254781033

254781033

HemY domain-containing protein

GeneID in NCBI database:8210056Locus tag:CLIBASIA_04675
Protein GI in NCBI database:254781033Protein Accession:YP_003065446.1
Gene range:-(1036301, 1037779)Protein Length:492aa
Gene description:HemY domain-containing protein
COG prediction:[R] FOG: TPR repeat
KEGG prediction:HemY domain-containing protein; K02498 HemY protein
SEED prediction:Homolog of E. coli HemY protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Heme and Siroheme Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED3 TM-Helix
HMMTOP3 TM-Helix
MEMSAT2 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS3 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490--
MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDSTIHPLDPHIRQPDDPGIKEQ
cHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccEEcccccccHHHccccccccccccEEccccccccccccccccccHHHHccccccHHHHcccccccccccccccccccccccccccHHcccccccccccc
cHHHHHHHHHHHHHHHHHHHHHcccccEEEEEccEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccEcccccHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccEEEccccccccccccccccccccEEEEcccccccccccHHHcccEEcccccccccccccccccccccccccEccccccccccccccccccccccccccc
MLRLIRYFFVISLVICSFIIVshypedvsitwgnrlyrtsPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMlqipatreFAVYSLYFESCRIGDLNSAQRYAtkaldispdapwvTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLenadkgdmiASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIwkvnphpeiANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSAlhampdplwisddgylssvwlplspisktlcyfewkiptkspeyisseninfslemaypaddLQSMLnngkknhlpsikkvssfedstihpldphirqpddpgikeq
MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKaldispdapwvTEAVVQQYVLAKEWSRAITflnqkkknakewnrNRAILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKslisqnkkRKAEVILEkiwkvnphpEIANIYthllsentVGKLKRALRleeinkesvesLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSsfedstihpldphirqpddpgikeq
MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDSTIHPLDPHIRQPDDPGIKEQ
MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLF*************ALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEWKIPTK*******************************************************************
MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDSTIHPLDPHIRQPDDPGIKEQ
MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNN**KNHLPSIKKVSSF*D**I******************
oooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDSTIHPLDPHIRQPDDPGIKEQ
MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDSTIHPLDPHIRQPDDPGIKEQ
MLRLIRYFFVISLVICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLFHMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAERQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEAVVQQYVLAKEWSRAITFLNQKKKNAKEWNRNRAILLIARSLENADKGDMIASYHDAIESLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKLKRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQANSHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEWKIPTKSPEYISSENINFSLEMAYPADDLQSMLNNGKKNHLPSIKKVSSFEDSTIHPLDPHIRQPDDPGIKEQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target492 HemY domain-containing protein [Candidatus Liberibacter
315122373487 HemY domain-containing protein [Candidatus Liberibacter 1 1e-165
150398166551 HemY domain-containing protein [Sinorhizobium medicae W 1 6e-73
86359488535 hypothetical protein RHE_CH03907 [Rhizobium etli CFN 42 1 4e-70
222087479532 hypothetical protein Arad_4359 [Agrobacterium radiobact 1 5e-69
15966835545 hypothetical protein SMc03234 [Sinorhizobium meliloti 1 1 7e-69
159185310538 hypothetical protein Atu2656 [Agrobacterium tumefaciens 1 1e-67
325294024535 HemY domain protein [Agrobacterium sp. H13-3] Length = 1 4e-67
327188880580 hypothetical conserved membrane protein [Rhizobium etli 1 9e-66
241206707544 HemY domain protein [Rhizobium leguminosarum bv. trifol 1 2e-65
116254227542 transmembrane protein [Rhizobium leguminosarum bv. vici 1 1e-64
>gi|315122373|ref|YP_004062862.1| HemY domain-containing protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 487 Back     alignment and organism information
 Score =  587 bits (1514), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 290/480 (60%), Positives = 368/480 (76%), Gaps = 4/480 (0%)

Query: 14  VICSFIIVSHYPEDVSITWGNRLYRTSPFVILSILYFFLFAWILLFAVSRFFLSCPAMLF 73
           +ICSFI +S+YP+D+ +TWGNR+Y+TSPFV+LSI+Y  +F ++L+  +SRFFLSCP+ + 
Sbjct: 1   MICSFIAISYYPDDIYVTWGNRIYQTSPFVMLSIVYILIFTFMLISKISRFFLSCPSTIA 60

Query: 74  HMLHKRNYDKGYKALYTGLMSIAAHNIPLARKMHSYVSQQHTFHNEYLVYLLEVQIALAE 133
           ++ HKRNY KGYK L  GL+SI A NIPLARKM SY+S +H FHNE L +LLE QIAL+E
Sbjct: 61  NIFHKRNYAKGYKELSAGLISITAQNIPLARKMFSYLSHRHIFHNESLFHLLEAQIALSE 120

Query: 134 RQYNIAHEKLEMMLQIPATREFAVYSLYFESCRIGDLNSAQRYATKALDISPDAPWVTEA 193
           ++++IA EK EMMLQIP TREFA+Y+LY E  RIGDL SAQ YA KAL ISP   W  EA
Sbjct: 121 KKHHIAREKFEMMLQIPETREFAIYNLYCEFYRIGDLKSAQCYAKKALKISPYISWGIEA 180

Query: 194 VVQQYVLAKEWSRAITFLNQKKK--NAKEWNRNRAILLIARSLENADKGDMIASYHDAIE 251
           ++Q Y L KEWS+AI FLN+ KK  N + +N ++AILL ARSLENA+KGD++ASY+DA+ 
Sbjct: 181 MLQYYALEKEWSKAIDFLNKNKKYENIETYNHHQAILLTARSLENAEKGDVVASYNDAMV 240

Query: 252 SLKLCDNSIMASICAAKSLISQNKKRKAEVILEKIWKVNPHPEIANIYTHLLSENTVGKL 311
            LKLC +SIMASICAAK+LI QNKK KA V+LEKIW++NPHPEIA IYT +LS N   ++
Sbjct: 241 VLKLCKHSIMASICAAKALILQNKKNKAAVVLEKIWEINPHPEIAYIYTIILSNNATERM 300

Query: 312 KRALRLEEINKESVESLVIVSKIALEMGSIDQAHAKAMLAMKIAPRKEIFLLLAQIEQAN 371
            RAL+LE INK+++ESL+ V+KI+LE G+I QA  KAMLA K  PRK IFLLLA+IE+A+
Sbjct: 301 NRALKLEAINKKNIESLITVAKISLETGNIQQAQTKAMLAAKANPRKGIFLLLAKIERAS 360

Query: 372 SHNTDKILYWTQSALHAMPDPLWISDDGYLSSVWLPLSPISKTLCYFEWKIPTKSPEYIS 431
           S+N DKILYWTQ AL+  PDPLWISDDGY SS WLPLSP SK LC FEWK+P K PEY +
Sbjct: 361 SNNLDKILYWTQRALYTEPDPLWISDDGYCSSTWLPLSPTSKKLCRFEWKVPAKIPEYTT 420

Query: 432 SEN-INFSLEMAYPADDLQSMLNNGKKNHLPSI-KKVSSFEDSTIHPLDPHIRQPDDPGI 489
           +++ I++     +     ++  N   KN  PSI +     ++  I  LDP IRQPDDPG+
Sbjct: 421 NKDLISYDESETFMTHLQETKRNKNIKNPYPSIHQDYHHPKNRNILSLDPSIRQPDDPGV 480


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150398166|ref|YP_001328633.1| HemY domain-containing protein [Sinorhizobium medicae WSM419] Length = 551 Back     alignment and organism information
>gi|86359488|ref|YP_471380.1| hypothetical protein RHE_CH03907 [Rhizobium etli CFN 42] Length = 535 Back     alignment and organism information
>gi|222087479|ref|YP_002546016.1| hypothetical protein Arad_4359 [Agrobacterium radiobacter K84] Length = 532 Back     alignment and organism information
>gi|15966835|ref|NP_387188.1| hypothetical protein SMc03234 [Sinorhizobium meliloti 1021] Length = 545 Back     alignment and organism information
>gi|159185310|ref|NP_355592.2| hypothetical protein Atu2656 [Agrobacterium tumefaciens str. C58] Length = 538 Back     alignment and organism information
>gi|325294024|ref|YP_004279888.1| HemY domain protein [Agrobacterium sp. H13-3] Length = 535 Back     alignment and organism information
>gi|327188880|gb|EGE56072.1| hypothetical conserved membrane protein [Rhizobium etli CNPAF512] Length = 580 Back     alignment and organism information
>gi|241206707|ref|YP_002977803.1| HemY domain protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 544 Back     alignment and organism information
>gi|116254227|ref|YP_770065.1| transmembrane protein [Rhizobium leguminosarum bv. viciae 3841] Length = 542 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target492 HemY domain-containing protein [Candidatus Liberibacter
pfam07219134 pfam07219, HemY_N, HemY protein N-terminus 5e-12
COG3071400 COG3071, HemY, Uncharacterized enzyme of heme biosynthe 8e-07
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR- 2e-04
COG3898531 COG3898, COG3898, Uncharacterized membrane-bound protei 1e-77
>gnl|CDD|148680 pfam07219, HemY_N, HemY protein N-terminus Back     alignment and domain information
>gnl|CDD|32885 COG3071, HemY, Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|163072 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|33686 COG3898, COG3898, Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 492 HemY domain-containing protein [Candidatus Liberibacter
COG3898531 Uncharacterized membrane-bound protein [Function unknow 100.0
PRK10747398 putative protoheme IX biogenesis protein; Provisional 100.0
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [Coenz 100.0
TIGR00540409 hemY_coli hemY protein; InterPro: IPR005254 This is a f 99.83
PRK10747398 putative protoheme IX biogenesis protein; Provisional 99.71
pfam07219134 HemY_N HemY protein N-terminus. This family represents 99.94
PRK11788389 hypothetical protein; Provisional 99.94
COG2956389 Predicted N-acetylglucosaminyl transferase [Carbohydrat 99.83
KOG4626 966 consensus 99.76
KOG1915677 consensus 99.27
TIGR02917 924 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipop 99.93
TIGR02917 924 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipop 99.93
PRK11447 1158 cellulose synthase subunit BcsC; Provisional 99.88
PRK11447 1158 cellulose synthase subunit BcsC; Provisional 99.78
KOG0495913 consensus 99.67
KOG1126638 consensus 99.67
KOG2002 1018 consensus 99.63
KOG1126638 consensus 99.55
KOG2076 895 consensus 99.11
KOG1129478 consensus 99.03
KOG1156 700 consensus 98.98
KOG0548539 consensus 98.84
KOG0550486 consensus 98.78
PRK04841903 transcriptional regulator MalT; Provisional 98.71
pfam04733290 Coatomer_E Coatomer epsilon subunit. This family repres 98.55
KOG4162799 consensus 98.38
KOG1915677 consensus 97.82
KOG4626 966 consensus 99.74
KOG2002 1018 consensus 99.57
KOG0624504 consensus 99.48
KOG0547606 consensus 99.35
KOG1173611 consensus 99.3
TIGR00990649 3a0801s09 mitochondrial precursor proteins import recep 99.27
KOG0624504 consensus 99.23
cd05804355 StaR_like StaR_like; a well-conserved protein found in 98.98
COG3898531 Uncharacterized membrane-bound protein [Function unknow 98.72
KOG4340459 consensus 96.99
KOG3081299 consensus 96.34
PRK11788389 hypothetical protein; Provisional 99.64
COG2956389 Predicted N-acetylglucosaminyl transferase [Carbohydrat 99.45
KOG0495913 consensus 99.63
KOG4162799 consensus 99.34
KOG1174564 consensus 99.28
KOG10701710 consensus 99.19
KOG1155559 consensus 99.15
pfam04733290 Coatomer_E Coatomer epsilon subunit. This family repres 99.15
KOG1173611 consensus 99.07
TIGR00990649 3a0801s09 mitochondrial precursor proteins import recep 98.97
cd05804355 StaR_like StaR_like; a well-conserved protein found in 98.1
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [Coenz 99.58
KOG0547 606 consensus 99.54
KOG1127 1238 consensus 98.91
PRK10370206 formate-dependent nitrite reductase complex subunit Nrf 98.51
COG4700251 Uncharacterized protein conserved in bacteria containin 97.83
COG2909894 MalT ATP-dependent transcriptional regulator [Transcrip 97.71
TIGR02552137 LcrH_SycD type III secretion low calcium response chape 97.48
KOG0543397 consensus 97.4
pfam03704146 BTAD Bacterial transcriptional activator domain. Found 96.85
KOG4555175 consensus 96.67
KOG0376476 consensus 93.96
KOG3824472 consensus 91.16
TIGR02521247 type_IV_pilW type IV pilus biogenesis/stability protein 99.54
KOG1174564 consensus 99.13
KOG1129478 consensus 98.85
KOG10701710 consensus 98.8
KOG2047835 consensus 95.8
KOG1585308 consensus 90.37
KOG2076 895 consensus 99.52
TIGR02521247 type_IV_pilW type IV pilus biogenesis/stability protein 99.44
KOG1125579 consensus 99.37
KOG2003840 consensus 99.35
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR repe 98.68
KOG1127 1238 consensus 98.22
COG4105254 ComL DNA uptake lipoprotein [General function predictio 98.06
KOG2796366 consensus 97.11
PRK10049 818 pgaA outer membrane protein PgaA; Provisional 99.41
COG4783484 Putative Zn-dependent protease, contains TPR repeats [G 98.83
KOG2376652 consensus 98.34
KOG1128777 consensus 98.1
KOG3785557 consensus 97.82
PRK10153512 DNA-binding transcriptional activator CadC; Provisional 96.27
pfam10300446 IML2 Putative mitochondrial outer membrane protein. Thi 95.43
PRK10049 818 pgaA outer membrane protein PgaA; Provisional 99.39
COG4783484 Putative Zn-dependent protease, contains TPR repeats [G 99.06
COG4235287 Cytochrome c biogenesis factor [Posttranslational modif 98.73
KOG0553304 consensus 98.19
COG3118304 Thioredoxin domain-containing protein [Posttranslationa 98.14
pfam09295395 ChAPs ChAPs (Chs5p-Arf1p-binding proteins). ChAPs (Chs5 97.89
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; Prov 97.71
COG1729262 Uncharacterized protein conserved in bacteria [Function 97.53
COG4649221 Uncharacterized protein conserved in bacteria [Function 97.44
KOG2796366 consensus 97.13
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motility and 99.36
PRK12370553 invasion protein regulator; Provisional 98.84
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR repe 98.8
KOG0550486 consensus 98.55
CHL00033165 ycf3 photosystem I assembly protein Ycf3 98.24
COG4700251 Uncharacterized protein conserved in bacteria containin 97.85
KOG1941518 consensus 97.31
KOG3617 1416 consensus 94.95
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motility and 99.35
KOG2003840 consensus 99.24
KOG1125579 consensus 99.06
PRK12370553 invasion protein regulator; Provisional 99.0
KOG1840508 consensus 98.98
KOG0548539 consensus 98.66
COG4105254 ComL DNA uptake lipoprotein [General function predictio 96.85
KOG1155559 consensus 99.19
KOG1840508 consensus 98.79
PRK10370206 formate-dependent nitrite reductase complex subunit Nrf 98.79
PRK11189297 lipoprotein NlpI; Provisional 98.55
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [General fu 96.54
PRK12798416 chemotaxis protein; Reviewed 96.22
pfam05843275 Suf Suppressor of forked protein (Suf). This family con 93.37
KOG1156 700 consensus 98.75
PRK04841903 transcriptional regulator MalT; Provisional 98.49
KOG2053 932 consensus 97.89
COG0457291 NrfG FOG: TPR repeat [General function prediction only] 96.53
KOG4234271 consensus 96.48
pfam06552186 TOM20_plant Plant specific mitochondrial import recepto 95.66
PRK10941269 putative transcriptional regulator; Provisional 95.43
KOG0545329 consensus 94.84
KOG1308377 consensus 94.39
pfam09613156 HrpB1_HrpK Bacterial type III secretion protein (HrpB1_ 93.79
pfam0051534 TPR_1 Tetratricopeptide repeat. 90.96
KOG3060289 consensus 98.63
PRK10866243 outer membrane protein assembly complex subunit YfiO; P 98.39
KOG2047835 consensus 96.28
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. Membe 98.63
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; Prov 98.63
KOG3081299 consensus 98.14
KOG3060289 consensus 98.62
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.54
PRK10866243 outer membrane protein assembly complex subunit YfiO; P 97.77
pfam04053435 Coatomer_WDAD Coatomer WD associated region. This regio 93.58
KOG3617 1416 consensus 93.33
KOG2376 652 consensus 98.59
KOG4340459 consensus 98.04
KOG2053 932 consensus 97.05
COG4649221 Uncharacterized protein conserved in bacteria [Function 96.22
COG2976207 Uncharacterized protein conserved in bacteria [Function 94.56
pfam04348 535 LppC LppC putative lipoprotein. This family includes se 94.36
KOG0376476 consensus 94.3
pfam10345 593 Cohesin_load Cohesin loading factor. Cohesin_load is a 93.8
cd00189100 TPR Tetratricopeptide repeat domain; typically contains 98.5
PRK10803262 hypothetical protein; Provisional 97.94
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF; InterPro: IPR 97.8
PRK10941269 putative transcriptional regulator; Provisional 94.58
KOG0551390 consensus 94.1
PRK11906458 transcriptional regulator; Provisional 93.8
KOG4507886 consensus 92.71
COG4235287 Cytochrome c biogenesis factor [Posttranslational modif 98.45
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.35
pfam09295395 ChAPs ChAPs (Chs5p-Arf1p-binding proteins). ChAPs (Chs5 97.79
COG3118304 Thioredoxin domain-containing protein [Posttranslationa 97.41
pfam03704146 BTAD Bacterial transcriptional activator domain. Found 96.56
KOG4648 536 consensus 96.16
KOG0551390 consensus 96.0
KOG4648 536 consensus 94.44
PRK10153512 DNA-binding transcriptional activator CadC; Provisional 93.27
TIGR02561190 HrpB1_HrpK type III secretion protein HrpB1/HrpK; Inter 91.02
KOG1130639 consensus 90.14
cd00189100 TPR Tetratricopeptide repeat domain; typically contains 98.39
COG4455273 ImpE Protein of avirulence locus involved in temperatur 96.1
KOG1308377 consensus 93.53
COG3629280 DnrI DNA-binding transcriptional activator of the SARP 92.68
PRK06330 906 transcript cleavage factor/unknown domain fusion protei 92.51
pfam04190260 DUF410 Protein of unknown function (DUF410). This famil 90.91
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. Membe 98.27
PRK11189297 lipoprotein NlpI; Provisional 98.24
KOG3785 557 consensus 97.27
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [General fu 97.27
KOG0553304 consensus 98.04
KOG4234271 consensus 95.29
KOG4642284 consensus 92.76
KOG1128777 consensus 98.01
CHL00033165 ycf3 photosystem I assembly protein Ycf3 97.64
pfam02259351 FAT FAT domain. The FAT domain is named after FRAP, ATM 96.03
KOG0543397 consensus 97.79
COG0457291 NrfG FOG: TPR repeat [General function prediction only] 96.38
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF; InterPro: IPR 97.65
PRK10803262 hypothetical protein; Provisional 97.62
COG1729262 Uncharacterized protein conserved in bacteria [Function 97.56
TIGR02552137 LcrH_SycD type III secretion low calcium response chape 97.44
COG2976207 Uncharacterized protein conserved in bacteria [Function 97.22
KOG4555175 consensus 96.85
pfam09613156 HrpB1_HrpK Bacterial type III secretion protein (HrpB1_ 95.45
COG2909894 MalT ATP-dependent transcriptional regulator [Transcrip 97.08
pfam07219134 HemY_N HemY protein N-terminus. This family represents 96.46
pfam0630580 DUF1049 Protein of unknown function (DUF1049). This fam 96.46
COG541698 Uncharacterized integral membrane protein [Function unk 94.35
COG377197 Predicted membrane protein [Function unknown] 92.99
COG1066 456 Sms Predicted ATP-dependent serine protease [Posttransl 96.29
PRK11823 454 DNA repair protein RadA; Provisional 96.18
cd01121 372 Sms Sms (bacterial radA) DNA repair protein. This prote 95.99
COG1592166 Rubrerythrin [Energy production and conversion] 95.23
TIGR00416 481 sms DNA repair protein RadA; InterPro: IPR004504 RadA/S 95.1
COG1110 1187 Reverse gyrase [DNA replication, recombination, and rep 90.07
pfam1114665 DUF2905 Protein of unknown function (DUF2905). This is 93.52
pfam04348 535 LppC LppC putative lipoprotein. This family includes se 93.52
KOG1586288 consensus 92.99
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein; InterPro: IPR005254 This is a family of uncharacterised proteins encoded next to a heme-biosynthetic enzyme in two gamma division proteobacteria (Escherichia coli and Haemophilus influenzae) Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>pfam07219 HemY_N HemY protein N-terminus Back     alignment and domain information
>PRK11788 hypothetical protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4626 consensus Back     alignment and domain information
>KOG1915 consensus Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein; InterPro: IPR014266 This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system , analogous to the LPXTG/sortase system common in Gram-positive bacteria Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein; InterPro: IPR014266 This protein family occurs in strictly within a subset of Gram-negative bacterial species with the proposed PEP-CTERM/exosortase system , analogous to the LPXTG/sortase system common in Gram-positive bacteria Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG0495 consensus Back     alignment and domain information
>KOG1126 consensus Back     alignment and domain information
>KOG2002 consensus Back     alignment and domain information
>KOG1126 consensus Back     alignment and domain information
>KOG2076 consensus Back     alignment and domain information
>KOG1129 consensus Back     alignment and domain information
>KOG1156 consensus Back     alignment and domain information
>KOG0548 consensus Back     alignment and domain information
>KOG0550 consensus Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>pfam04733 Coatomer_E Coatomer epsilon subunit Back     alignment and domain information
>KOG4162 consensus Back     alignment and domain information
>KOG1915 consensus Back     alignment and domain information
>KOG4626 consensus Back     alignment and domain information
>KOG2002 consensus Back     alignment and domain information
>KOG0624 consensus Back     alignment and domain information
>KOG0547 consensus Back     alignment and domain information
>KOG1173 consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor; InterPro: IPR005687 The mitochondrial protein translocase (MPT) family, which brings nuclearly encoded preproteins into mitochondria, is very complex with 19 currently identified protein constituents Back     alignment and domain information
>KOG0624 consensus Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Back     alignment and domain information
>KOG3081 consensus Back     alignment and domain information
>PRK11788 hypothetical protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0495 consensus Back     alignment and domain information
>KOG4162 consensus Back     alignment and domain information
>KOG1174 consensus Back     alignment and domain information
>KOG1070 consensus Back     alignment and domain information
>KOG1155 consensus Back     alignment and domain information
>pfam04733 Coatomer_E Coatomer epsilon subunit Back     alignment and domain information
>KOG1173 consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor; InterPro: IPR005687 The mitochondrial protein translocase (MPT) family, which brings nuclearly encoded preproteins into mitochondria, is very complex with 19 currently identified protein constituents Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG0547 consensus Back     alignment and domain information
>KOG1127 consensus Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD; InterPro: IPR005415 The type III secretion system of Gram-negative bacteria is used to transport virulence factors from the pathogen directly into the host cell and is only triggered when the bacterium comes into close contact with the host Back     alignment and domain information
>KOG0543 consensus Back     alignment and domain information
>pfam03704 BTAD Bacterial transcriptional activator domain Back     alignment and domain information
>KOG4555 consensus Back     alignment and domain information
>KOG0376 consensus Back     alignment and domain information
>KOG3824 consensus Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW; InterPro: IPR013360 Proteins in this entry are designated PilF and PilW Back     alignment and domain information
>KOG1174 consensus Back     alignment and domain information
>KOG1129 consensus Back     alignment and domain information
>KOG1070 consensus Back     alignment and domain information
>KOG2047 consensus Back     alignment and domain information
>KOG1585 consensus Back     alignment and domain information
>KOG2076 consensus Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW; InterPro: IPR013360 Proteins in this entry are designated PilF and PilW Back     alignment and domain information
>KOG1125 consensus Back     alignment and domain information
>KOG2003 consensus Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1127 consensus Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Back     alignment and domain information
>KOG1128 consensus Back     alignment and domain information
>KOG3785 consensus Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>pfam10300 IML2 Putative mitochondrial outer membrane protein Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0553 consensus Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>pfam09295 ChAPs ChAPs (Chs5p-Arf1p-binding proteins) Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2796 consensus Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0550 consensus Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG1941 consensus Back     alignment and domain information
>KOG3617 consensus Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2003 consensus Back     alignment and domain information
>KOG1125 consensus Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1840 consensus Back     alignment and domain information
>KOG0548 consensus Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG1155 consensus Back     alignment and domain information
>KOG1840 consensus Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK12798 chemotaxis protein; Reviewed Back     alignment and domain information
>pfam05843 Suf Suppressor of forked protein (Suf) Back     alignment and domain information
>KOG1156 consensus Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG2053 consensus Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG4234 consensus Back     alignment and domain information
>pfam06552 TOM20_plant Plant specific mitochondrial import receptor subunit TOM20 Back     alignment and domain information
>PRK10941 putative transcriptional regulator; Provisional Back     alignment and domain information
>KOG0545 consensus Back     alignment and domain information
>KOG1308 consensus Back     alignment and domain information
>pfam09613 HrpB1_HrpK Bacterial type III secretion protein (HrpB1_HrpK) Back     alignment and domain information
>pfam00515 TPR_1 Tetratricopeptide repeat Back     alignment and domain information
>KOG3060 consensus Back     alignment and domain information
>PRK10866 outer membrane protein assembly complex subunit YfiO; Provisional Back     alignment and domain information
>KOG2047 consensus Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG3081 consensus Back     alignment and domain information
>KOG3060 consensus Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK10866 outer membrane protein assembly complex subunit YfiO; Provisional Back     alignment and domain information
>pfam04053 Coatomer_WDAD Coatomer WD associated region Back     alignment and domain information
>KOG3617 consensus Back     alignment and domain information
>KOG2376 consensus Back     alignment and domain information
>KOG4340 consensus Back     alignment and domain information
>KOG2053 consensus Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam04348 LppC LppC putative lipoprotein Back     alignment and domain information
>KOG0376 consensus Back     alignment and domain information
>pfam10345 Cohesin_load Cohesin loading factor Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK10803 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF; InterPro: IPR014162 Members of this protein family are the product of one of seven genes regularly clustered in operons to encode the proteins of the tol-pal system, which is critical for maintaining the integrity of the bacterial outer membrane Back     alignment and domain information
>PRK10941 putative transcriptional regulator; Provisional Back     alignment and domain information
>KOG0551 consensus Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG4507 consensus Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>pfam09295 ChAPs ChAPs (Chs5p-Arf1p-binding proteins) Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>pfam03704 BTAD Bacterial transcriptional activator domain Back     alignment and domain information
>KOG4648 consensus Back     alignment and domain information
>KOG0551 consensus Back     alignment and domain information
>KOG4648 consensus Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK; InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG1130 consensus Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG4455 ImpE Protein of avirulence locus involved in temperature-dependent protein secretion [General function prediction only] Back     alignment and domain information
>KOG1308 consensus Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PRK06330 transcript cleavage factor/unknown domain fusion protein; Validated Back     alignment and domain information
>pfam04190 DUF410 Protein of unknown function (DUF410) Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG3785 consensus Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0553 consensus Back     alignment and domain information
>KOG4234 consensus Back     alignment and domain information
>KOG4642 consensus Back     alignment and domain information
>KOG1128 consensus Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>pfam02259 FAT FAT domain Back     alignment and domain information
>KOG0543 consensus Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF; InterPro: IPR014162 Members of this protein family are the product of one of seven genes regularly clustered in operons to encode the proteins of the tol-pal system, which is critical for maintaining the integrity of the bacterial outer membrane Back     alignment and domain information
>PRK10803 hypothetical protein; Provisional Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD; InterPro: IPR005415 The type III secretion system of Gram-negative bacteria is used to transport virulence factors from the pathogen directly into the host cell and is only triggered when the bacterium comes into close contact with the host Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4555 consensus Back     alignment and domain information
>pfam09613 HrpB1_HrpK Bacterial type III secretion protein (HrpB1_HrpK) Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>pfam07219 HemY_N HemY protein N-terminus Back     alignment and domain information
>pfam06305 DUF1049 Protein of unknown function (DUF1049) Back     alignment and domain information
>COG5416 Uncharacterized integral membrane protein [Function unknown] Back     alignment and domain information
>COG3771 Predicted membrane protein [Function unknown] Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA; InterPro: IPR004504 RadA/Sms is a highly conserved eubacterial protein that shares sequence similarity with both RecA strand transferase and lon protease Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam11146 DUF2905 Protein of unknown function (DUF2905) Back     alignment and domain information
>pfam04348 LppC LppC putative lipoprotein Back     alignment and domain information
>KOG1586 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target492 HemY domain-containing protein [Candidatus Liberibacter
1w3b_A388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 2e-15
3lca_A533 Structure Of Tom71 Complexed With Hsp70 Ssa1 C Term 6e-07
3fp2_A537 Crystal Structure Of Tom71 Complexed With Hsp82 C-T 6e-07
2gw1_A514 Crystal Structure Of The Yeast Tom70 Length = 514 2e-06
1w3b_A388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 4e-11
2q7f_A243 Crystal Structure Of Yrrb: A Tpr Protein With An Un 5e-08
2q7f_A243 Crystal Structure Of Yrrb: A Tpr Protein With An Un