254781020

254781020

isopentenyl pyrophosphate isomerase

GeneID in NCBI database:8210043Locus tag:CLIBASIA_04610
Protein GI in NCBI database:254781020Protein Accession:YP_003065433.1
Gene range:-(1020545, 1021558)Protein Length:337aa
Gene description:isopentenyl pyrophosphate isomerase
COG prediction:none
KEGG prediction:isopentenyl pyrophosphate isomerase (EC:5.3.3.2); K01823 isopentenyl-diphosphate delta-isomerase [EC:5.3.3.2]
SEED prediction:Isopentenyl-diphosphate delta-isomerase, FMN-dependent (EC 5.3.3.2)
Pathway involved in KEGG:Terpenoid backbone biosynthesis [PATH:las00900]
Subsystem involved in SEED:Isoprenoid Biosynthesis;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------
MVNDRKIDHINIVCKDPGIDRNKKFFDDWHLIHRALPEISFDEVDPSVEFLGKKLSFPLLISSMTGGNNKMIERINRNLAIAAEKTKVAMAVGSQRVMFSDHNAIKSFELRQYAPHTVLISNLGAVQLNYDFGVQKAHQAVHVLGADGLFLHLNPLQEIIQPNGNTNFADLSSKIALLSSAMDVPLLLKEVGCGLSSMDIELGLKSGIRYFDIAGRGGTSWSRIESHRDLESDIGIVFQDWGIPTPLSLEMARPYCNEAQFIASGGLRNGVDILKSIILGASLGGLASPFLKPAMDSSDAVVAAIESLRKEFIVSMFLLGTKRVQELYLNTALIRHQ
cccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccccccEEEEEEccEEEEccEEEEcccccHHHHHccHHHHHHHHHHHcccEEEEHHHHHHcccHHHHHHHHHHHccccEEEEEEcccHHHHccccHHHHHHHHHHcccccEEEEccHHHHHHccccccccccHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHccccEEEEccccccccccccHHHHccHHHHHHHHHccccHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHcccEEHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccHHHHccccEEEccc
cccHccHHHHHHHHHcccccccccccHHEEEEccccccccHHHcccccccccccccccEEEEccccccHHHHHHHHHHHHHHHHHccccEEEccHHHHcccccHHccccHHcccccccEEEEccHHHHcccccHHHHHHHHHHHcHHHHHHHHcHHHHHccccccccHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHccccEEEEcccccccHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHcccEEEEcc
mvndrkidhinivckdpgidrnkkffddwhlihralpeisfdevdpsveflgkklsfpllissmtggnnKMIERINRNLAIAAEKTKVAMAVGSqrvmfsdhnaiksfelrqyaphtvlISNLGAVQLNYDFGVQKAHQAVHVLGadglflhlnplqeiiqpngntnfaDLSSKIALLSSAMDVPLLLKEVGCGLSSMDIELGLKSGIRyfdiagrggtswsrieshrdlesdigivfqdwgiptplslemarpycneaqfIASGGLRNGVDILKSIILGaslgglaspflkpamdsSDAVVAAIESLRKEFIVSMFLLGTKRVQELYLNTALIRHQ
mvndrkidhinivckdpgidrNKKFFDDWHLIHRALPEISFDEVDPSVEFLGKKLSFPLLISSMTGGNNKMIERINRNLAIAAEKTKVAMAVGSQRVMFSDHNAIKSFELRQYAPHTVLISNLGAVQLNYDFGVQKAHQAVHVLGADGLFLHLNPLQEIIQPNGNTNFADLSSKIALLSSAMDVPLLLKEVGCGLSSMDIELGLKSGIRYFDIAGRGGTSWSRIESHRDLESDIGIVFQDWGIPTPLSLEMARPYCNEAQFIASGGLRNGVDILKSIILGASLGGLASPFLKPAMDSSDAVVAAIESLRKEFIVSMFLLGTKRVQELYLNTALIRHQ
MVNDRKIDHINIVCKDPGIDRNKKFFDDWHLIHRALPEISFDEVDPSVEFLGKKLSFPLLISSMTGGNNKMIERINRNLAIAAEKTKVAMAVGSQRVMFSDHNAIKSFELRQYAPHTVLISNLGAVQLNYDFGVQKAHQAVHVLGADGLFLHLNPLQEIIQPNGNTNFADLSSKIALLSSAMDVPLLLKEVGCGLSSMDIELGLKSGIRYFDIAGRGGTSWSRIESHRDLESDIGIVFQDWGIPTPLSLEMARPYCNEAQFIASGGLRNGVDILKSIILGASLGGLASPFLKPAMDSSDAVVAAIESLRKEFIVSMFLLGTKRVQELYLNTALIRHQ
**NDRKIDHINIVCKDPGIDRNKKFFDDWHLIHRALPEISFDEVDPSVEFLGKKLSFPLLISSMTGGNNKMIERINRNLAIAAEKTKVAMAVGSQRVMFSDHNAIKSFELRQYAPHTVLISNLGAVQLNYDFGVQKAHQAVHVLGADGLFLHLNPLQEII*PNGNTNFADLSSKIALLSSAMDVPLLLKEVGCGLSSMDIELGLKSGIRYFDIAGRGGTSWSRIESHRDLESDIGIVFQDWGIPTPLSLEMARPYCNEAQFIASGGLRNGVDILKSIILGASLGGLASPFLKPAMDSSDAVVAAIESLRKEFIVSMFLLGTKRVQELYLNTALIRH*
MVNDRKIDHINIVCKDPGIDRNKKFFDDWHLIHRALPEISFDEVDPSVEFLGKKLSFPLLISSMTGGNNKMIERINRNLAIAAEKTKVAMAVGSQRVMFSDHNAIKSFELRQYAPHTVLISNLGAVQLNYDFGVQKAHQAVHVLGADGLFLHLNPLQEIIQPNGNTNFADLSSKIALLSSAMDVPLLLKEVGCGLSSMDIELGLKSGIRYFDIAGRGGTSWSRIESHRDLESDIGIVFQDWGIPTPLSLEMARPYCNEAQFIASGGLRNGVDILKSIILGASLGGLASPFLKPAMDSSDAVVAAIESLRKEFIVSMFLLGTKRVQELYLNTALIRHQ
*VNDRKIDHINIVCKDPGIDRNKKFFDDWHLIHRALPEISFDEVDPSVEFLGKKLSFPLLISSMTGGNNKMIERINRNLAIAAEKTKVAMAVGSQRVMFSDHNAIKSFELRQYAPHTVLISNLGAVQLNYDFGVQKAHQAVHVLGADGLFLHLNPLQEIIQPNGNTNFADLSSKIALLSSAMDVPLLLKEVGCGLSSMDIELGLKSGIRYFDIAGRGGTSWSRIESHRDLESDIGIVFQDWGIPTPLSLEMARPYCNEAQFIASGGLRNGVDILKSIILGASLGGLASPFLKPAMDSSDAVVAAIESLRKEFIVSMFLLGTKRVQELYLNTALIRHQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVNDRKIDHINIVCKDPGIDRNKKFFDDWHLIHRALPEISFDEVDPSVEFLGKKLSFPLLISSMTGGNNKMIERINRNLAIAAEKTKVAMAVGSQRVMFSDHNAIKSFELRQYAPHTVLISNLGAVQLNYDFGVQKAHQAVHVLGADGLFLHLNPLQEIIQPNGNTNFADLSSKIALLSSAMDVPLLLKEVGCGLSSMDIELGLKSGIRYFDIAGRGGTSWSRIESHRDLESDIGIVFQDWGIPTPLSLEMARPYCNEAQFIASGGLRNGVDILKSIILGASLGGLASPFLKPAMDSSDAVVAAIESLRKEFIVSMFLLGTKRVQELYLNTALIRHQ
MVNDRKIDHINIVCKDPGIDRNKKFFDDWHLIHRALPEISFDEVDPSVEFLGKKLSFPLLISSMTGGNNKMIERINRNLAIAAEKTKVAMAVGSQRVMFSDHNAIKSFELRQYAPHTVLISNLGAVQLNYDFGVQKAHQAVHVLGADGLFLHLNPLQEIIQPNGNTNFADLSSKIALLSSAMDVPLLLKEVGCGLSSMDIELGLKSGIRYFDIAGRGGTSWSRIESHRDLESDIGIVFQDWGIPTPLSLEMARPYCNEAQFIASGGLRNGVDILKSIILGASLGGLASPFLKPAMDSSDAVVAAIESLRKEFIVSMFLLGTKRVQELYLNTALIRHQ
MVNDRKIDHINIVCKDPGIDRNKKFFDDWHLIHRALPEISFDEVDPSVEFLGKKLSFPLLISSMTGGNNKMIERINRNLAIAAEKTKVAMAVGSQRVMFSDHNAIKSFELRQYAPHTVLISNLGAVQLNYDFGVQKAHQAVHVLGADGLFLHLNPLQEIIQPNGNTNFADLSSKIALLSSAMDVPLLLKEVGCGLSSMDIELGLKSGIRYFDIAGRGGTSWSRIESHRDLESDIGIVFQDWGIPTPLSLEMARPYCNEAQFIASGGLRNGVDILKSIILGASLGGLASPFLKPAMDSSDAVVAAIESLRKEFIVSMFLLGTKRVQELYLNTALIRHQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target337 isopentenyl pyrophosphate isomerase [Candidatus Liberib
254781018337 GHMP kinase [Candidatus Liberibacter asiaticus str 0.015
>gi|254781018|ref|YP_003065431.1| GHMP kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 337 Back     alignment
 Score = 32.0 bits (71), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 6/81 (7%)

Query: 12  IVCKDPGIDRNKKFFDDWHLIHRALPEISFDEVDPSVEFLGKKLSFPLLISSMTGGNNKM 71
           I    P I +N+    +W  I+  +PE S  E    V F+ +  S   + S      N+M
Sbjct: 187 IYINPPQIIKNETLVGEWWAINTGMPESSTGEC---VSFVEQHFSQSSIWSEFNAVTNEM 243

Query: 72  IERINRNLAIAAEKTKVAMAV 92
           +E I +     AEKT  ++ V
Sbjct: 244 MENIQKK---DAEKTYKSVRV 261

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target337 isopentenyl pyrophosphate isomerase [Candidatus Liberib
315122509340 isopentenyl pyrophosphate isomerase [Candidatus Liberib 1 1e-163
89094691342 Isopentenyl-diphosphate delta-isomerase, FMN-dependent 1 1e-115
78486059343 isopentenyl pyrophosphate isomerase [Thiomicrospira cru 1 1e-108
146329192344 isopentenyl pyrophosphate isomerase [Dichelobacter nodo 1 1e-104
254513308349 isopentenyl-diphosphate delta-isomerase, type 2 [Rhodob 1 1e-102
47605898349 RecName: Full=Isopentenyl-diphosphate delta-isomerase; 1 1e-100
258544190340 type 2 isopentenyl-diphosphate delta-isomerase [Cardiob 1 2e-96
119493251360 hypothetical protein L8106_30505 [Lyngbya sp. PCC 8106] 1 3e-71
320161453342 isopentenyl-diphosphate delta-isomerase [Anaerolinea th 1 1e-70
332708204342 isopentenyl-diphosphate delta-isomerase, type 2 [Lyngby 1 3e-70
>gi|315122509|ref|YP_004062998.1| isopentenyl pyrophosphate isomerase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 340 Back     alignment and organism information
 Score =  578 bits (1491), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 276/337 (81%), Positives = 319/337 (94%)

Query: 1   MVNDRKIDHINIVCKDPGIDRNKKFFDDWHLIHRALPEISFDEVDPSVEFLGKKLSFPLL 60
           MVNDRKIDHINI+CKD  IDR K FFDDWHL+HRALPEIS D+VDPSV+FLGKK+SFPLL
Sbjct: 1   MVNDRKIDHINIICKDSHIDRKKNFFDDWHLMHRALPEISLDDVDPSVDFLGKKISFPLL 60

Query: 61  ISSMTGGNNKMIERINRNLAIAAEKTKVAMAVGSQRVMFSDHNAIKSFELRQYAPHTVLI 120
           ISSMTGGN+K+I+RINRNLAIAAEKTKVAMAVGSQRVMF+D  A+KSFELRQYAPHTVLI
Sbjct: 61  ISSMTGGNHKLIQRINRNLAIAAEKTKVAMAVGSQRVMFTDPQAVKSFELRQYAPHTVLI 120

Query: 121 SNLGAVQLNYDFGVQKAHQAVHVLGADGLFLHLNPLQEIIQPNGNTNFADLSSKIALLSS 180
           SNLGAVQLNY+FG+++A+QAVHVLGADGLFLHLNPLQE+IQ NGNTNFA+LSSKI+LLSS
Sbjct: 121 SNLGAVQLNYNFGIKEANQAVHVLGADGLFLHLNPLQEVIQLNGNTNFANLSSKISLLSS 180

Query: 181 AMDVPLLLKEVGCGLSSMDIELGLKSGIRYFDIAGRGGTSWSRIESHRDLESDIGIVFQD 240
            MD+P++LKEVGCG+S MDIELGLK+GIRYFD+AGRGGTSWSR+ESHRD+  + GI FQD
Sbjct: 181 EMDIPIILKEVGCGMSPMDIELGLKAGIRYFDLAGRGGTSWSRVESHRDITDNAGIFFQD 240

Query: 241 WGIPTPLSLEMARPYCNEAQFIASGGLRNGVDILKSIILGASLGGLASPFLKPAMDSSDA 300
           WGIPTP +LEMARPYC +A+FI+SGG+RNG+DILKSIILGAS+GGLASPFLKPAMDSS++
Sbjct: 241 WGIPTPYALEMARPYCKKAKFISSGGIRNGMDILKSIILGASIGGLASPFLKPAMDSSES 300

Query: 301 VVAAIESLRKEFIVSMFLLGTKRVQELYLNTALIRHQ 337
           V++ IESLRKEF++SMFLLG KRV+ELYLNT+L+RHQ
Sbjct: 301 VISVIESLRKEFVISMFLLGIKRVEELYLNTSLVRHQ 337


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|89094691|ref|ZP_01167627.1| Isopentenyl-diphosphate delta-isomerase, FMN-dependent [Oceanospirillum sp. MED92] Length = 342 Back     alignment and organism information
>gi|78486059|ref|YP_391984.1| isopentenyl pyrophosphate isomerase [Thiomicrospira crunogena XCL-2] Length = 343 Back     alignment and organism information
>gi|146329192|ref|YP_001209698.1| isopentenyl pyrophosphate isomerase [Dichelobacter nodosus VCS1703A] Length = 344 Back     alignment and organism information
>gi|254513308|ref|ZP_05125373.1| isopentenyl-diphosphate delta-isomerase, type 2 [Rhodobacteraceae bacterium KLH11] Length = 349 Back     alignment and organism information
>gi|47605898|sp|Q8L1I4|IDI2_PARZE RecName: Full=Isopentenyl-diphosphate delta-isomerase; Short=IPP isomerase; AltName: Full=Isopentenyl pyrophosphate isomerase Length = 349 Back     alignment and organism information
>gi|258544190|ref|ZP_05704424.1| type 2 isopentenyl-diphosphate delta-isomerase [Cardiobacterium hominis ATCC 15826] Length = 340 Back     alignment and organism information
>gi|119493251|ref|ZP_01624091.1| hypothetical protein L8106_30505 [Lyngbya sp. PCC 8106] Length = 360 Back     alignment and organism information
>gi|320161453|ref|YP_004174677.1| isopentenyl-diphosphate delta-isomerase [Anaerolinea thermophila UNI-1] Length = 342 Back     alignment and organism information
>gi|332708204|ref|ZP_08428194.1| isopentenyl-diphosphate delta-isomerase, type 2 [Lyngbya majuscula 3L] Length = 342 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target337 isopentenyl pyrophosphate isomerase [Candidatus Liberib
PRK05437352 PRK05437, PRK05437, isopentenyl pyrophosphate isomerase 1e-122
TIGR02151333 TIGR02151, IPP_isom_2, isopentenyl-diphosphate delta-is 2e-98
COG1304360 COG1304, LldD, L-lactate dehydrogenase (FMN-dependent) 6e-61
pfam01070301 pfam01070, FMN_dh, FMN-dependent dehydrogenase 3e-18
cd02809299 cd02809, alpha_hydroxyacid_oxid_FMN, Family of homologo 3e-11
cd02922344 cd02922, FCB2_FMN, Flavocytochrome b2 (FCB2) FMN-bindin 7e-11
KOG0538363 KOG0538, KOG0538, KOG0538, Glycolate oxidase [Energy pr 2e-09
cd03332383 cd03332, LMO_FMN, L-Lactate 2-monooxygenase (LMO) FMN-b 2e-06
cd02811326 cd02811, IDI-2_FMN, Isopentenyl-diphosphate:dimethylall 1e-110
cd02808392 cd02808, GltS_FMN, Glutamate synthase (GltS) FMN-bindin 2e-05
COG0069485 COG0069, GltB, Glutamate synthase domain 2 [Amino acid 0.001
pfam01645367 pfam01645, Glu_synthase, Conserved region in glutamate 0.001
cd04737351 cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-bind 0.001
PLN02979366 PLN02979, PLN02979, glycolate oxidase 0.003
PRK11197381 PRK11197, lldD, L-lactate dehydrogenase; Provisional 0.003
PLN02493367 PLN02493, PLN02493, probable peroxisomal (S)-2-hydroxy- 0.004
>gnl|CDD|180081 PRK05437, PRK05437, isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|162733 TIGR02151, IPP_isom_2, isopentenyl-diphosphate delta-isomerase, type 2 Back     alignment and domain information
>gnl|CDD|31495 COG1304, LldD, L-lactate dehydrogenase (FMN-dependent) and related alpha-hydroxy acid dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|144604 pfam01070, FMN_dh, FMN-dependent dehydrogenase Back     alignment and domain information
>gnl|CDD|73371 cd02809, alpha_hydroxyacid_oxid_FMN, Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>gnl|CDD|73376 cd02922, FCB2_FMN, Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>gnl|CDD|35758 KOG0538, KOG0538, KOG0538, Glycolate oxidase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|73383 cd03332, LMO_FMN, L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>gnl|CDD|73373 cd02811, IDI-2_FMN, Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>gnl|CDD|73370 cd02808, GltS_FMN, Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information
>gnl|CDD|30418 COG0069, GltB, Glutamate synthase domain 2 [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|110632 pfam01645, Glu_synthase, Conserved region in glutamate synthase Back     alignment and domain information
>gnl|CDD|73399 cd04737, LOX_like_FMN, L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>gnl|CDD|166620 PLN02979, PLN02979, glycolate oxidase Back     alignment and domain information
>gnl|CDD|183033 PRK11197, lldD, L-lactate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|166134 PLN02493, PLN02493, probable peroxisomal (S)-2-hydroxy-acid oxidase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 337 isopentenyl pyrophosphate isomerase [Candidatus Liberib
TIGR02151349 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, typ 100.0
PRK05437351 isopentenyl pyrophosphate isomerase; Provisional 100.0
cd02811326 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosp 100.0
cd02922344 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain. 100.0
cd03332383 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding dom 100.0
PRK11197381 lldD L-lactate dehydrogenase; Provisional 100.0
cd04737351 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain 100.0
pfam01070301 FMN_dh FMN-dependent dehydrogenase. 100.0
cd04736361 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding 100.0
cd02809299 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dep 100.0
COG1304360 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 a 100.0
KOG0538363 consensus 100.0
TIGR02708368 L_lactate_ox L-lactate oxidase; InterPro: IPR014080 Mem 100.0
PRK06843404 inositol-5-monophosphate dehydrogenase; Validated 100.0
PRK08649368 inositol-5-monophosphate dehydrogenase; Validated 100.0
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine monoph 100.0
PRK05458326 guanosine 5'-monophosphate oxidoreductase; Provisional 100.0
PRK05096347 guanosine 5'-monophosphate oxidoreductase; Provisional 100.0
TIGR01304376 IMP_DH_rel_2 IMP dehydrogenase family protein; InterPro 100.0
cd02808392 GltS_FMN Glutamate synthase (GltS) FMN-binding domain. 100.0
TIGR01306321 GMP_reduct_2 guanosine monophosphate reductase; InterPr 99.87
KOG1436398 consensus 99.82
TIGR01305343 GMP_reduct_1 guanosine monophosphate reductase; InterPr 99.77
pfam00478467 IMPDH IMP dehydrogenase / GMP reductase domain. This fa 100.0
PTZ00314499 inosine-5'-monophosphate dehydrogenase; Provisional 100.0
TIGR01302476 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; In 100.0
PRK05567486 inositol-5'-monophosphate dehydrogenase; Reviewed 100.0
PRK07807479 inositol-5-monophosphate dehydrogenase; Validated 100.0
PRK07107497 inositol-5-monophosphate dehydrogenase; Validated 100.0
KOG2550503 consensus 99.9
TIGR01303476 IMP_DH_rel_1 IMP dehydrogenase family protein; InterPro 99.55
PRK13126237 consensus 97.91
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 97.52
PRK07226266 fructose-bisphosphate aldolase; Provisional 97.42
PRK13307392 bifunctional formaldehyde-activating enzyme/3-hexulose- 97.25
COG0352211 ThiE Thiamine monophosphate synthase [Coenzyme metaboli 96.73
PRK07695202 transcriptional regulator TenI; Provisional 96.15
PTZ00170224 D-ribulose-5-phosphate 3-epimerase; Provisional 95.49
KOG1606296 consensus 94.55
COG0069485 GltB Glutamate synthase domain 2 [Amino acid transport 100.0
PRK08318413 dihydropyrimidine dehydrogenase; Validated 100.0
PRK07565333 dihydroorotate dehydrogenase 2; Reviewed 100.0
cd04739325 DHOD_like Dihydroorotate dehydrogenase (DHOD) like prot 99.98
TIGR01037308 pyrD_sub1_fam dihydroorotate dehydrogenase family prote 99.98
pfam01645367 Glu_synthase Conserved region in glutamate synthase. Th 99.97
PRK11750 1483 gltB glutamate synthase subunit alpha; Provisional 99.97
PRK07259301 dihydroorotate dehydrogenase 1B; Reviewed 99.96
cd04740296 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 99.96
COG0167310 PyrD Dihydroorotate dehydrogenase [Nucleotide transport 99.95
PRK02506308 dihydroorotate dehydrogenase 1A; Reviewed 99.93
pfam01180290 DHO_dh Dihydroorotate dehydrogenase. 99.91
KOG0399 2142 consensus 99.86
cd04741294 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 99.81
PRK05286336 dihydroorotate dehydrogenase 2; Reviewed 99.8
TIGR01036370 pyrD_sub2 dihydroorotate oxidase; InterPro: IPR005719 D 99.71
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 99.63
KOG1799471 consensus 99.57
TIGR00737336 nifR3_yhdG putative TIM-barrel protein, nifR3 family; I 99.57
COG0042323 tRNA-dihydrouridine synthase [Translation, ribosomal st 99.51
PRK13306216 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provi 93.59
cd02940299 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-bin 99.92
cd02810289 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and D 99.91
cd04738327 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 99.84
cd04730236 NPD_like 2-Nitropropane dioxygenase (NPD), one of the n 99.74
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) reduc 99.71
COG2070336 Dioxygenases related to 2-nitropropane dioxygenase [Gen 99.62
cd02801231 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FM 99.39
cd04722200 TIM_phosphate_binding TIM barrel proteins share a struc 99.37
PRK11815333 tRNA-dihydrouridine synthase A; Provisional 99.33
cd04743320 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, a 99.3
pfam01207309 Dus Dihydrouridine synthase (Dus). Members of this fami 99.28
KOG2335358 consensus 98.98
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme 98.81
PRK00208256 thiG thiazole synthase; Reviewed 98.79
PRK11840327 bifunctional sulfur carrier protein/thiazole synthase p 98.74
CHL00162267 thiG thiamin biosynthesis protein G; Validated 98.56
COG2022262 ThiG Uncharacterized enzyme of thiazole biosynthesis [N 98.48
PTZ00314 499 inosine-5'-monophosphate dehydrogenase; Provisional 96.94
pfam00478 467 IMPDH IMP dehydrogenase / GMP reductase domain. This fa 96.87
PRK05567 486 inositol-5'-monophosphate dehydrogenase; Reviewed 96.67
TIGR01302 476 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; In 96.37
KOG2333614 consensus 96.12
PRK07107 497 inositol-5-monophosphate dehydrogenase; Validated 95.9
PRK07807 479 inositol-5-monophosphate dehydrogenase; Validated 95.78
COG0329299 DapA Dihydrodipicolinate synthase/N-acetylneuraminate l 95.4
COG4981 717 Enoyl reductase domain of yeast-type FAS1 [Lipid metabo 90.9
pfam03060330 NPD 2-nitropropane dioxygenase. Members of this family 99.72
pfam05690246 ThiG Thiazole biosynthesis protein ThiG. This family co 98.75
COG0134254 TrpC Indole-3-glycerol phosphate synthase [Amino acid t 98.17
PRK13597252 imidazole glycerol phosphate synthase subunit HisF; Pro 98.1
PRK13585240 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 97.99
PRK03220257 consensus 97.92
PRK00748241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 97.87
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazole car 97.87
PRK02083253 imidazole glycerol phosphate synthase subunit HisF; Pro 97.78
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family belong 97.75
PRK08104212 consensus 97.74
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 97.57
PRK00830273 consensus 97.42
cd04742 418 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, 97.37
COG3010229 NanE Putative N-acetylmannosamine-6-phosphate epimerase 97.23
TIGR00007241 TIGR00007 phosphoribosylformimino-5-aminoimidazole carb 97.08
COG0106241 HisA Phosphoribosylformimino-5-aminoimidazole carboxami 97.07
PRK06843 404 inositol-5-monophosphate dehydrogenase; Validated 96.71
PRK00043210 thiE thiamine-phosphate pyrophosphorylase; Reviewed 96.55
PRK08385279 nicotinate-nucleotide pyrophosphorylase; Provisional 96.55
pfam01729169 QRPTase_C Quinolinate phosphoribosyl transferase, C-ter 96.24
cd01568269 QPRTase_NadC Quinolinate phosphoribosyl transferase (QA 96.04
PRK07428285 nicotinate-nucleotide pyrophosphorylase; Provisional 95.92
PRK03512211 thiamine-phosphate pyrophosphorylase; Provisional 95.74
PRK05848272 nicotinate-nucleotide pyrophosphorylase; Provisional 95.56
PRK08999312 hypothetical protein; Provisional 95.55
TIGR01304 376 IMP_DH_rel_2 IMP dehydrogenase family protein; InterPro 95.53
cd01572268 QPRTase Quinolinate phosphoribosyl transferase (QAPRTas 95.42
PRK13813215 orotidine 5'-phosphate decarboxylase; Provisional 95.26
PRK06096284 molybdenum transport protein ModD; Provisional 95.19
cd00564196 TMP_TenI Thiamine monophosphate synthase (TMP synthase) 95.14
PRK05742277 nicotinate-nucleotide pyrophosphorylase; Provisional 95.07
TIGR00078276 nadC nicotinate-nucleotide pyrophosphorylase; InterPro: 95.06
TIGR02814 449 pfaD_fam PfaD family protein; InterPro: IPR014179 The p 94.84
PRK07896288 nicotinate-nucleotide pyrophosphorylase; Provisional 94.81
KOG4201289 consensus 94.68
PRK02615345 thiamine-phosphate pyrophosphorylase; Provisional 93.81
PRK06559290 nicotinate-nucleotide pyrophosphorylase; Provisional 93.57
cd01573272 modD_like ModD; Quinolinate phosphoribosyl transferase 93.16
pfam02581180 TMP-TENI Thiamine monophosphate synthase/TENI. Thiamine 92.36
COG0157280 NadC Nicotinate-nucleotide pyrophosphorylase [Coenzyme 92.35
PRK06543281 nicotinate-nucleotide pyrophosphorylase; Provisional 92.02
TIGR00693210 thiE thiamine-phosphate pyrophosphorylase; InterPro: IP 91.91
PRK00230231 orotidine 5'-phosphate decarboxylase; Reviewed 91.44
cd00516281 PRTase_typeII Phosphoribosyltransferase (PRTase) type I 91.01
PRK09016296 quinolinate phosphoribosyltransferase; Validated 90.88
pfam03437254 BtpA BtpA family. The BtpA protein is tightly associate 90.66
PRK06106281 nicotinate-nucleotide pyrophosphorylase; Provisional 90.26
cd02911233 arch_FMN Archeal FMN-binding domain. This family of arc 99.39
PRK10550312 tRNA-dihydrouridine synthase C; Provisional 98.99
PRK13523337 NADPH dehydrogenase NamA; Provisional 98.78
pfam00724336 Oxidored_FMN NADH:flavin oxidoreductase / NADH oxidase 98.75
cd02930353 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding dom 98.63
cd02803327 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN bi 98.61
cd02932336 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN bind 98.54
cd02931382 ER_like_FMN Enoate reductase (ER)-like FMN-binding doma 98.53
PRK08255770 salicylyl-CoA 5-hydroxylase; Reviewed 98.52
cd04734343 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN bind 98.47
cd02929370 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and h 98.45
COG1902363 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme fam 98.43
cd04733338 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN bind 98.43
pfam04131192 NanE Putative N-acetylmannosamine-6-phosphate epimerase 98.41
pfam00218254 IGPS Indole-3-glycerol phosphate synthase. 98.35
PRK06552209 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 98.33
PRK09140206 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Review 98.29
PRK00278261 trpC indole-3-glycerol-phosphate synthase; Reviewed 98.27
cd02933338 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding d 98.24
cd00331217 IGPS Indole-3-glycerol phosphate synthase (IGPS); an en 98.22
PRK07455210 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 98.21
PRK13129267 consensus 98.16
PRK10605362 N-ethylmaleimide reductase; Provisional 98.01
pfam01791231 DeoC DeoC/LacD family aldolase. This family includes di 97.99
PRK13122242 consensus 97.95
PRK00507221 deoxyribose-phosphate aldolase; Provisional 97.94
COG0800211 Eda 2-keto-3-deoxy-6-phosphogluconate aldolase [Carbohy 97.92
cd00945201 Aldolase_Class_I Class I aldolases. The class I aldolas 97.86
cd00959203 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the D 97.82
PRK13957247 indole-3-glycerol-phosphate synthase; Provisional 97.8
PRK13117268 consensus 97.78
PRK06857209 consensus 97.76
COG0274228 DeoC Deoxyribose-phosphate aldolase [Nucleotide transpo 97.71
CHL00200263 trpA tryptophan synthase alpha subunit; Provisional 97.71
PRK08782219 consensus 97.67
TIGR01949259 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonat 97.66
PRK09427 459 bifunctional indole-3-glycerol phosphate synthase/phosp 97.66
PRK05283258 deoxyribose-phosphate aldolase; Provisional 97.61
PRK13139254 consensus 97.48
pfam04481243 DUF561 Protein of unknown function (DUF561). Protein of 97.46
PRK13115269 consensus 97.4
PRK13116278 consensus 97.33
PRK13140257 consensus 97.32
PRK13125247 trpA tryptophan synthase subunit alpha; Provisional 97.31
cd04747361 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN bind 97.3
PRK13124257 consensus 97.1
PRK08227291 aldolase; Validated 96.98
COG0159265 TrpA Tryptophan synthase alpha chain [Amino acid transp 96.98
pfam00290258 Trp_syntA Tryptophan synthase alpha chain. 96.9
PRK13112279 consensus 96.78
PRK13134257 consensus 96.75
PRK13135267 consensus 96.72
TIGR00736234 nifR3_rel_arch TIM-barrel protein, putative; InterPro: 96.7
PRK13114266 consensus 96.67
PRK13137266 consensus 96.6
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) a 96.55
PRK13119261 consensus 96.53
PRK13118269 consensus 96.52
PRK13113263 consensus 96.49
PRK13123256 consensus 96.49
cd00958235 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases 96.38
PRK03170292 dihydrodipicolinate synthase; Provisional 96.33
PRK13121265 consensus 96.3
PRK13111256 trpA tryptophan synthase subunit alpha; Provisional 96.29
PRK13131257 consensus 96.2
pfam00701289 DHDPS Dihydrodipicolinate synthetase family. This famil 95.98
COG1830265 FbaB DhnA-type fructose-1,6-bisphosphate aldolase and r 95.92
cd00950284 DHDPS Dihydrodipicolinate synthase (DHDPS) is a key enz 95.82
cd00408281 DHDPS-like Dihydrodipicolinate synthase family. A membe 95.78
TIGR03249296 KdgD 5-dehydro-4-deoxyglucarate dehydratase. 5-dehydro- 95.61
cd00951289 KDGDH 5-dehydro-4-deoxyglucarate dehydratase, also call 95.58
PRK04147294 N-acetylneuraminate lyase; Provisional 95.55
PRK13132246 consensus 95.41
PRK13138264 consensus 95.36
cd00954288 NAL N-Acetylneuraminic acid aldolase, also called N-ace 94.87
PRK13133267 consensus 93.82
PRK06852303 aldolase; Validated 93.26
TIGR01769212 GGGP geranylgeranylglyceryl phosphate synthase; InterPr 93.15
PRK13136253 consensus 92.79
KOG2334 477 consensus 91.56
PRK13120285 consensus 91.3
COG0036220 Rpe Pentose-5-phosphate-3-epimerase [Carbohydrate trans 90.87
cd04735353 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN bind 98.8
PRK13127262 consensus 97.76
TIGR00742326 yjbN TIM-barrel protein, yjbN family; InterPro: IPR0046 96.71
pfam09370268 TIM-br_sig_trns TIM-barrel signal transduction protein. 94.02
PRK09722227 allulose-6-phosphate 3-epimerase; Provisional 93.49
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) c 98.73
PRK01130222 N-acetylmannosamine-6-phosphate 2-epimerase; Provisiona 98.59
COG0269217 SgbH 3-hexulose-6-phosphate synthase and related protei 95.77
PRK03620296 5-dehydro-4-deoxyglucarate dehydratase; Provisional 95.69
pfam01081196 Aldolase KDPG and KHG aldolase. This family includes th 98.07
pfam00977229 His_biosynth Histidine biosynthesis protein. Proteins i 97.93
PRK07114223 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 97.89
PRK01033253 imidazole glycerol phosphate synthase subunit HisF; Pro 97.84
PRK02621254 consensus 97.83
PRK05211248 consensus 97.79
PRK02145257 consensus 97.78
cd04731243 HisF The cyclase subunit of imidazoleglycerol phosphate 97.76
PRK08904207 consensus 97.72
PRK01659252 consensus 97.69
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 97.59
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. This c 97.51
PRK06015212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 97.43
PRK05718212 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphoglucon 97.43
PRK02747257 consensus 97.4
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carb 97.39
PRK04281254 consensus 97.28
PRK13586231 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 96.84
cd02812219 PcrB_like PcrB_like proteins. One member of this family 96.77
COG1646240 Predicted phosphate-binding enzymes, TIM-barrel fold [G 96.6
PRK13586231 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 96.55
COG0214296 SNZ1 Pyridoxine biosynthesis enzyme [Coenzyme metabolis 96.52
PRK04169229 geranylgeranylglyceryl phosphate synthase-like protein; 96.15
TIGR03572232 WbuZ glycosyl amidation-associated protein WbuZ. This c 96.1
cd04726202 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase ( 96.07
pfam01884231 PcrB PcrB family. This family contains proteins that ar 95.73
TIGR01768242 GGGP-family geranylgeranylglyceryl phosphate synthase f 95.14
TIGR01919246 hisA-trpF bifunctional HisA/TrpF protein; InterPro: IPR 95.01
), involved in the fourth step of histidine biosynthesis. The bacterial HisF protein is a cyclase which catalyzes the cyclization reaction that produces D-erythro-imidazole glycerol phosphate during the sixth step of histidine biosynthesis. The yeast His7 protein is a bifunctional protein which catalyzes an amido-transferase reaction that generates imidazole-glycerol phosphate and 5-aminoimidazol-4-carboxamide. The latter is the ribonucleotide used for purine biosynthesis. The enzyme also catalyzes the cyclization reaction that produces D-erythro-imidazole glycerol phosphate, and is involved in the fifth and sixth steps in histidine biosynthesis. This family describes the histidine biosynthesis protein, HisF. ; GO: 0000107 imidazoleglycerol-phosphate synthase activity, 0000105 histidine biosynthetic process, 0005737 cytoplasm, 0009382 imidazoleglycerol-phosphate synthase complex." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00735">TIGR00735 312 hisF imidazoleglycerol phosphate synthase, cyclase subu 93.74
pfam04309174 G3P_antiterm Glycerol-3-phosphate responsive antitermin 93.51
) (TIM) is the glycolytic enzyme that catalyzes the reversible interconversion of glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. TIM plays an important role in several metabolic pathways and is essential for efficient energy production. It is a dimer of identical subunits, each of which is made up of about 250 amino-acid residues. A glutamic acid residue is involved in the catalytic mechanism . The sequence around the active site residue is perfectly conserved in all known TIM's. Deficiencies in TIM are associated with haemolytic anaemia coupled with a progressive, severe neurological disorder .; GO: 0004807 triose-phosphate isomerase activity, 0008152 metabolic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00419">TIGR00419244 tim triosephosphate isomerase; InterPro: IPR000652 Trio 91.74
PRK04302223 triosephosphate isomerase; Provisional 90.22
PRK13802 695 bifunctional indole-3-glycerol phosphate synthase/trypt 97.9
PRK07028 429 bifunctional hexulose-6-phosphate synthase/ribonuclease 97.88
pfam04898288 Glu_syn_central Glutamate synthase central domain. The 97.86
PRK11750 1483 gltB glutamate synthase subunit alpha; Provisional 97.53
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino acid t 97.45
PRK08185283 hypothetical protein; Provisional 94.5
TIGR00737336 nifR3_yhdG putative TIM-barrel protein, nifR3 family; I 97.2
PRK04180293 pyridoxine biosynthesis protein; Provisional 97.07
cd04727283 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (P 96.9
), involved in the fourth step of histidine biosynthesis. The bacterial HisF protein is a cyclase which catalyzes the cyclization reaction that produces D-erythro-imidazole glycerol phosphate during the sixth step of histidine biosynthesis. The yeast His7 protein is a bifunctional protein which catalyzes an amido-transferase reaction that generates imidazole-glycerol phosphate and 5-aminoimidazol-4-carboxamide. The latter is the ribonucleotide used for purine biosynthesis. The enzyme also catalyzes the cyclization reaction that produces D-erythro-imidazole glycerol phosphate, and is involved in the fifth and sixth steps in histidine biosynthesis. This family describes the histidine biosynthesis protein, HisF. ; GO: 0000107 imidazoleglycerol-phosphate synthase activity, 0000105 histidine biosynthetic process, 0005737 cytoplasm, 0009382 imidazoleglycerol-phosphate synthase complex." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00735">TIGR00735312 hisF imidazoleglycerol phosphate synthase, cyclase subu 96.31
PRK12376238 putative translaldolase; Provisional 90.67
TIGR01182205 eda 2-dehydro-3-deoxyphosphogluconate aldolase/4-hydrox 96.93
PRK10415321 tRNA-dihydrouridine synthase B; Provisional 96.55
cd00381325 IMPDH IMPDH: The catalytic domain of the inosine monoph 96.41
cd04729219 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) c 96.33
cd00952309 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydra 96.2
PRK01033253 imidazole glycerol phosphate synthase subunit HisF; Pro 96.09
TIGR01858282 tag_bisphos_ald class II aldolase, tagatose bisphosphat 95.66
pfam01207309 Dus Dihydrouridine synthase (Dus). Members of this fami 95.36
pfam04131192 NanE Putative N-acetylmannosamine-6-phosphate epimerase 95.24
PRK01130222 N-acetylmannosamine-6-phosphate 2-epimerase; Provisiona 95.1
PRK06512221 thiamine-phosphate pyrophosphorylase; Provisional 95.04
PRK13587234 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 94.91
PRK02145257 consensus 96.81
PRK02747257 consensus 96.71
PRK01659252 consensus 96.66
pfam00977229 His_biosynth Histidine biosynthesis protein. Proteins i 96.55
PRK02621254 consensus 96.51
PRK13585240 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 96.47
PRK00748241 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 96.46
PRK13597252 imidazole glycerol phosphate synthase subunit HisF; Pro 96.38
PRK04281254 consensus 96.38
cd04731243 HisF The cyclase subunit of imidazoleglycerol phosphate 96.35
PRK03220257 consensus 96.35
cd04723233 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carb 96.27
PRK02083253 imidazole glycerol phosphate synthase subunit HisF; Pro 96.23
PRK05211248 consensus 96.11
PRK00830273 consensus 96.04
COG0107256 HisF Imidazoleglycerol-phosphate synthase [Amino acid t 95.85
cd04732234 HisA HisA. Phosphoribosylformimino-5-aminoimidazole car 95.59
PRK04128228 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylid 95.25
cd02812219 PcrB_like PcrB_like proteins. One member of this family 93.67
PRK04169229 geranylgeranylglyceryl phosphate synthase-like protein; 93.25
COG0516170 GuaB IMP dehydrogenase/GMP reductase [Nucleotide transp 96.51
TIGR03128206 RuMP_HxlA 3-hexulose-6-phosphate synthase. at the cost 96.15
PRK00507221 deoxyribose-phosphate aldolase; Provisional 92.87
TIGR02317287 prpB methylisocitrate lyase; InterPro: IPR012695 Propio 92.87
>TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2; InterPro: IPR011179 This group represents the bacterial and archaeal isopentenyl-diphosphate delta-isomerase (IPP isomerase) Back     alignment and domain information
>PRK05437 isopentenyl pyrophosphate isomerase; Provisional Back     alignment and domain information
>cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain Back     alignment and domain information
>cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain Back     alignment and domain information
>cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain Back     alignment and domain information
>PRK11197 lldD L-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain Back     alignment and domain information
>pfam01070 FMN_dh FMN-dependent dehydrogenase Back     alignment and domain information
>cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain Back     alignment and domain information
>cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes Back     alignment and domain information
>COG1304 idi Isopentenyl diphosphate isomerase (BS_ypgA, MTH48 and related proteins) [Coenzyme transport and metabolism] Back     alignment and domain information
>KOG0538 consensus Back     alignment and domain information
>TIGR02708 L_lactate_ox L-lactate oxidase; InterPro: IPR014080 Members of this entry oxidize L-lactate to pyruvate, reducing molecular oxygen to hydrogen peroxide Back     alignment and domain information
>PRK06843 inositol-5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK08649 inositol-5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase Back     alignment and domain information
>PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>PRK05096 guanosine 5'-monophosphate oxidoreductase; Provisional Back     alignment and domain information
>TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein; InterPro: IPR005992 This family of proteins, often annotated as a putative IMP dehydrogenase, are related to IMP dehydrogenase and GMP reductase Back     alignment and domain information
>cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain Back     alignment and domain information
>TIGR01306 GMP_reduct_2 guanosine monophosphate reductase; InterPro: IPR005994 Guanosine monophosphate reductase (1 Back     alignment and domain information
>KOG1436 consensus Back     alignment and domain information
>TIGR01305 GMP_reduct_1 guanosine monophosphate reductase; InterPro: IPR005993 Guanosine monophosphate reductase (1 Back     alignment and domain information
>pfam00478 IMPDH IMP dehydrogenase / GMP reductase domain Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; InterPro: IPR005990 Synonyms: Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase IMP dehydrogenase (1 Back     alignment and domain information
>PRK05567 inositol-5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07807 inositol-5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07107 inositol-5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>KOG2550 consensus Back     alignment and domain information
>TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein; InterPro: IPR005991 This family of proteins, often annotated as a putative IMP dehydrogenase, are related to IMP dehydrogenase and GMP reductase and restricted to the high GC Gram-positive bacteria Back     alignment and domain information
>PRK13126 consensus Back     alignment and domain information
>PRK06512 thiamine-phosphate pyrophosphorylase; Provisional Back     alignment and domain information
>PRK07226 fructose-bisphosphate aldolase; Provisional Back     alignment and domain information
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional Back     alignment and domain information
>COG0352 ThiE Thiamine monophosphate synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK07695 transcriptional regulator TenI; Provisional Back     alignment and domain information
>PTZ00170 D-ribulose-5-phosphate 3-epimerase; Provisional Back     alignment and domain information
>KOG1606 consensus Back     alignment and domain information
>COG0069 GltB Glutamate synthase domain 2 [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase; Validated Back     alignment and domain information
>PRK07565 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins Back     alignment and domain information
>TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase family protein; InterPro: IPR005720 Dihydroorotate dehydrogenase (1 Back     alignment and domain information
>pfam01645 Glu_synthase Conserved region in glutamate synthase Back     alignment and domain information
>PRK11750 gltB glutamate synthase subunit alpha; Provisional Back     alignment and domain information
>PRK07259 dihydroorotate dehydrogenase 1B; Reviewed Back     alignment and domain information
>cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain Back     alignment and domain information
>COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK02506 dihydroorotate dehydrogenase 1A; Reviewed Back     alignment and domain information
>pfam01180 DHO_dh Dihydroorotate dehydrogenase Back     alignment and domain information
>KOG0399 consensus Back     alignment and domain information
>cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain Back     alignment and domain information
>PRK05286 dihydroorotate dehydrogenase 2; Reviewed Back     alignment and domain information
>TIGR01036 pyrD_sub2 dihydroorotate oxidase; InterPro: IPR005719 Dihydroorotate dehydrogenase (1 Back     alignment and domain information
>PRK10415 tRNA-dihydrouridine synthase B; Provisional Back     alignment and domain information
>KOG1799 consensus Back     alignment and domain information
>TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family; InterPro: IPR004652 This family represents one branch of COG0042 from COG (Predicted TIM-barrel enzymes, possibly dehydrogenases, nifR3 family) and includes NifR3 itself, from Rhodobacter capsulatus Back     alignment and domain information
>COG0042 tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13306 ulaD 3-keto-L-gulonate-6-phosphate decarboxylase; Provisional Back     alignment and domain information
>cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain Back     alignment and domain information
>cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 Back     alignment and domain information
>cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>COG2070 Dioxygenases related to 2-nitropropane dioxygenase [General function prediction only] Back     alignment and domain information
>cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain Back     alignment and domain information
>cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure Back     alignment and domain information
>PRK11815 tRNA-dihydrouridine synthase A; Provisional Back     alignment and domain information
>cd04743 NPD_PKS 2-Nitropropane dioxygenase (NPD)-like domain, associated with polyketide synthases (PKS) Back     alignment and domain information
>pfam01207 Dus Dihydrouridine synthase (Dus) Back     alignment and domain information
>KOG2335 consensus Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>COG2022 ThiG Uncharacterized enzyme of thiazole biosynthesis [Nucleotide transport and metabolism] Back     alignment and domain information
>PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>pfam00478 IMPDH IMP dehydrogenase / GMP reductase domain Back     alignment and domain information
>PRK05567 inositol-5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; InterPro: IPR005990 Synonyms: Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase IMP dehydrogenase (1 Back     alignment and domain information
>KOG2333 consensus Back     alignment and domain information
>PRK07107 inositol-5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK07807 inositol-5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG4981 Enoyl reductase domain of yeast-type FAS1 [Lipid metabolism] Back     alignment and domain information
>pfam03060 NPD 2-nitropropane dioxygenase Back     alignment and domain information
>pfam05690 ThiG Thiazole biosynthesis protein ThiG Back     alignment and domain information
>COG0134 TrpC Indole-3-glycerol phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13597 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK03220 consensus Back     alignment and domain information
>PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated Back     alignment and domain information
>cd04732 HisA HisA Back     alignment and domain information
>PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PRK08104 consensus Back     alignment and domain information
>PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional Back     alignment and domain information
>PRK00830 consensus Back     alignment and domain information
>cd04742 NPD_FabD 2-Nitropropane dioxygenase (NPD)-like domain, associated with the (acyl-carrier-protein) S-malonyltransferase FabD Back     alignment and domain information
>COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00007 TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase; InterPro: IPR006063 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (5 Back     alignment and domain information
>COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06843 inositol-5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information