254781040

254781040

hypothetical protein CLIBASIA_04710

GeneID in NCBI database:8210063Locus tag:CLIBASIA_04710
Protein GI in NCBI database:254781040Protein Accession:YP_003065453.1
Gene range:+(1043470, 1043901)Protein Length:143aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized conserved protein
KEGG prediction:hypothetical protein
SEED prediction:Protein of unknown function DUF55
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140---
MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSNPPL
ccccEEEcccccccHHHHHHcccccccccccccHHHHHHHHHHHHccEEEEEEcccccEEEEEEEEEEcccccccccccccEEEEEEEEcccccccccHHHHHccccccccHHHHcccccEEEccHHHHHHHHHHHHcccccc
ccEEEEccccccccHHHHHHccccccccccHHHHHHHHHHHHHcccccEEEEEccccccEEEEEEEEcccccccccccccccEEEEEEEEccccccccHHHHHccHHHHcccEEccccEEEccccHHHHHHHHHHcccccccc
maywlvksepsewswkmqqdkgrvgeawtgvrnyqarnnmrkmrvgdkgffyhsnkgreIVGIFEVItctypdptaeqsscwecvdicavcsmpcpvslmaikanprLSSMILIVSsrlsvqpvttdEYLEVCrmgklsnppl
maywlvksepsewswkmqqdkgrvgeawtgvrnyqarnnmrkmrvgDKGFFYHSNKGREIVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVssrlsvqpvTTDEYLevcrmgklsnppl
MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSNPPL
MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKL*****
MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSNPPL
*AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLS****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSNPPL
MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSNPPL
MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSNPPL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target143 hypothetical protein CLIBASIA_04710 [Candidatus Liberib
315122379148 hypothetical protein CKC_03155 [Candidatus Liberibacter 1 7e-65
325294017147 hypothetical protein AGROH133_08872 [Agrobacterium sp. 1 1e-52
222087472143 hypothetical protein Arad_4351 [Agrobacterium radiobact 1 2e-52
15889904147 hypothetical protein Atu2648 [Agrobacterium tumefaciens 1 2e-52
15966828143 hypothetical protein SMc03227 [Sinorhizobium meliloti 1 1 1e-50
222150051143 hypothetical protein Avi_4141 [Agrobacterium vitis S4] 1 5e-50
227823728143 hypothetical protein NGR_c32150 [Sinorhizobium fredii N 1 7e-50
163757404142 hypothetical protein HPDFL43_18377 [Hoeflea phototrophi 1 1e-49
150398159143 hypothetical protein Smed_2962 [Sinorhizobium medicae W 1 1e-49
292490246141 hypothetical protein Nhal_0077 [Nitrosococcus halophilu 1 5e-49
>gi|315122379|ref|YP_004062868.1| hypothetical protein CKC_03155 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 148 Back     alignment and organism information
 Score =  249 bits (637), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 126/143 (88%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
           MAYWLVKSEP  WSWKMQQDKG +GEAWTGVRNYQARNNMRKMR+GDKGFFYHSNKGREI
Sbjct: 1   MAYWLVKSEPCVWSWKMQQDKGSIGEAWTGVRNYQARNNMRKMRIGDKGFFYHSNKGREI 60

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGIFEVIT TYPDPT E  S WECVDI +VCSMPCPVSL+AIK N +LS M L+  SRLS
Sbjct: 61  VGIFEVITGTYPDPTVEGYSPWECVDIRSVCSMPCPVSLVAIKGNLQLSKMALVTFSRLS 120

Query: 121 VQPVTTDEYLEVCRMGKLSNPPL 143
           VQPV  DEYLEVCRMGKLS+PPL
Sbjct: 121 VQPVKLDEYLEVCRMGKLSSPPL 143


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325294017|ref|YP_004279881.1| hypothetical protein AGROH133_08872 [Agrobacterium sp. H13-3] Length = 147 Back     alignment and organism information
>gi|222087472|ref|YP_002546009.1| hypothetical protein Arad_4351 [Agrobacterium radiobacter K84] Length = 143 Back     alignment and organism information
>gi|15889904|ref|NP_355585.1| hypothetical protein Atu2648 [Agrobacterium tumefaciens str. C58] Length = 147 Back     alignment and organism information
>gi|15966828|ref|NP_387181.1| hypothetical protein SMc03227 [Sinorhizobium meliloti 1021] Length = 143 Back     alignment and organism information
>gi|222150051|ref|YP_002551008.1| hypothetical protein Avi_4141 [Agrobacterium vitis S4] Length = 143 Back     alignment and organism information
>gi|227823728|ref|YP_002827701.1| hypothetical protein NGR_c32150 [Sinorhizobium fredii NGR234] Length = 143 Back     alignment and organism information
>gi|163757404|ref|ZP_02164493.1| hypothetical protein HPDFL43_18377 [Hoeflea phototrophica DFL-43] Length = 142 Back     alignment and organism information
>gi|150398159|ref|YP_001328626.1| hypothetical protein Smed_2962 [Sinorhizobium medicae WSM419] Length = 143 Back     alignment and organism information
>gi|292490246|ref|YP_003525685.1| hypothetical protein Nhal_0077 [Nitrosococcus halophilus Nc4] Length = 141 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target143 hypothetical protein CLIBASIA_04710 [Candidatus Liberib
pfam01878143 pfam01878, DUF55, Protein of unknown function DUF55 3e-39
KOG3383187 KOG3383, KOG3383, KOG3383, Uncharacterized conserved pr 5e-26
COG2947156 COG2947, COG2947, Uncharacterized conserved protein [Fu 6e-45
PRK00809144 PRK00809, PRK00809, hypothetical protein; Provisional 0.003
>gnl|CDD|145181 pfam01878, DUF55, Protein of unknown function DUF55 Back     alignment and domain information
>gnl|CDD|38593 KOG3383, KOG3383, KOG3383, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|32770 COG2947, COG2947, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|179133 PRK00809, PRK00809, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 143 hypothetical protein CLIBASIA_04710 [Candidatus Liberib
COG2947156 Uncharacterized conserved protein [Function unknown] 100.0
pfam01878143 DUF55 Protein of unknown function DUF55. This family of 100.0
KOG3383187 consensus 100.0
PRK00809144 hypothetical protein; Provisional 98.35
COG4933124 Uncharacterized conserved protein [Function unknown] 96.19
PRK02268141 hypothetical protein; Provisional 92.0
>COG2947 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>pfam01878 DUF55 Protein of unknown function DUF55 Back     alignment and domain information
>KOG3383 consensus Back     alignment and domain information
>PRK00809 hypothetical protein; Provisional Back     alignment and domain information
>COG4933 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK02268 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target143 hypothetical protein CLIBASIA_04710 [Candidatus Liberib
2gbs_A145 Nmr Structure Of Rpa0253 From Rhodopseudomonas Palu 1e-44
1zce_A155 X-Ray Crystal Structure Of Protein Atu2648 From Agr 2e-43
3eop_A176 Crystal Structure Of The Duf55 Domain Of Human Thym 3e-39
2ar1_A172 Structure Of Hypothetical Protein From Leishmania M 3e-37
2eve_A157 X-Ray Crystal Structure Of Protein Pspto5229 From P 2e-36
2g2x_A157 X-Ray Crystal Structure Protein Q88ch6 From Pseudom 6e-35
>gi|99032450|pdb|2GBS|A Chain A, Nmr Structure Of Rpa0253 From Rhodopseudomonas Palustris. No Structural Genomics Consortium Target Rpr3 Length = 145 Back     alignment and structure
 Score =  182 bits (463), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 81/137 (59%), Positives = 98/137 (71%), Gaps = 1/137 (0%)

Query: 2   AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIV 61
           AYWLVKSEPS WSW  Q  KG  GEAWTGVRN+ A+ +M  MR GD+ F+YHSN+G+EIV
Sbjct: 2   AYWLVKSEPSVWSWDQQVAKGAAGEAWTGVRNHSAKLHMVAMRRGDRAFYYHSNEGKEIV 61

Query: 62  GIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSV 121
           GI E+I   YPDPT   S  + CVDI A   +  PV+L A+KA PRL+ M L+  SRLSV
Sbjct: 62  GIAEIIREAYPDPTDA-SGKFVCVDIKADKPLKTPVTLAAVKAEPRLADMALMKYSRLSV 120

Query: 122 QPVTTDEYLEVCRMGKL 138
           QPVT +E+  VC+MG L
Sbjct: 121 QPVTAEEWKLVCKMGGL 137


>gi|66361456|pdb|1ZCE|A Chain A, X-Ray Crystal Structure Of Protein Atu2648 From Agrobacteriu Tumefaciens. Northeast Structural Genomics Consortium Targe Length = 155 Back     alignment and structure
>gi|260099885|pdb|3EOP|A Chain A, Crystal Structure Of The Duf55 Domain Of Human Thymocyte Nuclear Protein 1 Length = 176 Back     alignment and structure
>gi|75766309|pdb|2AR1|A Chain A, Structure Of Hypothetical Protein From Leishmania Major Length = 172 Back     alignment and structure
>gi|83754987|pdb|2EVE|A Chain A, X-Ray Crystal Structure Of Protein Pspto5229 From Pseudomona Syringae. Northeast Structural Genomics Consortium Target P Length = 157 Back     alignment and structure
>gi|93279841|pdb|2G2X|A Chain A, X-Ray Crystal Structure Protein Q88ch6 From Pseudomonas Puti Northeast Structural Genomics Consortium Target Ppr72. Length = 157 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target143 hypothetical protein CLIBASIA_04710 [Candidatus Liberib
1zce_A155 Hypothetical protein ATU2648; alpha-beta protein., stru 8e-49
2gbs_A145 Hypothetical protein RPA0253; alpha-beta, RPR3, NESG, s 3e-45
2ar1_A172 Hypothetical protein; structural genomics, PSI, protein 2e-42
3eop_A176 Thymocyte nuclear protein 1; protein of unknown functio 7e-41
2eve_A157 Hypothetical protein pspto5229; alpha-beta protein, str 4e-39
>1zce_A Hypothetical protein ATU2648; alpha-beta protein., structural genomics, PSI, protein structure initiative; 1.30A {Agrobacterium tumefaciens str} SCOP: b.122.1.8 Length = 155 Back     alignment and structure
 Score =  187 bits (476), Expect = 8e-49
 Identities = 95/142 (66%), Positives = 111/142 (78%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
             YWL KSEP +WSW+MQ+ KG  GE WTGVRNYQARNNMR M++GDKGFFYHSN+G ++
Sbjct: 2   ANYWLYKSEPFKWSWEMQKAKGETGEEWTGVRNYQARNNMRAMKIGDKGFFYHSNEGLDV 61

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD TAE    W+CVDI AVC MP PVSL  +KANP+L  M L+ S RLS
Sbjct: 62  VGIVEVCALSHPDSTAEGDLKWDCVDIRAVCDMPQPVSLKDVKANPKLEKMSLVTSMRLS 121

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT +EYLEVCRMG L+NPP
Sbjct: 122 VQPVTEEEYLEVCRMGGLANPP 143


>2gbs_A Hypothetical protein RPA0253; alpha-beta, RPR3, NESG, structural genomics, COG2947, PSI, protein structure initiative; NMR {Rhodopseudomonas palustris CGA009} SCOP: b.122.1.8 Length = 145 Back     alignment and structure
>2ar1_A Hypothetical protein; structural genomics, PSI, protein structure initiative, structural genomics of pathogenic protozoa consortium; 1.60A {Leishmania major} SCOP: b.122.1.8 Length = 172 Back     alignment and structure
>3eop_A Thymocyte nuclear protein 1; protein of unknown function, alternative splicing, nucleus, phosphoprotein; 2.30A {Homo sapiens} Length = 176 Back     alignment and structure
>2eve_A Hypothetical protein pspto5229; alpha-beta protein, structural genomics, PSI, protein structure initiative; HET: MPO; 1.60A {Pseudomonas syringae PV} SCOP: b.122.1.8 PDB: 2g2x_A Length = 157 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target143 hypothetical protein CLIBASIA_04710 [Candidatus Liberib
3eop_A176 Thymocyte nuclear protein 1; protein of unknown functio 100.0
1zce_A155 Hypothetical protein ATU2648; alpha-beta protein., stru 100.0
2gbs_A145 Hypothetical protein RPA0253; alpha-beta, RPR3, NESG, s 100.0
2ar1_A172 Hypothetical protein; structural genomics, PSI, protein 100.0
2eve_A157 Hypothetical protein pspto5229; alpha-beta protein, str 100.0
2p5d_A147 UPF0310 protein mjecl36; NPPSFA, national project on pr 99.94
2hd9_A145 UPF0310 protein PH1033; structural genomics, NPPSFA, na 97.86
>3eop_A Thymocyte nuclear protein 1; protein of unknown function, alternative splicing, nucleus, phosphoprotein; 2.30A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=0  Score=433.18  Aligned_cols=140  Identities=38%  Similarity=0.675  Sum_probs=133.9

Q ss_pred             CCCCEECCCCCC---------CCHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCC-CCCCEEEEEECCCC
Q ss_conf             974500115886---------67789985868887777765899999998538897899994588-87634888860446
Q gi|254781040|r    1 MAYWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GREIVGIFEVITCT   70 (143)
Q Consensus         1 M~yWL~KsEP~~---------~s~~~~~~~~~~~~~WdGVRNyqArn~lr~Mk~GD~~~fYHS~~-~~~ivgi~~v~~~~   70 (143)
                      |+||||||||++         ||||||.++++++++||||||||||||||+||+||+|||||||| .++|||+++|++++
T Consensus         1 M~YWL~KsEP~~~~~~g~~~~fSiddl~~~~~~~~~WdGVRNyqArn~lR~Mk~GD~~ffYHS~~~~~~IvGi~~V~~~a   80 (176)
T 3eop_A            1 MSHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEA   80 (176)
T ss_dssp             -CEEEEEEBSSCCBSSSSBCBCCSHHHHTSGGGEEECCCCCCHHHHHHHHHCCTTCEEEEEECCSSSCEEEEEEEEEEEE
T ss_pred             CCEEEEEECCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCCCCCCEEEEEEEEEEE
T ss_conf             96244632788765567656374999986458888667704499999998655788899985278998289999998841


Q ss_pred             CCCCCC-------------CCCCCEEEEECHHHCCCCCCCCHHHHHCCCC--------CCCCCCCCCCCCCEEECCHHHH
Q ss_conf             667764-------------4567227985032210799758889840820--------1146010057455011689999
Q gi|254781040|r   71 YPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANPR--------LSSMILIVSSRLSVQPVTTDEY  129 (143)
Q Consensus        71 y~d~t~-------------~~~p~W~~VdVk~~~~l~~pVsL~~lK~~~~--------L~~m~Llk~~RLSV~PVt~~ew  129 (143)
                      |||+|+             +++|+|+||||+|+++|++||||++||+++.        |++|.|+||+||||||||++||
T Consensus        81 yPD~Tafd~~s~Y~Dpkst~~~prW~~VdV~~v~~f~~~VtL~~LK~~~~~~~~~~~~L~~m~Lvr~sRLSV~PVt~~ew  160 (176)
T 3eop_A           81 YPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEF  160 (176)
T ss_dssp             EECGGGTCTTSTTCCTTCCTTSCSCEEEEEEEEEEEEEEEEHHHHHHHHHHHHHHTCTTSSCHHHHCTTCSEEEECHHHH
T ss_pred             ECCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEECCCCCCHHHHHHCHHHCCCCCCCCCCCEEEECCCCCEEECCHHHH
T ss_conf             32785425677654866656799768999998253488538999972810123456640268252158552675699999


Q ss_pred             HHHHHHCCCCC
Q ss_conf             99999727999
Q gi|254781040|r  130 LEVCRMGKLSN  140 (143)
Q Consensus       130 ~~I~~L~~~~~  140 (143)
                      ++||+||++..
T Consensus       161 ~~I~~La~~~~  171 (176)
T 3eop_A          161 DFVLSLEELEH  171 (176)
T ss_dssp             HHHHHGGGCC-
T ss_pred             HHHHHHHCCCC
T ss_conf             99999877744



>1zce_A Hypothetical protein ATU2648; alpha-beta protein., structural genomics, PSI, protein structure initiative; 1.30A {Agrobacterium tumefaciens str} SCOP: b.122.1.8 Back     alignment and structure
>2gbs_A Hypothetical protein RPA0253; alpha-beta, RPR3, NESG, structural genomics, COG294 protein structure initiative; NMR {Rhodopseudomonas palustris CGA009} SCOP: b.122.1.8 Back     alignment and structure
>2ar1_A Hypothetical protein; structural genomics, PSI, protein structure initiative, structural genomics of pathogenic protozoa consortium; 1.60A {Leishmania major} SCOP: b.122.1.8 Back     alignment and structure
>2eve_A Hypothetical protein pspto5229; alpha-beta protein, structural genomics, PSI, protein struct initiative; HET: MPO; 1.60A {Pseudomonas syringae PV} SCOP: b.122.1.8 PDB: 2g2x_A Back     alignment and structure
>2p5d_A UPF0310 protein mjecl36; NPPSFA, national project on protein structural and functional analyses; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>2hd9_A UPF0310 protein PH1033; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: CIT; 1.35A {Pyrococcus horikoshii OT3} SCOP: b.122.1.8 PDB: 1wmm_A* 2zbn_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 143 hypothetical protein CLIBASIA_04710 [Candidatus Liberib
d1zcea1146 b.122.1.8 (A:2-147) Hypothetical protein Atu2648 {Agrob 1e-49
d2gbsa1136 b.122.1.8 (A:2-137) Hypothetical protein RPA0253 {Rhodo 4e-45
d2ar1a1157 b.122.1.8 (A:7-163) Hypothetical protein LmjF36.6870 {L 3e-39
d2evea1148 b.122.1.8 (A:2-149) Hypothetical protein PSPTO5229 {Pse 2e-38
>d1zcea1 b.122.1.8 (A:2-147) Hypothetical protein Atu2648 {Agrobacterium tumefaciens [TaxId: 358]} Length = 146 Back     information, alignment and structure

class: All beta proteins
fold: PUA domain-like
superfamily: PUA domain-like
family: Atu2648/PH1033-like
domain: Hypothetical protein Atu2648
species: Agrobacterium tumefaciens [TaxId: 358]
 Score =  188 bits (479), Expect = 1e-49
 Identities = 95/140 (67%), Positives = 111/140 (79%)

Query: 3   YWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVG 62
           YWL KSEP +WSW+MQ+ KG  GE WTGVRNYQARNNMR M++GDKGFFYHSN+G ++VG
Sbjct: 3   YWLYKSEPFKWSWEMQKAKGETGEEWTGVRNYQARNNMRAMKIGDKGFFYHSNEGLDVVG 62

Query: 63  IFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQ 122
           I EV   ++PD TAE    W+CVDI AVC MP PVSL  +KANP+L  M L+ S RLSVQ
Sbjct: 63  IVEVCALSHPDSTAEGDLKWDCVDIRAVCDMPQPVSLKDVKANPKLEKMSLVTSMRLSVQ 122

Query: 123 PVTTDEYLEVCRMGKLSNPP 142
           PVT +EYLEVCRMG L+NPP
Sbjct: 123 PVTEEEYLEVCRMGGLANPP 142


>d2gbsa1 b.122.1.8 (A:2-137) Hypothetical protein RPA0253 {Rhodopseudomonas palustris [TaxId: 1076]} Length = 136 Back     information, alignment and structure
>d2ar1a1 b.122.1.8 (A:7-163) Hypothetical protein LmjF36.6870 {Leishmania major [TaxId: 5664]} Length = 157 Back     information, alignment and structure
>d2evea1 b.122.1.8 (A:2-149) Hypothetical protein PSPTO5229 {Pseudomonas syringae [TaxId: 317]} Length = 148 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target143 hypothetical protein CLIBASIA_04710 [Candidatus Liberib
d1zcea1146 Hypothetical protein Atu2648 {Agrobacterium tumefaciens 100.0
d2gbsa1136 Hypothetical protein RPA0253 {Rhodopseudomonas palustri 100.0
d2evea1148 Hypothetical protein PSPTO5229 {Pseudomonas syringae [T 100.0
d2ar1a1157 Hypothetical protein LmjF36.6870 {Leishmania major [Tax 100.0
d2hd9a1145 Hypothetical protein PH1033 {Pyrococcus horikoshii [Tax 97.66
>d1zcea1 b.122.1.8 (A:2-147) Hypothetical protein Atu2648 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
class: All beta proteins
fold: PUA domain-like
superfamily: PUA domain-like
family: Atu2648/PH1033-like
domain: Hypothetical protein Atu2648
species: Agrobacterium tumefaciens [TaxId: 358]
Probab=100.00  E-value=0  Score=434.01  Aligned_cols=141  Identities=67%  Similarity=1.190  Sum_probs=139.0

Q ss_pred             CCCEECCCCCCCCHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCCCCCCEEEEEECCCCCCCCCCCCCCC
Q ss_conf             74500115886677899858688877777658999999985388978999945888763488886044666776445672
Q gi|254781040|r    2 AYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREIVGIFEVITCTYPDPTAEQSSC   81 (143)
Q Consensus         2 ~yWL~KsEP~~~s~~~~~~~~~~~~~WdGVRNyqArn~lr~Mk~GD~~~fYHS~~~~~ivgi~~v~~~~y~d~t~~~~p~   81 (143)
                      +||||||||++|||+|++.+++++++||||||||||||||+||+||+||||||||+++|||+++|++++|+|+|++++|+
T Consensus         2 nYWL~KsEP~~~s~~dl~~~~~~~~~WdGVRNyqArn~lr~Mk~GD~~ffYHS~~~~~ivg~~~v~~~~y~d~t~~~~pr   81 (146)
T d1zcea1           2 NYWLYKSEPFKWSWEMQKAKGETGEEWTGVRNYQARNNMRAMKIGDKGFFYHSNEGLDVVGIVEVCALSHPDSTAEGDLK   81 (146)
T ss_dssp             CEEEEEECTTTSCHHHHHHHGGGCEECCCCCCHHHHHHHHTCCTTCEEEEEETTTTCEEEEEEEEEEEEEECTTSTTCSS
T ss_pred             CEEEEECCCCCCCHHHHHHCCCCCCCCCCCCHHHHHHHHHHCCCCCEEEEEECCCCCCCEEEEEECCCCCCCCCCCCCCC
T ss_conf             64078428987899999865888886567250999999996537888999951899882689951245578867577987


Q ss_pred             EEEEECHHHCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCEEECCHHHHHHHHHHCCCCCCC
Q ss_conf             2798503221079975888984082011460100574550116899999999972799989
Q gi|254781040|r   82 WECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLSVQPVTTDEYLEVCRMGKLSNPP  142 (143)
Q Consensus        82 W~~VdVk~~~~l~~pVsL~~lK~~~~L~~m~Llk~~RLSV~PVt~~ew~~I~~L~~~~~p~  142 (143)
                      |+||||+|+++|+++|+|++||+++.|++|.|+||+||||||||++||++||+|||+++|+
T Consensus        82 W~~VdV~~v~~~~~~VsL~eLK~~~~L~~m~Lvk~~RLSV~PVt~~ew~~I~~Lag~~~p~  142 (146)
T d1zcea1          82 WDCVDIRAVCDMPQPVSLKDVKANPKLEKMSLVTSMRLSVQPVTEEEYLEVCRMGGLANPP  142 (146)
T ss_dssp             CEEEEEEEEEEEEEEEEHHHHHHCGGGTTCHHHHCSSCSEEEECHHHHHHHHHHTTCSSCC
T ss_pred             EEEEEEEEECCCCCEEEHHHHHCCCCHHHCCCHHCCCCCEEECCHHHHHHHHHHCCCCCCC
T ss_conf             5899888602369612299962676652196611382374966999999999962999998



>d2gbsa1 b.122.1.8 (A:2-137) Hypothetical protein RPA0253 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2evea1 b.122.1.8 (A:2-149) Hypothetical protein PSPTO5229 {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2ar1a1 b.122.1.8 (A:7-163) Hypothetical protein LmjF36.6870 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2hd9a1 b.122.1.8 (A:1-145) Hypothetical protein PH1033 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 143 hypothetical protein CLIBASIA_04710 [Candidatus Li
1zce_A_155 (A:) Hypothetical protein ATU2648; alpha-beta prot 7e-50
2gbs_A_145 (A:) Hypothetical protein RPA0253; alpha-beta, RPR 1e-49
3eop_A_176 (A:) Thymocyte nuclear protein 1; protein of unkno 8e-46
2ar1_A_172 (A:) Hypothetical protein; structural genomics, PS 3e-45
2eve_A_157 (A:) Hypothetical protein pspto5229; alpha-beta pr 2e-42
2p5d_A_147 (A:) UPF0310 protein mjecl36; NPPSFA, national pro 3e-25
>1zce_A (A:) Hypothetical protein ATU2648; alpha-beta protein., structural genomics, PSI, protein structure initiative; 1.30A {Agrobacterium tumefaciens str}Length = 155 Back     alignment and structure
 Score =  190 bits (484), Expect = 7e-50
 Identities = 89/142 (62%), Positives = 105/142 (73%)

Query: 1   MAYWLVKSEPSEWSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNKGREI 60
             YWL KSEP +WSW+ Q+ KG  GE WTGVRNYQARNN R  ++GDKGFFYHSN+G ++
Sbjct: 2   ANYWLYKSEPFKWSWEXQKAKGETGEEWTGVRNYQARNNXRAXKIGDKGFFYHSNEGLDV 61

Query: 61  VGIFEVITCTYPDPTAEQSSCWECVDICAVCSMPCPVSLMAIKANPRLSSMILIVSSRLS 120
           VGI EV   ++PD TAE    W+CVDI AVC  P PVSL  +KANP+L    L+ S RLS
Sbjct: 62  VGIVEVCALSHPDSTAEGDLKWDCVDIRAVCDXPQPVSLKDVKANPKLEKXSLVTSXRLS 121

Query: 121 VQPVTTDEYLEVCRMGKLSNPP 142
           VQPVT +EYLEVCR G L+NPP
Sbjct: 122 VQPVTEEEYLEVCRXGGLANPP 143


>2gbs_A (A:) Hypothetical protein RPA0253; alpha-beta, RPR3, NESG, structural genomics, COG2947, PSI, protein structure initiative; NMR {Rhodopseudomonas palustris CGA009}Length = 145 Back     alignment and structure
>3eop_A (A:) Thymocyte nuclear protein 1; protein of unknown function, alternative splicing, nucleus, phosphoprotein; 2.30A {Homo sapiens}Length = 176 Back     alignment and structure
>2ar1_A (A:) Hypothetical protein; structural genomics, PSI, protein structure initiative, structural genomics of pathogenic protozoa consortium; 1.60A {Leishmania major}Length = 172 Back     alignment and structure
>2eve_A (A:) Hypothetical protein pspto5229; alpha-beta protein, structural genomics, PSI, protein structure initiative; HET: MPO; 1.60A {Pseudomonas syringae PV}Length = 157 Back     alignment and structure
>2p5d_A (A:) UPF0310 protein mjecl36; NPPSFA, national project on protein structural and functional analyses; 1.70A {Methanocaldococcus jannaschii}Length = 147 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target143 hypothetical protein CLIBASIA_04710 [Candidatus Liberib
3eop_A_176 Thymocyte nuclear protein 1; protein of unknown fu 100.0
1zce_A_155 Hypothetical protein ATU2648; alpha-beta protein., 100.0
2ar1_A_172 Hypothetical protein; structural genomics, PSI, pr 100.0
2gbs_A_145 Hypothetical protein RPA0253; alpha-beta, RPR3, NE 100.0
2eve_A_157 Hypothetical protein pspto5229; alpha-beta protein 100.0
2p5d_A_147 UPF0310 protein mjecl36; NPPSFA, national project 100.0
2hd9_A_145 UPF0310 protein PH1033; structural genomics, NPPSF 97.89
>3eop_A (A:) Thymocyte nuclear protein 1; protein of unknown function, alternative splicing, nucleus, phosphoprotein; 2.30A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=0  Score=424.59  Aligned_cols=142  Identities=37%  Similarity=0.655  Sum_probs=135.0

Q ss_pred             CCCCEECCCCCC---------CCHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCC-CCCCEEEEEECCCC
Q ss_conf             974500115886---------67789985868887777765899999998538897899994588-87634888860446
Q gi|254781040|r    1 MAYWLVKSEPSE---------WSWKMQQDKGRVGEAWTGVRNYQARNNMRKMRVGDKGFFYHSNK-GREIVGIFEVITCT   70 (143)
Q Consensus         1 M~yWL~KsEP~~---------~s~~~~~~~~~~~~~WdGVRNyqArn~lr~Mk~GD~~~fYHS~~-~~~ivgi~~v~~~~   70 (143)
                      |+||||||||++         ||||||.++++++++||||||||||||||+||+||+|||||||| +|+||||++|++++
T Consensus         1 M~YWL~KsEP~~r~~~g~d~~fSidDl~~~~~~~~~WdGVRNyqArn~lR~Mk~GD~~ffYHS~~~~pgIvGiaeV~~~~   80 (176)
T 3eop_A            1 MSHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEA   80 (176)
T ss_dssp             -CEEEEEEBSSCCBSSSSBCBCCSHHHHTSGGGEEECCCCCCHHHHHHHHHCCTTCEEEEEECCSSSCEEEEEEEEEEEE
T ss_pred             CCEEEEEECCCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCHHHHHHHHHCCCCCEEEEEECCCCCCEEEEEEEEEEEC
T ss_conf             96022522788765567656365999986568898778815399999998654678899985378886368999999714


Q ss_pred             CCCCCC-------------CCCCCEEEEECHHHCCCCCCCCHHHHHCCC--------CCCCCCCCCCCCCCEEECCHHHH
Q ss_conf             667764-------------456722798503221079975888984082--------01146010057455011689999
Q gi|254781040|r   71 YPDPTA-------------EQSSCWECVDICAVCSMPCPVSLMAIKANP--------RLSSMILIVSSRLSVQPVTTDEY  129 (143)
Q Consensus        71 y~d~t~-------------~~~p~W~~VdVk~~~~l~~pVsL~~lK~~~--------~L~~m~Llk~~RLSV~PVt~~ew  129 (143)
                      |||+|+             +++|+|+||||+|+++|++||+|++||+++        +|++|.|+||+||||+|||++||
T Consensus        81 ypD~ta~dp~s~YyD~ks~~e~prW~~VdV~~~~k~~~pv~L~~lK~~~~~~~~~~~aL~~m~L~r~~RLSV~PVt~~ew  160 (176)
T 3eop_A           81 YPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEF  160 (176)
T ss_dssp             EECGGGTCTTSTTCCTTCCTTSCSCEEEEEEEEEEEEEEEEHHHHHHHHHHHHHHTCTTSSCHHHHCTTCSEEEECHHHH
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEECCCEECHHHHHHCHHHCCCCCCCCCCCEEEECCCCCEEECCHHHH
T ss_conf             55785546666645876656699779999998043487043999863721113456630158142058552564699999


Q ss_pred             HHHHHHCCCCCCC
Q ss_conf             9999972799989
Q gi|254781040|r  130 LEVCRMGKLSNPP  142 (143)
Q Consensus       130 ~~I~~L~~~~~p~  142 (143)
                      ++||+|+++.+..
T Consensus       161 ~~I~~l~~~~~~~  173 (176)
T 3eop_A          161 DFVLSLEELEHHH  173 (176)
T ss_dssp             HHHHHGGGCC---
T ss_pred             HHHHHHHCCCCCC
T ss_conf             9999987774434



>1zce_A (A:) Hypothetical protein ATU2648; alpha-beta protein., structural genomics, PSI, protein structure initiative; 1.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ar1_A (A:) Hypothetical protein; structural genomics, PSI, protein structure initiative, structural genomics of pathogenic protozoa consortium; 1.60A {Leishmania major} Back     alignment and structure
>2gbs_A (A:) Hypothetical protein RPA0253; alpha-beta, RPR3, NESG, structural genomics, COG2947, PSI, protein structure initiative; NMR {Rhodopseudomonas palustris CGA009} Back     alignment and structure
>2eve_A (A:) Hypothetical protein pspto5229; alpha-beta protein, structural genomics, PSI, protein structure initiative; HET: MPO; 1.60A {Pseudomonas syringae PV} Back     alignment and structure
>2p5d_A (A:) UPF0310 protein mjecl36; NPPSFA, national project on protein structural and functional analyses; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>2hd9_A (A:) UPF0310 protein PH1033; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: CIT; 1.35A {Pyrococcus horikoshii OT3} Back     alignment and structure