-methylglutaryl-Co 2e-40
PLN02577459 PLN02577, PLN02577, hydroxymethylglutaryl-CoA synthase 1e-38
cd00831361 cd00831, CHS_like, Chalcone and stilbene synthases; pla 2e-04
PRK04262347 PRK04262, PRK04262, hypothetical protein; Provisional 7e-25
pfam08540282 pfam08540, HMG_CoA_synt_C, Hydroxymethylglutaryl-coenzy 4e-21
pfam01154171 pfam01154, HMG_CoA_synt_N, Hydroxymethylglutaryl-coenzy 3e-17
cd00830320 cd00830, KAS_III, Ketoacyl-acyl carrier protein synthas 1e-11
COG0332323 COG0332, FabH, 3-oxoacyl-[acyl-carrier-protein] 4e-09
PRK12879325 PRK12879, PRK12879, 3-oxoacyl-(acyl carrier protein) sy 7e-05
pfam00195228 pfam00195, Chal_sti_synt_N, Chalcone and stilbene synth 1e-04
PRK12880353 PRK12880, PRK12880, 3-oxoacyl-(acyl carrier protein) sy 1e-04
PLN03172393 PLN03172, PLN03172, chalcone synthase family protein; P 1e-04
PLN03173391 PLN03173, PLN03173, chalcone synthase; Provisional 2e-04
TIGR00747318 TIGR00747, fabH, 3-oxoacyl-(acyl-carrier-protein) synth 0.003
>gnl|CDD|130894 TIGR01835, HMG-CoA-S_prok, 3-hydroxy-3-methylglutaryl CoA synthase, prokaryotic clade Back     alignment and domain information
>gnl|CDD|129831 TIGR00748, HMG_CoA_syn_Arc, hydroxymethylglutaryl-CoA synthase, putative Back     alignment and domain information
>gnl|CDD|33231 COG3425, PksG, 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|29414 cd00827, init_cond_enzymes, "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes Back     alignment and domain information
>gnl|CDD|36607 KOG1393, KOG1393, KOG1393, Hydroxymethylglutaryl-CoA synthase [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|162552 TIGR01833, HMG-CoA-S_euk, 3-hydroxy-3-methylglutaryl-CoA-synthase, eukaryotic clade Back     alignment and domain information
>gnl|CDD|178189 PLN02577, PLN02577, hydroxymethylglutaryl-CoA synthase Back     alignment and domain information
>gnl|CDD|29418 cd00831, CHS_like, Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs Back     alignment and domain information
>gnl|CDD|179804 PRK04262, PRK04262, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|149555 pfam08540, HMG_CoA_synt_C, Hydroxymethylglutaryl-coenzyme A synthase C terminal Back     alignment and domain information
>gnl|CDD|110176 pfam01154, HMG_CoA_synt_N, Hydroxymethylglutaryl-coenzyme A synthase N terminal Back     alignment and domain information
>gnl|CDD|29417 cd00830, KAS_III, Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems Back     alignment and domain information
>gnl|CDD|30680 COG0332, FabH, 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information
>gnl|CDD|183809 PRK12879, PRK12879, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>gnl|CDD|109260 pfam00195, Chal_sti_synt_N, Chalcone and stilbene synthases, N-terminal domain Back     alignment and domain information
>gnl|CDD|171793 PRK12880, PRK12880, 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>gnl|CDD|178716 PLN03172, PLN03172, chalcone synthase family protein; Provisional Back     alignment and domain information
>gnl|CDD|178717 PLN03173, PLN03173, chalcone synthase; Provisional Back     alignment and domain information
>gnl|CDD|162020 TIGR00747, fabH, 3-oxoacyl-(acyl-carrier-protein) synthase III Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 396 hydroxymethylglutaryl-coenzyme A synthase [Candidatus L
TIGR01835412 HMG-CoA-S_prok hydroxymethylglutaryl-CoA synthase; Inte 100.0
TIGR01833461 HMG-CoA-S_euk hydroxymethylglutaryl-CoA synthase; Inter 100.0
COG3425377 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid met 100.0
KOG1393462 consensus 100.0
PRK04262346 hypothetical protein; Provisional 100.0
TIGR00748347 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, put 100.0
TIGR00747329 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III; Int 100.0
PRK09352319 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 100.0
PRK09258339 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 100.0
COG0332323 FabH 3-oxoacyl-[acyl-carrier-protein] 100.0
PRK07204329 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 100.0
PRK06816378 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 100.0
PRK12879326 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 100.0
CHL00203327 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisi 100.0
PRK07515372 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 100.0
PRK05963327 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 100.0
cd00830320 KAS_III Ketoacyl-acyl carrier protein synthase III (KAS 100.0
PRK06840337 hypothetical protein; Validated 100.0
PRK12880353 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed 100.0
cd00827324 init_cond_enzymes "initiating" condensing enzymes are a 100.0
cd00831361 CHS_like Chalcone and stilbene synthases; plant-specifi 100.0
COG3424356 BcsA Predicted naringenin-chalcone synthase [Secondary 100.0
cd00834406 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synth 99.21
PRK07314411 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 99.15
PRK05952379 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 99.13
TIGR03150407 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2. FabB 99.07
PRK06333424 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 99.05
PRK07103415 polyketide beta-ketoacyl:acyl carrier protein synthase; 98.89
PRK08722414 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 98.87
PRK08768411 consensus 98.85
PRK07967406 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed 98.79
PRK08439405 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 98.69
pfam08540282 HMG_CoA_synt_C Hydroxymethylglutaryl-coenzyme A synthas 100.0
pfam01154171 HMG_CoA_synt_N Hydroxymethylglutaryl-coenzyme A synthas 100.0
pfam00195228 Chal_sti_synt_N Chalcone and stilbene synthases, N-term 99.93
pfam08392290 FAE1_CUT1_RppA FAE1/Type III polyketide synthase-like p 99.45
cd00327254 cond_enzymes Condensing enzymes; Family of enzymes that 99.97
cd00825332 decarbox_cond_enzymes decarboxylating condensing enzyme 99.45
PRK06059399 lipid-transfer protein; Provisional 99.44
PRK06365415 acetyl-CoA acetyltransferase; Provisional 99.39
PRK06363387 consensus 99.37
PRK06364389 consensus 99.34
PRK06065393 acetyl-CoA acetyltransferase; Provisional 99.29
PRK06066375 acetyl-CoA acetyltransferase; Provisional 99.0
smart00825424 PKS_KS Beta-ketoacyl synthase. The structure of beta-ke 98.94
PTZ00050477 3-oxoacyl-acyl carrier protein synthase; Provisional 98.94
PRK09116336 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 98.89
PRK06147346 3-oxoacyl-(acyl carrier protein) synthase; Validated 98.88
cd00828407 elong_cond_enzymes "elongating" condensing enzymes are 98.88
PRK07910418 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 98.85
cd00832399 CLF Chain-length factor (CLF) is a factor required for 98.82
cd00833421 PKS polyketide synthases (PKSs) polymerize simple fatty 98.78
PRK08304336 stage V sporulation protein AD; Validated 98.07
pfam07451329 SpoVAD Stage V sporulation protein AD (SpoVAD). This fa 98.04
PRK12404334 stage V sporulation protein AD; Provisional 97.89
pfam0854190 ACP_syn_III_C 3-Oxoacyl-[acyl-carrier-protein (ACP)] sy 99.58
pfam02797151 Chal_sti_synt_C Chalcone and stilbene synthases, C-term 99.23
pfam02803123 Thiolase_C Thiolase, C-terminal domain. Thiolase is rep 91.41
pfam02801117 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal doma 91.02
cd00829375 SCP-x_thiolase Thiolase domain associated with sterol c 99.47
PRK06158384 thiolase; Provisional 99.33
TIGR02845331 spore_V_AD stage V sporulation protein AD; InterPro: IP 98.68
COG0304412 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid m 98.22
COG3321 1061 Polyketide synthase modules and related proteins [Secon 97.65
KOG1394440 consensus 97.31
PRK06519397 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 96.87
KOG1202 2376 consensus 95.66
PRK06157400 acetyl-CoA acetyltransferase; Validated 99.4
PRK08256391 lipid-transfer protein; Provisional 99.39
PRK12578385 acetyl-CoA acetyltransferase; Provisional 99.38
cd00751386 thiolase Thiolase are ubiquitous enzymes that catalyze 99.32
PRK06289408 acetyl-CoA acetyltransferase; Provisional 99.32
PRK08313391 acetyl-CoA acetyltransferase; Provisional 99.31
PRK06064389 acetyl-CoA acetyltransferase; Provisional 99.31
PRK07516389 acetyl-CoA acetyltransferase; Provisional 99.3
cd00826393 nondecarbox_cond_enzymes nondecarboxylating condensing 99.29
PRK07800393 consensus 99.28
PRK08235393 acetyl-CoA acetyltransferase; Provisional 99.27
PRK08371388 consensus 99.26
PRK06504390 acetyl-CoA acetyltransferase; Provisional 99.17
PRK07801382 acetyl-CoA acetyltransferase; Provisional 99.15
PRK08242402 acetyl-CoA acetyltransferase; Validated 99.13
PRK08041391 consensus 99.1
PRK08142388 acetyl-CoA acetyltransferase; Provisional 99.1
PRK07855386 lipid-transfer protein; Provisional 99.07
PRK06954397 acetyl-CoA acetyltransferase; Provisional 99.07
PRK06445394 acetyl-CoA acetyltransferase; Provisional 99.06
PRK08947387 fadA 3-ketoacyl-CoA thiolase; Reviewed 99.06
PRK05656392 acetyl-CoA acetyltransferase; Provisional 98.97
PRK09051394 beta-ketothiolase; Provisional 98.96
PRK07124402 consensus 98.96
PRK06633392 acetyl-CoA acetyltransferase; Provisional 98.94
PRK06025417 acetyl-CoA acetyltransferase; Provisional 98.93
PRK07108392 acetyl-CoA acetyltransferase; Provisional 98.93
PRK05790393 acetyl-CoA acetyltransferase; Provisional 98.93
PRK07937352 lipid-transfer protein; Provisional 98.92
PRK07851405 acetyl-CoA acetyltransferase; Provisional 98.89
PRK09052399 acetyl-CoA acetyltransferase; Provisional 98.83
PRK06845392 consensus 98.83
PRK06205404 acetyl-CoA acetyltransferase; Provisional 98.77
PRK07025393 consensus 98.77
pfam00108264 Thiolase_N Thiolase, N-terminal domain. Thiolase is rep 98.75
PRK07491392 consensus 98.73
PRK06366388 acetyl-CoA acetyltransferase; Provisional 98.72
PRK08170426 acetyl-CoA acetyltransferase; Provisional 98.71
PRK08963436 fadI 3-ketoacyl-CoA thiolase; Reviewed 98.69
PRK09268428 acetyl-CoA acetyltransferase; Provisional 98.65
PRK08131401 acetyl-CoA acetyltransferase; Provisional 98.64
PRK06689391 consensus 98.59
PRK07850387 acetyl-CoA acetyltransferase; Provisional 98.53
TIGR01930447 AcCoA-C-Actrans acetyl-CoA acetyltransferases; InterPro 98.52
PRK09050401 beta-ketoadipyl CoA thiolase; Validated 98.52
PRK08234400 consensus 98.51
PRK06690361 acetyl-CoA acetyltransferase; Provisional 98.5
PRK13359400 beta-ketoadipyl CoA thiolase; Provisional 98.43
PRK07661384 acetyl-CoA acetyltransferase; Provisional 98.25
KOG1390396 consensus 97.93
pfam00109243 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 97.92
COG0183392 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism] 97.7
KOG1389435 consensus 97.21
PRK08257 502 acetyl-CoA acetyltransferase; Validated 97.03
KOG1406408 consensus 96.54
KOG1391396 consensus 94.89
KOG1392465 consensus 92.93
pfam0854580 ACP_syn_III 3-Oxoacyl-[acyl-carrier-protein (ACP)] synt 99.09
PRK06501425 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed 98.9
PRK09185395 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed 98.86
>TIGR01835 HMG-CoA-S_prok hydroxymethylglutaryl-CoA synthase; InterPro: IPR011554 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A synthase, HMG-CoA synthase Back     alignment and domain information
>TIGR01833 HMG-CoA-S_euk hydroxymethylglutaryl-CoA synthase; InterPro: IPR010122 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A synthase, HMG-CoA synthase Back     alignment and domain information
>COG3425 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism] Back     alignment and domain information
>KOG1393 consensus Back     alignment and domain information
>PRK04262 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative; InterPro: IPR004656 This family of archaeal proteins shows considerable homology and identical active site residues to FabH, the beta-ketoacyl-acyl carrier protein synthase III of bacteria and plants Back     alignment and domain information
>TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III; InterPro: IPR004655 Beta-ketoacyl-acyl carrier protein synthase III (FabH), in general, initiates elongation in type II fatty acid synthase systems found in bacteria and plants Back     alignment and domain information
>PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information
>PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional Back     alignment and domain information
>PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems Back     alignment and domain information
>PRK06840 hypothetical protein; Validated Back     alignment and domain information
>PRK12880 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>cd00827 init_cond_enzymes "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes Back     alignment and domain information
>cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs Back     alignment and domain information
>COG3424 BcsA Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd00834 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II Back     alignment and domain information
>PRK07314 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK05952 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>TIGR03150 fabF 3-oxoacyl-[acyl-carrier-protein] synthase 2 Back     alignment and domain information
>PRK06333 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK07103 polyketide beta-ketoacyl:acyl carrier protein synthase; Validated Back     alignment and domain information
>PRK08722 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK08768 consensus Back     alignment and domain information
>PRK07967 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>PRK08439 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>pfam08540 HMG_CoA_synt_C Hydroxymethylglutaryl-coenzyme A synthase C terminal Back     alignment and domain information
>pfam01154 HMG_CoA_synt_N Hydroxymethylglutaryl-coenzyme A synthase N terminal Back     alignment and domain information
>pfam00195 Chal_sti_synt_N Chalcone and stilbene synthases, N-terminal domain Back     alignment and domain information
>pfam08392 FAE1_CUT1_RppA FAE1/Type III polyketide synthase-like protein Back     alignment and domain information
>cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>PRK06059 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK06365 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06363 consensus Back     alignment and domain information
>PRK06364 consensus Back     alignment and domain information
>PRK06065 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06066 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>smart00825 PKS_KS Beta-ketoacyl synthase Back     alignment and domain information
>PTZ00050 3-oxoacyl-acyl carrier protein synthase; Provisional Back     alignment and domain information
>PRK09116 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK06147 3-oxoacyl-(acyl carrier protein) synthase; Validated Back     alignment and domain information
>cd00828 elong_cond_enzymes "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases Back     alignment and domain information
>PRK07910 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria Back     alignment and domain information
>cd00833 PKS polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations Back     alignment and domain information
>PRK08304 stage V sporulation protein AD; Validated Back     alignment and domain information
>pfam07451 SpoVAD Stage V sporulation protein AD (SpoVAD) Back     alignment and domain information
>PRK12404 stage V sporulation protein AD; Provisional Back     alignment and domain information
>pfam08541 ACP_syn_III_C 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal Back     alignment and domain information
>pfam02797 Chal_sti_synt_C Chalcone and stilbene synthases, C-terminal domain Back     alignment and domain information
>pfam02803 Thiolase_C Thiolase, C-terminal domain Back     alignment and domain information
>pfam02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain Back     alignment and domain information
>cd00829 SCP-x_thiolase Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism Back     alignment and domain information
>PRK06158 thiolase; Provisional Back     alignment and domain information
>TIGR02845 spore_V_AD stage V sporulation protein AD; InterPro: IPR010894 This family contains the bacterial stage V sporulation protein AD (SpoVAD), which is approximately 340 residues long Back     alignment and domain information
>COG0304 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG3321 Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1394 consensus Back     alignment and domain information
>PRK06519 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>KOG1202 consensus Back     alignment and domain information
>PRK06157 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK08256 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK12578 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PRK06289 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08313 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06064 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07516 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>cd00826 nondecarbox_cond_enzymes nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PRK07800 consensus Back     alignment and domain information
>PRK08235 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08371 consensus Back     alignment and domain information
>PRK06504 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07801 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08242 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK08041 consensus Back     alignment and domain information
>PRK08142 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07855 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK06954 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06445 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08947 fadA 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>PRK05656 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09051 beta-ketothiolase; Provisional Back     alignment and domain information
>PRK07124 consensus Back     alignment and domain information
>PRK06633 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06025 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07108 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK05790 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07937 lipid-transfer protein; Provisional Back     alignment and domain information
>PRK07851 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09052 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06845 consensus Back     alignment and domain information
>PRK06205 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07025 consensus Back     alignment and domain information
>pfam00108 Thiolase_N Thiolase, N-terminal domain Back     alignment and domain information
>PRK07491 consensus Back     alignment and domain information
>PRK06366 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08170 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08963 fadI 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>PRK09268 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08131 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06689 consensus Back     alignment and domain information
>PRK07850 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases; InterPro: IPR002155 Two different types of thiolase , , are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>PRK09050 beta-ketoadipyl CoA thiolase; Validated Back     alignment and domain information
>PRK08234 consensus Back     alignment and domain information
>PRK06690 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK13359 beta-ketoadipyl CoA thiolase; Provisional Back     alignment and domain information
>PRK07661 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>KOG1390 consensus Back     alignment and domain information
>pfam00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain Back     alignment and domain information
>COG0183 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism] Back     alignment and domain information
>KOG1389 consensus Back     alignment and domain information
>PRK08257 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>KOG1406 consensus Back     alignment and domain information
>KOG1391 consensus Back     alignment and domain information
>KOG1392 consensus Back     alignment and domain information
>pfam08545 ACP_syn_III 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III Back     alignment and domain information
>PRK06501 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK09185 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target396 hydroxymethylglutaryl-coenzyme A synthase [Candidatus L
2hdb_A383 Hmg-Coa Synthase From Enterococcus Faecalis. Mutati 1e-80
1x9e_A383 Crystal Structure Of Hmg-Coa Synthase From Enteroco 2e-80
1ysl_A402 Crystal Structure Of Hmg-Coa Synthase From Enteroco 4e-80
1ysl_B384 Crystal Structure Of Hmg-Coa Synthase From Enteroco 3e-79
1xpk_C388 Crystal Structure Of Staphylococcus Aureus Hmg-Coa 5e-78
1xpk_B388 Crystal Structure Of Staphylococcus Aureus Hmg-Coa 1e-77
3leh_A425 The Crystal Structure Of Smu.943c From Streptococcu 1e-77
1tvz_A388 Crystal Structure Of 3-Hydroxy-3-Methylglutaryl-Coe 1e-77
2v4w_B460 Crystal Structure Of Human Mitochondrial 3-Hydroxy- 4e-76
1xpk_D388 Crystal Structure Of Staphylococcus Aureus Hmg-Coa 1e-75
1xpl_B390 Crystal Structure Of Staphylococcus Aureus Hmg-Coa 1e-75
2p8u_A478 Crystal Structure Of Human 3-Hydroxy-3-Methylglutar 1e-75
2f82_A450 Hmg-Coa Synthase From Brassica Juncea In The Apo-Fo 7e-71
2fa3_A450 Hmg-Coa Synthase From Brassica Juncea In Complex Wi 1e-70
2ebd_A309 Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protei 3e-63
1hn9_A317 Crystal Structure Of Beta-Ketoacyl-Acp Synthase Iii 9e-63
1mzs_A317 Crystal Structure Of Beta-Ketoacyl-Acp Synthase Iii 2e-62
3il9_A340 Structure Of E. Coli Fabh Length = 340 7e-62
1zow_A313 Crystal Structure Of S. Aureus Fabh, Beta-Ketoacyl 2e-61
1hnh_A317 Crystal Structure Of Beta-Ketoacyl-Acp Synthase Iii 1e-58
1ebl_A317 The 1.8 A Crystal Structure And Active Site Archite 2e-58
1ub7_A322 The Crystal Analysis Of Beta-Keroacyl-[acyl Carrier 4e-58
3il3_A323 Structure Of Haemophilus Influenzae Fabh Length = 3 1e-57
3il5_A343 Structure Of E. Faecalis Fabh In Complex With 2-({4 1e-48
2qny_A335 Crystal Structure Of The Complex Between The A246f 1e-48
1m1m_A355 X-Ray Crystal Structure Of Mycobacterium Tuberculos 2e-48
1hzp_A335 Crystal Structure Of The Myobacterium Tuberculosis 2e-48
3il4_A320 Structure Of E. Faecalis Fabh In Complex With Acety 2e-48
1mzj_A339 Crystal Structure Of The Priming Beta-Ketosynthase 3e-48
1u6s_A335 Crystal Structure Of The Complex Between Mycobacter 5e-48
3il6_A321 Structure Of E. Faecalis Fabh In Complex With 2-({4 2e-47
3gwa_A365 1.6 Angstrom Crystal Structure Of 3-Oxoacyl-(Acyl-C 8e-47
2ahb_A356 X-Ray Crystal Structure Of R46a,R161a Mutant Of Myc 9e-47
2aj9_A356 X-Ray Crystal Structure Of W42a,R161a Double Mutant 8e-46
3h76_A359 Crystal Structure Of Pqsd, A Key Enzyme In Pseudomo 2e-41
3h77_A359 Crystal Structure Of Pseudomonas Aeruginosa Pqsd In 4e-41
3h78_A359 Crystal Structure Of Pseudomonas Aeruginosa Pqsd C1 4e-41
2x3e_A331 Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protei 2e-40
3fk5_A338 Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protei 2e-27
3led_A392 Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protei 2e-21
1u0m_A382 Crystal Structure Of 1,3,6,8-Tetrahydroxynaphthalen 4e-19
1qlv_A402 Pyrone Synthase (Pys) From Gerbera Hybrida Length = 3e-16
1ted_A393 Crystal Structure Of A Type Iii Polyketide Synthase 1e-14
1tee_A393 Crystal Structure Of C205f Mutant Of Pks18 From Myc 2e-14
2d3m_A406 Pentaketide Chromone Synthase Complexed With Coenzy 1e-13
2d51_A406 Pentaketide Chromone Synthase (M207g Mutant) Length 1e-13
1i8b_A389 Chalcone Synthase (G256f) Length = 389 3e-13
1cgz_A389 Chalcone Synthase From Alfalfa Complexed With Resve 6e-13
3ov3_A393 G211f Mutant Of Curcumin Synthase 1 From Curcuma Lo 8e-13
3ov2_A393 Curcumin Synthase 1 From Curcuma Longa Length = 393 8e-13
1i86_A389 Chalcone Synthase, G256a Mutant Length = 389 1e-12
1bi5_A389 Chalcone Synthase From Alfalfa Length = 389 1e-12
1i89_A389 Chalcone Synthase (G256l) Length = 389 1e-12
1i88_A389 Chalcone Synthase (G256v) Length = 389 1e-12
1bq6_A388 Chalcone Synthase From Alfalfa With Coenzyme A Leng 1e-12
1chw_A389 Chalcone Synthase From Alfalfa Complexed With Hexan 1e-12
1cml_A389 Chalcone Synthase From Alfalfa Complexed With Malon 1e-12
1jwx_A389 Chalcone Synthase--F215s Mutant Length = 389 2e-12
1u0v_A393 An Aldol Switch Discovered In Stilbene Synthases Me 4e-12
1d6h_A387 Chalone Synthase (N336a Mutant Complexed With Coa) 9e-12
1d6i_A388 Chalcone Synthase (H303q Mutant) Length = 388 2e-11
2p0u_A413 Crystal Structure Of Marchantia Polymorpha Stilbene 5e-11
1z1e_A390 Crystal Structure Of Stilbene Synthase From Arachis 7e-11
1xes_A413 Crystal Structure Of Stilbene Synthase From Pinus S 2e-09
1u0u_A397 An Aldol Switch Discovered In Stilbene Synthases Me 2e-09
2h84_A374 Crystal Structure Of The C-Terminal Type Iii Polyke 3e-07
3ale_A416 A Type Iii Polyketide Synthase That Produces Diaryl 3e-05
3oit_A387 Crystal Structure Of Curcuminoid Synthase Cus From 4e-05
3a5s_A387 Benzalacetone Synthase (I207lL208F) Length = 387 2e-09
3a5q_A387 Benzalacetone Synthase From Rheum Palmatum Length = 1e-08
3e1h_A465 Crystal Structure Of A Type Iii Polyketide Synthase 8e-04
3euo_A379 Crystal Structure Of A Fungal Type Iii Polyketide S 8e-04
3euq_A379 X-Ray Structural Of A Type Iii Pentaketide Synthase 0.001
>gi|145579495|pdb|2HDB|A Chain A, Hmg-Coa Synthase From Enterococcus Faecalis. Mutation Alanine 110 To Glycine Length = 383 Back     alignment and structure
 Score =  304 bits (779), Expect = 1e-80,   Method: Composition-based stats.
 Identities = 147/385 (38%), Positives = 230/385 (59%), Gaps = 4/385 (1%)

Query: 1   MAIGIEDISFYTTNQYLDLSVIAEKYRLDVAKFYVGIGQERMSVLNPDEDIVTMAAAAAL 60
           M IGI+ ISF+    Y+D++ +AE   +D  KF++GIGQ++M+V    +DIVT AA AA 
Sbjct: 1   MTIGIDKISFFVPPYYIDMTALAEARNVDPGKFHIGIGQDQMAVNPISQDIVTFAANAAE 60

Query: 61  PIMQNQDKNLIDTLFFATESSVDQSKSAAIWLHKLLGLNSSCRVVELKQACYSATCALHM 120
            I+  +DK  ID +   TESS+D+SK+AA+ LH+L+G+    R  E+K+ CY AT  L +
Sbjct: 61  AILTKEDKEAIDMVIVGTESSIDESKAAAVVLHRLMGIQPFARSFEIKEGCYGATAGLQL 120

Query: 121 ACALVAKSPERKVLIVASDVARYDLGSSGEPTQGCGAVAILISSQTSILEIEDITGIYTN 180
           A   VA  P++KVL+VA+D+A+Y L S GEPTQG GAVA+L++S+  IL +++   + T 
Sbjct: 121 AKNHVALHPDKKVLVVAADIAKYGLNSGGEPTQGAGAVAMLVASEPRILALKEDNVMLTQ 180

Query: 181 DCMDFWRPNYRRTALVDGKYSTKIYLQSLEAVWHDYQKNKGHDFNDFQYFCYHQPFTRMA 240
           D  DFWRP      +VDG  S + Y+QS   VW +++K  G DF D+    +H P+T+M 
Sbjct: 181 DIYDFWRPTGHPYPMVDGPLSNETYIQSFAQVWDEHKKRTGLDFADYDALAFHIPYTKMG 240

Query: 241 EKAHIRLSKIVHQNLSVAEIEKAIGITTLYNRLIGNSYTASLYIALISLLDHSSENLAGK 300
           +KA +       +      + +    + +Y+R +GN YT SLY+ LISLL++++   AG 
Sbjct: 241 KKALLAKISDQTEAEQERILAR-YEESIIYSRRVGNLYTGSLYLGLISLLENATTLTAGN 299

Query: 301 RVGFFSYGSGCVAEFFSGIVQKNYRKKSHQKRHQHIINSRIPISYQVYCDLHQDIIPSVE 360
           ++G FSYGSG VAEFF+G +   Y+    ++ H  ++++R  +S   Y  +  + + +  
Sbjct: 300 QIGLFSYGSGAVAEFFTGELVAGYQNHLQKETHLALLDNRTELSIAEYEAMFAETLDTDI 359

Query: 361 GNCTIPHTTTGPFRLATIQNHKRIY 385
                       + ++ I N  R Y
Sbjct: 360 DQTLEDELK---YSISAINNTVRSY 381


gi|82407425|pdb|1X9E|A Chain A, Crystal Structure Of Hmg-Coa Synthase From Enterococcus Faecalis Length = 383 Back     alignment and structure
>gi|83753737|pdb|1YSL|A Chain A, Crystal Structure Of Hmg-Coa Synthase From Enterococcus Faecalis With Acetoacetyl-Coa Ligand Length = 402 Back     alignment and structure
gi|56554625|pdb|1XPK|C Chain C, Crystal Structure Of Staphylococcus Aureus Hmg-Coa Synthase With Hmg-Coa And With Acetoacetyl-Coa And Acetylated Cysteine Length = 388 Back     alignment and structure
>gi|56554624|pdb|1XPK|B Chain B, Crystal Structure Of Staphylococcus Aureus Hmg-Coa Synthase With Hmg-Coa And With Acetoacetyl-Coa And Acetylated Cysteine Length = 388 Back     alignment and structure
>gi|319443537|pdb|3LEH|A Chain A, The Crystal Structure Of Smu.943c From Streptococcus Mutans Ua159 Length = 425 Back     alignment and structure
>gi|52695876|pdb|1TVZ|A Chain A, Crystal Structure Of 3-Hydroxy-3-Methylglutaryl-Coenzyme A Synthase From Staphylococcus Aureus Length = 388 Back     alignment and structure
>gi|145580541|pdb|2P8U|A Chain A, Crystal Structure Of Human 3-Hydroxy-3-Methylglutaryl Coa Sy Length = 478 Back     alignment and structure
>gi|112490556|pdb|2F82|A Chain A, Hmg-Coa Synthase From Brassica Juncea In The Apo-Form Length = 450 Back     alignment and structure
>gi|112490562|pdb|2FA3|A Chain A, Hmg-Coa Synthase From Brassica Juncea In Complex With Acetyl-Coa And Acetyl-Cys117 Length = 450 Back     alignment and structure
gi|157834882|pdb|2EBD|A Chain A, Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein] Synthase Iii From Aquifex Aeolicus Vf5 Length = 309 Back     alignment and structure
gi|12084276|pdb|1HN9|A Chain A, Crystal Structure Of Beta-Ketoacyl-Acp Synthase Iii Length = 317 Back     alignment and structure
>gi|27065814|pdb|1MZS|A Chain A, Crystal Structure Of Beta-Ketoacyl-Acp Synthase Iii With Bound Dichlorobenzyloxy-Indole-Carboxylic Acid Inhibitor Length = 317 Back     alignment and structure
>gi|256599935|pdb|3IL9|A Chain A, Structure Of E. Coli Fabh Length = 340 Back     alignment and structure
gi|75765832|pdb|1ZOW|A Chain A, Crystal Structure Of S. Aureus Fabh, Beta-Ketoacyl Carrier Protein Synthase Iii Length = 313 Back     alignment and structure
>gi|12084279|pdb|1HNH|A Chain A, Crystal Structure Of Beta-Ketoacyl-Acp Synthase Iii + Degraded Form Of Acetyl-Coa Length = 317 Back     alignment and structure
>gi|7245808|pdb|1EBL|A Chain A, The 1.8 A Crystal Structure And Active Site Architecture Of Beta-Ketoacyl-[acyl Carrier Protein] Synthase Iii (Fabh) From Escherichia Coli Length = 317 Back     alignment and structure
>gi|30750145|pdb|1UB7|A Chain A, The Crystal Analysis Of Beta-Keroacyl-[acyl Carrier Protein] Synthase Iii (Fabh)from Thermus Thermophilus. Length = 322 Back     alignment and structure
>gi|256599923|pdb|3IL3|A Chain A, Structure Of Haemophilus Influenzae Fabh Length = 323 Back     alignment and structure
>gi|256599928|pdb|3IL5|A Chain A, Structure Of E. Faecalis Fabh In Complex With 2-({4-Bromo-3- [(Diethylamino)sulfonyl]benzoyl}amino)benzoic Acid Length = 343 Back     alignment and structure
>gi|187609065|pdb|2QNY|A Chain A, Crystal Structure Of The Complex Between The A246f Mutant Of Mycobacterium Beta-Ketoacyl-Acyl Carrier Protein Synthase Iii (Fabh) And Ss-(2-Hydroxyethyl) O-Decyl Ester Carbono(Dithioperoxoic) Acid Length = 335 Back     alignment and structure
>gi|22219354|pdb|1M1M|A Chain A, X-Ray Crystal Structure Of Mycobacterium Tuberculosis Beta- Ketoacyl-Acyl Carrier Protein Synthase Iii (Mtfabh) Length = 355 Back     alignment and structure
gi|14719783|pdb|1HZP|A Chain A, Crystal Structure Of The Myobacterium Tuberculosis Beta- Ketoacyl-Acyl Carrier Protein Synthase Iii Length = 335 Back     alignment and structure
>gi|256599924|pdb|3IL4|A Chain A, Structure Of E. Faecalis Fabh In Complex With Acetyl Coa Length = 320 Back     alignment and structure
gi|27574020|pdb|1MZJ|A Chain A, Crystal Structure Of The Priming Beta-Ketosynthase From The R1128 Polyketide Biosynthetic Pathway Length = 339 Back     alignment and structure
>gi|62738065|pdb|1U6S|A Chain A, Crystal Structure Of The Complex Between Mycobacterium Tuberculosis Beta-Ketoacyl-Acyl Carrier Protein Synthase Iii And Lauroyl Coenzyme A Length = 335 Back     alignment and structure
>gi|256599932|pdb|3IL6|A Chain A, Structure Of E. Faecalis Fabh In Complex With 2-({4-[(3r, 5s)-3,5-Dimethylpiperidin-1-Yl]-3-Phenoxybenzoyl}amino) Benzoic Acid Length = 321 Back     alignment and structure
>gi|228312355|pdb|3GWA|A Chain A, 1.6 Angstrom Crystal Structure Of 3-Oxoacyl-(Acyl-Carrier- Protein) Synthase Iii Length = 365 Back     alignment and structure