254781041

254781041

succinate dehydrogenase protein, cytochrome b subunit

GeneID in NCBI database:8210064Locus tag:CLIBASIA_04715
Protein GI in NCBI database:254781041Protein Accession:YP_003065454.1
Gene range:+(1044072, 1044461)Protein Length:129aa
Gene description:succinate dehydrogenase protein, cytochrome b subunit
COG prediction:[C] Succinate dehydrogenase/fumarate reductase, cytochrome b subunit
KEGG prediction:sdhC; succinate dehydrogenase protein, cytochrome b subunit; K00241 succinate dehydrogenase cytochrome b-556 subunit [EC:1.3.99.1]
SEED prediction:Succinate dehydrogenase cytochrome b-556 subunit
Pathway involved in KEGG:Citrate cycle (TCA cycle) [PATH:las00020]
Butanoate metabolism [PATH:las00650]
Oxidative phosphorylation [PATH:las00190]
Toluene degradation
Subsystem involved in SEED:Succinate dehydrogenase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM3 TM-Helix
TOPPRED3 TM-Helix
HMMTOP3 TM-Helix
MEMSAT3 TM-Helix
MEMSAT_SVM3 TM-Helix
PHOBIUS3 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKDIV
cccHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
ccccccccccccccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccHEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
mssiknnrplsphlqiyrlIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKDIV
mssiknnrplsphLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKDIV
MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKDIV
******N***SPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKDIV
MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKDIV
*******RPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKDIV
oooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooo
iiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKDIV
MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKDIV
MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIVWIIKDIV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target129 succinate dehydrogenase protein, cytochrome b subunit [
315122380129 succinate dehydrogenase protein, cytochrome b subunit [ 1 1e-44
90421134130 succinate dehydrogenase, cytochrome b subunit [Aurantim 1 4e-29
86359478131 succinate dehydrogenase cytochrome B-556 subunit protei 1 5e-29
327188889146 succinate dehydrogenase cytochrome B-556 subunit protei 1 6e-29
222087469133 succinate dehydrogenase, cytochrome b556 subunit [Agrob 1 1e-27
227823652130 putative succinate dehydrogenase membrane anchor subuni 1 1e-27
325294014130 succinate dehydrogenase cytochrome B-556 subunit [Agrob 1 2e-27
159185307130 succinate dehydrogenase cytochrome B-556 subunit [Agrob 1 2e-27
209551264131 succinate dehydrogenase, cytochrome b556 subunit [Rhizo 1 2e-27
116254178131 succinate dehydrogenase cytochrome b556 subunit [Rhizob 1 2e-27
>gi|315122380|ref|YP_004062869.1| succinate dehydrogenase protein, cytochrome b subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 129 Back     alignment and organism information
 Score =  182 bits (462), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 83/128 (64%), Positives = 101/128 (78%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           MS +K+NRPLSPHLQIY+LIPTM +SIVHRITGS VY GTP +V WFF +A G++TL   
Sbjct: 1   MSDLKSNRPLSPHLQIYKLIPTMLISIVHRITGSAVYFGTPALVLWFFAVAEGKYTLGLW 60

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVL 120
           R Y D   F + LFLYTW+ IHHMLGGIRYL+WD S  L+KK++  MAKINIIASI  V 
Sbjct: 61  RSYTDCGFFSIFLFLYTWSAIHHMLGGIRYLMWDSSFLLEKKVSITMAKINIIASIFIVS 120

Query: 121 IVWIIKDI 128
           ++WI+K+I
Sbjct: 121 VIWIVKNI 128


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|90421134|ref|ZP_01229036.1| succinate dehydrogenase, cytochrome b subunit [Aurantimonas manganoxydans SI85-9A1] Length = 130 Back     alignment and organism information
>gi|86359478|ref|YP_471370.1| succinate dehydrogenase cytochrome B-556 subunit protein [Rhizobium etli CFN 42] Length = 131 Back     alignment and organism information
>gi|327188889|gb|EGE56081.1| succinate dehydrogenase cytochrome B-556 subunit protein [Rhizobium etli CNPAF512] Length = 146 Back     alignment and organism information
>gi|222087469|ref|YP_002546006.1| succinate dehydrogenase, cytochrome b556 subunit [Agrobacterium radiobacter K84] Length = 133 Back     alignment and organism information
>gi|227823652|ref|YP_002827625.1| putative succinate dehydrogenase membrane anchor subunit [Sinorhizobium fredii NGR234] Length = 130 Back     alignment and organism information
>gi|325294014|ref|YP_004279878.1| succinate dehydrogenase cytochrome B-556 subunit [Agrobacterium sp. H13-3] Length = 130 Back     alignment and organism information
>gi|159185307|ref|NP_355582.2| succinate dehydrogenase cytochrome B-556 subunit [Agrobacterium tumefaciens str. C58] Length = 130 Back     alignment and organism information
>gi|209551264|ref|YP_002283181.1| succinate dehydrogenase, cytochrome b556 subunit [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 131 Back     alignment and organism information
>gi|116254178|ref|YP_770016.1| succinate dehydrogenase cytochrome b556 subunit [Rhizobium leguminosarum bv. viciae 3841] Length = 131 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target129 succinate dehydrogenase protein, cytochrome b subunit [
TIGR02970120 TIGR02970, succ_dehyd_cytB, succinate dehydrogenase, cy 4e-26
pfam01127122 pfam01127, Sdh_cyt, Succinate dehydrogenase/Fumarate re 3e-13
COG2009132 COG2009, SdhC, Succinate dehydrogenase/fumarate reducta 1e-10
cd0349398 cd03493, SQR_QFR_TM, Succinate:quinone oxidoreductase ( 6e-05
PRK09487129 PRK09487, sdhC, succinate dehydrogenase cytochrome b556 0.004
cd03499117 cd03499, SQR_TypeC_SdhC, Succinate:quinone oxidoreducta 2e-21
KOG0449168 KOG0449, KOG0449, KOG0449, Succinate dehydrogenase, cyt 8e-10
PLN00127178 PLN00127, PLN00127, succinate dehydrogenase (ubiquinone 2e-06
>gnl|CDD|163092 TIGR02970, succ_dehyd_cytB, succinate dehydrogenase, cytochrome b556 subunit Back     alignment and domain information
>gnl|CDD|144645 pfam01127, Sdh_cyt, Succinate dehydrogenase/Fumarate reductase transmembrane subunit Back     alignment and domain information
>gnl|CDD|32192 COG2009, SdhC, Succinate dehydrogenase/fumarate reductase, cytochrome b subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|48054 cd03493, SQR_QFR_TM, Succinate:quinone oxidoreductase (SQR) and Quinol:fumarate reductase (QFR) family, transmembrane subunits; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol, while QFR catalyzes the reverse reaction Back     alignment and domain information
>gnl|CDD|181900 PRK09487, sdhC, succinate dehydrogenase cytochrome b556 large membrane subunit; Provisional Back     alignment and domain information
>gnl|CDD|48060 cd03499, SQR_TypeC_SdhC, Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase C (SdhC) subunit; composed of bacterial SdhC and eukaryotic large cytochrome b binding (CybL) proteins Back     alignment and domain information
>gnl|CDD|35670 KOG0449, KOG0449, KOG0449, Succinate dehydrogenase, cytochrome b subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|177738 PLN00127, PLN00127, succinate dehydrogenase (ubiquinone) cytochrome b subunit; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 129 succinate dehydrogenase protein, cytochrome b subunit [
TIGR02970123 succ_dehyd_cytB succinate dehydrogenase, cytochrome b55 100.0
PRK09487129 sdhC succinate dehydrogenase cytochrome b556 large memb 100.0
cd03499117 SQR_TypeC_SdhC Succinate:quinone oxidoreductase (SQR) T 100.0
KOG0449168 consensus 100.0
pfam01127122 Sdh_cyt Succinate dehydrogenase/Fumarate reductase tran 100.0
COG2009132 SdhC Succinate dehydrogenase/fumarate reductase, cytoch 99.95
cd03501101 SQR_TypeA_SdhC_like Succinate:quinone oxidoreductase (S 99.79
cd0349398 SQR_QFR_TM Succinate:quinone oxidoreductase (SQR) and Q 99.7
cd03500106 SQR_TypeA_SdhD_like Succinate:quinone oxidoreductase (S 99.04
COG2142117 SdhD Succinate dehydrogenase, hydrophobic anchor subuni 98.52
TIGR02968105 succ_dehyd_anc succinate dehydrogenase, hydrophobic mem 98.23
cd03497207 SQR_TypeB_1_TM Succinate:quinone oxidoreductase (SQR) T 98.17
cd03498209 SQR_TypeB_2_TM Succinate:quinone oxidoreductase (SQR)-l 97.87
cd03495100 SQR_TypeC_SdhD_like Succinate:quinone oxidoreductase (S 97.66
cd03526199 SQR_QFR_TypeB_TM Succinate:quinone oxidoreductase (SQR) 97.57
cd03498209 SQR_TypeB_2_TM Succinate:quinone oxidoreductase (SQR)-l 96.96
TIGR02046233 sdhC_b558_fam succinate dehydrogenase (or fumarate redu 94.26
cd00546124 QFR_TypeD_subunitC Quinol:fumarate reductase (QFR) Type 93.03
cd0349499 SQR_TypeC_SdhD Succinate:quinone oxidoreductase (SQR) T 97.76
PRK09488115 sdhD succinate dehydrogenase cytochrome b556 small memb 97.74
cd03526199 SQR_QFR_TypeB_TM Succinate:quinone oxidoreductase (SQR) 95.39
cd03497207 SQR_TypeB_1_TM Succinate:quinone oxidoreductase (SQR) T 95.24
cd00581206 QFR_TypeB_TM Quinol:fumarate reductase (QFR) Type B sub 94.7
PRK13554 241 fumarate reductase cytochrome b-556 subunit; Provisiona 93.13
>TIGR02970 succ_dehyd_cytB succinate dehydrogenase, cytochrome b556 subunit; InterPro: IPR014314 In E Back     alignment and domain information
>PRK09487 sdhC succinate dehydrogenase cytochrome b556 large membrane subunit; Provisional Back     alignment and domain information
>cd03499 SQR_TypeC_SdhC Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase C (SdhC) subunit; composed of bacterial SdhC and eukaryotic large cytochrome b binding (CybL) proteins Back     alignment and domain information
>KOG0449 consensus Back     alignment and domain information
>pfam01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit Back     alignment and domain information
>COG2009 SdhC Succinate dehydrogenase/fumarate reductase, cytochrome b subunit [Energy production and conversion] Back     alignment and domain information
>cd03501 SQR_TypeA_SdhC_like Succinate:quinone oxidoreductase (SQR) Type A subfamily, Succinate dehydrogenase C (SdhC)-like subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol Back     alignment and domain information
>cd03493 SQR_QFR_TM Succinate:quinone oxidoreductase (SQR) and Quinol:fumarate reductase (QFR) family, transmembrane subunits; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol, while QFR catalyzes the reverse reaction Back     alignment and domain information
>cd03500 SQR_TypeA_SdhD_like Succinate:quinone oxidoreductase (SQR) Type A subfamily, Succinate dehydrogenase D (SdhD)-like subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol Back     alignment and domain information
>COG2142 SdhD Succinate dehydrogenase, hydrophobic anchor subunit [Energy production and conversion] Back     alignment and domain information
>TIGR02968 succ_dehyd_anc succinate dehydrogenase, hydrophobic membrane anchor protein; InterPro: IPR014312 In Escherichia coli and many other bacteria, two small, hydrophobic, mutually homologous subunits of succinate dehydrogenase (a TCA cycle enzyme) are SdhC and SdhD Back     alignment and domain information
>cd03497 SQR_TypeB_1_TM Succinate:quinone oxidoreductase (SQR) Type B subfamily 1, transmembrane subunit; composed of proteins similar to Bacillus subtilis SQR Back     alignment and domain information
>cd03498 SQR_TypeB_2_TM Succinate:quinone oxidoreductase (SQR)-like Type B subfamily 2, transmembrane subunit; composed of proteins with similarity to the SQRs of Geobacter metallireducens and Corynebacterium glutamicum Back     alignment and domain information
>cd03495 SQR_TypeC_SdhD_like Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase D (SdhD) subunit-like; composed of predominantly uncharacterized bacterial proteins with similarity to the E Back     alignment and domain information
>cd03526 SQR_QFR_TypeB_TM Succinate:quinone oxidoreductase (SQR) and Quinol:fumarate reductase (QFR) Type B subfamily, transmembrane subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol, while QFR catalyzes the reverse reaction Back     alignment and domain information
>cd03498 SQR_TypeB_2_TM Succinate:quinone oxidoreductase (SQR)-like Type B subfamily 2, transmembrane subunit; composed of proteins with similarity to the SQRs of Geobacter metallireducens and Corynebacterium glutamicum Back     alignment and domain information
>TIGR02046 sdhC_b558_fam succinate dehydrogenase (or fumarate reductase) cytochrome b subunit, b558 family; InterPro: IPR011138 This family contains succinate dehydrogenase subunit C of Bacillus subtilis, designated cytochrome b-558, and related sequences that include a fumarate reductase subunit C Back     alignment and domain information
>cd00546 QFR_TypeD_subunitC Quinol:fumarate reductase (QFR) Type D subfamily, 15kD hydrophobic subunit C; QFR couples the reduction of fumarate to succinate to the oxidation of quinol to quinone, the opposite reaction to that catalyzed by the related protein, succinate:quinine oxidoreductase (SQR) Back     alignment and domain information
>cd03494 SQR_TypeC_SdhD Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase D (SdhD) subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol Back     alignment and domain information
>PRK09488 sdhD succinate dehydrogenase cytochrome b556 small membrane subunit; Provisional Back     alignment and domain information
>cd03526 SQR_QFR_TypeB_TM Succinate:quinone oxidoreductase (SQR) and Quinol:fumarate reductase (QFR) Type B subfamily, transmembrane subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol, while QFR catalyzes the reverse reaction Back     alignment and domain information
>cd03497 SQR_TypeB_1_TM Succinate:quinone oxidoreductase (SQR) Type B subfamily 1, transmembrane subunit; composed of proteins similar to Bacillus subtilis SQR Back     alignment and domain information
>cd00581 QFR_TypeB_TM Quinol:fumarate reductase (QFR) Type B subfamily, transmembrane subunit; QFR couples the reduction of fumarate to succinate to the oxidation of quinol to quinone, the opposite reaction to that catalyzed by the related protein, succinate:quinone oxidoreductase (SQR) Back     alignment and domain information
>PRK13554 fumarate reductase cytochrome b-556 subunit; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target129 succinate dehydrogenase protein, cytochrome b subunit [
1zoy_C140 Crystal Structure Of Mitochondrial Respiratory Comp 9e-20
2h88_C140 Avian Mitochondrial Respiratory Complex Ii At 1.8 A 1e-19
1yq3_C141 Avian Respiratory Complex Ii With Oxaloacetate And 3e-19
2fbw_C141 Avian Respiratory Complex Ii With Carboxin Bound Le 3e-19
1nek_C129 Complex Ii (Succinate Dehydrogenase) From E. Coli W 9e-17
2wu2_C129 Crystal Structure Of The E. Coli Succinate:quinone 2e-15
>gi|73535958|pdb|1ZOY|C Chain C, Crystal Structure Of Mitochondrial Respiratory Complex Ii From Porcine Heart At 2.4 Angstroms Length = 140 Back     alignment and structure
 Score =  100 bits (248), Expect = 9e-20,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 56/123 (45%), Gaps = 2/123 (1%)

Query: 2   SSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVF--WFFCIANGEHTLSS 59
            ++ +NRPLSPH+ IYR    M +SI HR TG  +  G  +              H    
Sbjct: 15  KNLGSNRPLSPHITIYRWSLPMAMSICHRGTGIALSAGVSLFGLSALLLPGNFESHLELV 74

Query: 60  LRCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTV 119
               +  ++     F   + +++H   GIR+LIWD+   L     TQ   + +I ++L+ 
Sbjct: 75  KSLCLGPTLIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQSGVVVLILTVLSS 134

Query: 120 LIV 122
           + +
Sbjct: 135 VGL 137


>gi|110590576|pdb|2H88|C Chain C, Avian Mitochondrial Respiratory Complex Ii At 1.8 Angstrom Resolution Length = 140 Back     alignment and structure
>gi|85544002|pdb|1YQ3|C Chain C, Avian Respiratory Complex Ii With Oxaloacetate And Ubiquinone Length = 141 Back     alignment and structure
>gi|85544667|pdb|2FBW|C Chain C, Avian Respiratory Complex Ii With Carboxin Bound Length = 141 Back     alignment and structure
gi|28948820|pdb|1NEK|C Chain C, Complex Ii (Succinate Dehydrogenase) From E. Coli With Ubiquinone Bound Length = 129 Back     alignment and structure
>gi|304445630|pdb|2WU2|C Chain C, Crystal Structure Of The E. Coli Succinate:quinone Oxidoreductase (Sqr) Sdhc His84met Mutant Length = 129 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target129 succinate dehydrogenase protein, cytochrome b subunit [
2h88_C140 Succinate dehydrogenase cytochrome B, large subunit; co 1e-21
1zoy_C140 Large cytochrome binding protein, FAD-binding protein; 2e-21
2wdq_C129 Succinate dehydrogenase cytochrome B556 subunit; succin 4e-18
>2h88_C Succinate dehydrogenase cytochrome B, large subunit; complex II, membrane protein, heme protein, iron sulfur protein, oxidoreductase, redox enzyme; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 2h89_C* 1yq3_C* 1yq4_C* 2fbw_C* Length = 140 Back     alignment and structure
 Score = 96.9 bits (241), Expect = 1e-21
 Identities = 29/121 (23%), Positives = 53/121 (43%), Gaps = 2/121 (1%)

Query: 5   KNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSS--LRC 62
           K++RPLSPH+ IY+    M +SI HR TG  + LG  +       +        +     
Sbjct: 18  KSSRPLSPHISIYKWSLPMAMSITHRGTGVALSLGVSLFSLAALLLPEQFPHYVAVVKSL 77

Query: 63  YMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLDKKIATQMAKINIIASILTVLIV 122
            +  ++     F   + + +H   GIR+L+WD+          Q   + +I ++L+   +
Sbjct: 78  SLSPALIYSAKFALVFPLSYHTWNGIRHLVWDMGKGFKLSQVEQSGVVVLILTLLSSAAI 137

Query: 123 W 123
            
Sbjct: 138 A 138


>1zoy_C Large cytochrome binding protein, FAD-binding protein; succinate, ubiquinone oxidoreductase, mitochondrial respiratory complex II; HET: FAD HEM EPH UQ1; 2.40A {Sus scrofa} PDB: 1zp0_C* Length = 140 Back     alignment and structure
>2wdq_C Succinate dehydrogenase cytochrome B556 subunit; succinate dehydrogenase activity, cell inner membrane, tricarboxylic acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_C* 2acz_C* 1nek_C* 2wdr_C* 2wdv_C* Length = 129 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target129 succinate dehydrogenase protein, cytochrome b subunit [
2wdq_C129 Succinate dehydrogenase cytochrome B556 subunit; succin 100.0
2h88_C140 Succinate dehydrogenase cytochrome B, large subunit; co 100.0
1zoy_C140 Large cytochrome binding protein, FAD-binding protein; 100.0
1kf6_D119 Fumarate reductase 13 kDa hydrophobic protein; respirat 93.12
1kf6_C130 Fumarate reductase 15 kDa hydrophobic protein; respirat 92.31
2wdq_D115 Succinate dehydrogenase hydrophobic membrane anchor sub 98.55
2bs2_C256 Quinol-fumarate reductase diheme cytochrome B subunit C 97.59
2bs2_C 256 Quinol-fumarate reductase diheme cytochrome B subunit C 95.35
>2wdq_C Succinate dehydrogenase cytochrome B556 subunit; succinate dehydrogenase activity, cell inner membrane, tricarboxylic acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_C* 2acz_C* 1nek_C* 2wdr_C* 2wdv_C* 2wp9_C* 2ws3_C* 2wu5_C* 2wu2_C* Back     alignment and structure
Probab=100.00  E-value=2.8e-45  Score=265.40  Aligned_cols=125  Identities=18%  Similarity=0.341  Sum_probs=119.5

Q ss_pred             CCCCCCCCCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             96200498999773510266659999999999999999999999999998516303554675306831699999999999
Q gi|254781041|r    1 MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAV   80 (129)
Q Consensus         1 m~~m~~~RPlsphL~iyk~~~t~~~SI~HRitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~   80 (129)
                      .+|||+|||+||||||||||+||++||+||+||++++++++++.+++.....+||.|+.++...+++++|++++++++++
T Consensus         2 ~~~~~~~RPlsphL~iyr~~lt~~~SI~HRiSGv~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (129)
T 2wdq_C            2 IRNVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILLWLLGTSLSSPEGFEQASAIMGSFFVKFIMWGILTAL   81 (129)
T ss_dssp             ------CCCBCCCGGGSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHSHHHHHHHHHHHHHH
T ss_pred             CHHCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             11012689999986605736999999999999999999999999999998657668999999984499999999999999


Q ss_pred             HHHHHHHHHHHHHHCCHHCC-HHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999989999985212335-8999999999999999999999999
Q gi|254781041|r   81 IHHMLGGIRYLIWDVSLCLD-KKIATQMAKINIIASILTVLIVWII  125 (129)
Q Consensus        81 ~yH~~nGiRHL~wD~g~g~~-~~~~~~s~~~vl~~sil~~~~~~~i  125 (129)
                      +||++||+|||+||+|+|+| +++++++++++++++++.++..++.
T Consensus        82 ~yH~~nGIRHL~wD~g~~~~~~~~~~~s~~iv~~~s~~~t~~~~~~  127 (129)
T 2wdq_C           82 AYHVVVGIRHMMMDFGYLEETFEAGKRSAKISFVITVVLSLLAGVL  127 (129)
T ss_dssp             HHHHHHHHHHHHHHTTSSCCSHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999985999999802311148999999999999999999999999



>2h88_C Succinate dehydrogenase cytochrome B, large subunit; complex II, membrane protein, heme protein, iron sulfur protein, oxidoreductase, redox enzyme; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 2h89_C* 1yq3_C* 1yq4_C* 2fbw_C* 2wqy_C* Back     alignment and structure
>1zoy_C Large cytochrome binding protein, FAD-binding protein; succinate, ubiquinone oxidoreductase, mitochondrial respiratory complex II; HET: FAD HEM EPH UQ1; 2.40A {Sus scrofa} PDB: 1zp0_C* Back     alignment and structure
>1kf6_D Fumarate reductase 13 kDa hydrophobic protein; respiration, fumarate reductace, succinate dehydrogenase, complex II, quinol, quinone; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: f.21.2.2 PDB: 1kfy_D* 1l0v_D* 2b76_D* 3cir_D* Back     alignment and structure
>1kf6_C Fumarate reductase 15 kDa hydrophobic protein; respiration, fumarate reductace, succinate dehydrogenase, complex II, quinol, quinone; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: f.21.2.2 PDB: 1kfy_C* 1l0v_C* 2b76_C* 3cir_C* Back     alignment and structure
>2wdq_D Succinate dehydrogenase hydrophobic membrane anchor subunit; succinate dehydrogenase activity, cell inner membrane, tricarboxylic acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_D* 2acz_D* 1nek_D* 2wdr_D* 2wdv_D* 2wp9_D* 2wu2_D* 2ws3_D* 2wu5_D* Back     alignment and structure
>2bs2_C Quinol-fumarate reductase diheme cytochrome B subunit C; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: f.21.2.1 PDB: 1qlb_C* 1e7p_C* 2bs3_C* 2bs4_C* Back     alignment and structure
>2bs2_C Quinol-fumarate reductase diheme cytochrome B subunit C; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: f.21.2.1 PDB: 1qlb_C* 1e7p_C* 2bs3_C* 2bs4_C* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 129 succinate dehydrogenase protein, cytochrome b subunit [
d1nekc_129 f.21.2.2 (C:) Succinate dehydrogenase subunit SdhC {Esc 2e-18
>d1nekc_ f.21.2.2 (C:) Succinate dehydrogenase subunit SdhC {Escherichia coli [TaxId: 562]} Length = 129 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Heme-binding four-helical bundle
superfamily: Fumarate reductase respiratory complex transmembrane subunits
family: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD)
domain: Succinate dehydrogenase subunit SdhC
species: Escherichia coli [TaxId: 562]
 Score = 84.6 bits (209), Expect = 2e-18
 Identities = 23/126 (18%), Positives = 60/126 (47%), Gaps = 1/126 (0%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           + ++K  RP++  LQ  R   T   SI+HR++G + ++   ++++      +        
Sbjct: 2   IRNVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILLWLLGTSLSSPEGFEQA 61

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD-KKIATQMAKINIIASILTV 119
              M     +  ++    A+ +H++ GIR+++ D     +  +   + AKI+ + +++  
Sbjct: 62  SAIMGSFFVKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFEAGKRSAKISFVITVVLS 121

Query: 120 LIVWII 125
           L+  ++
Sbjct: 122 LLAGVL 127


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target129 succinate dehydrogenase protein, cytochrome b subunit [
d1nekc_129 Succinate dehydrogenase subunit SdhC {Escherichia coli 100.0
d1kf6c_130 Fumarate reductase subunit FrdC {Escherichia coli [TaxI 92.71
d1kf6d_119 Fumarate reductase subunit FrdD {Escherichia coli [TaxI 92.36
d1nekd_113 Succinate dehydrogenase subunit SdhD {Escherichia coli 98.6
d2bs2c1254 Fumarate reductase respiratory complex cytochrome b sub 97.31
d2bs2c1 254 Fumarate reductase respiratory complex cytochrome b sub 97.13
>d1nekc_ f.21.2.2 (C:) Succinate dehydrogenase subunit SdhC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Heme-binding four-helical bundle
superfamily: Fumarate reductase respiratory complex transmembrane subunits
family: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD)
domain: Succinate dehydrogenase subunit SdhC
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=268.26  Aligned_cols=126  Identities=18%  Similarity=0.333  Sum_probs=121.0

Q ss_pred             CCCCCCCCCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             96200498999773510266659999999999999999999999999998516303554675306831699999999999
Q gi|254781041|r    1 MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAV   80 (129)
Q Consensus         1 m~~m~~~RPlsphL~iyk~~~t~~~SI~HRitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~   80 (129)
                      ++|||+|||+||||||||||+||++||+||+||++++++++++.+++.....+||.|+..+..++++++|++++++++++
T Consensus         2 ~~~~~~~RP~sPhL~iyk~~~t~~~SI~HRisGv~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (129)
T d1nekc_           2 IRNVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILLWLLGTSLSSPEGFEQASAIMGSFFVKFIMWGILTAL   81 (129)
T ss_dssp             CTTCCCCCCBCCCGGGSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHTTSHHHHHHHHHHHHHH
T ss_pred             CHHCCCCCCCCCCCCEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             11013699999985615732999999999999999999999999999998421117999999997799999999999999


Q ss_pred             HHHHHHHHHHHHHHCCHHCC-HHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999989999985212335-89999999999999999999999997
Q gi|254781041|r   81 IHHMLGGIRYLIWDVSLCLD-KKIATQMAKINIIASILTVLIVWIIK  126 (129)
Q Consensus        81 ~yH~~nGiRHL~wD~g~g~~-~~~~~~s~~~vl~~sil~~~~~~~i~  126 (129)
                      +||++||+||++||+|+|+| +++++++++++++++++.++..|++.
T Consensus        82 ~yH~~nGIRHL~wD~G~g~~~~~~~~~s~~~~~~~si~~s~~~~~~i  128 (129)
T d1nekc_          82 AYHVVVGIRHMMMDFGYLEETFEAGKRSAKISFVITVVLSLLAGVLV  128 (129)
T ss_dssp             HHHHHHHHHHHHHHHTSSCCSHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999859999997430234689999999999999999999999997



>d1kf6c_ f.21.2.2 (C:) Fumarate reductase subunit FrdC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kf6d_ f.21.2.2 (D:) Fumarate reductase subunit FrdD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nekd_ f.21.2.2 (D:) Succinate dehydrogenase subunit SdhD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2c1 f.21.2.1 (C:1-254) Fumarate reductase respiratory complex cytochrome b subunit, FrdC {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2bs2c1 f.21.2.1 (C:1-254) Fumarate reductase respiratory complex cytochrome b subunit, FrdC {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 129 succinate dehydrogenase protein, cytochrome b subu
2wdq_C_129 (C:) Succinate dehydrogenase cytochrome B556 subun 8e-21
1zoy_C_27-140114 (C:27-140) Large cytochrome binding protein, FAD-b 2e-17
2h88_C_27-140114 (C:27-140) Succinate dehydrogenase cytochrome B, l 2e-17
>2wdq_C (C:) Succinate dehydrogenase cytochrome B556 subunit; succinate dehydrogenase activity, cell inner membrane, tricarboxylic acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_C* 2acz_C* 1nek_C* 2wdr_C* 2wdv_C*Length = 129 Back     alignment and structure
 Score = 93.4 bits (232), Expect = 8e-21
 Identities = 23/126 (18%), Positives = 60/126 (47%), Gaps = 1/126 (0%)

Query: 1   MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSL 60
           + ++K  RP++  LQ  R   T   SI+HR++G + ++   ++++      +        
Sbjct: 2   IRNVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILLWLLGTSLSSPEGFEQA 61

Query: 61  RCYMDGSVFEVCLFLYTWAVIHHMLGGIRYLIWDVSLCLD-KKIATQMAKINIIASILTV 119
              M     +  ++    A+ +H++ GIR+++ D     +  +   + AKI+ + +++  
Sbjct: 62  SAIMGSFFVKFIMWGILTALAYHVVVGIRHMMMDFGYLEETFEAGKRSAKISFVITVVLS 121

Query: 120 LIVWII 125
           L+  ++
Sbjct: 122 LLAGVL 127


>1zoy_C (C:27-140) Large cytochrome binding protein, FAD-binding protein; succinate, ubiquinone oxidoreductase, mitochondrial respiratory complex II; HET: FAD HEM EPH UQ1; 2.40A {Sus scrofa} PDB: 1zp0_C*Length = 114 Back     alignment and structure
>2h88_C (C:27-140) Succinate dehydrogenase cytochrome B, large subunit; complex II, membrane protein, heme protein, iron sulfur protein, oxidoreductase, redox enzyme; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 2h89_C* 1yq3_C* 1yq4_C* 2fbw_C*Length = 114 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target129 succinate dehydrogenase protein, cytochrome b subunit [
2wdq_C_129 Succinate dehydrogenase cytochrome B556 subunit; s 100.0
1zoy_C_27-140114 Large cytochrome binding protein, FAD-binding prot 100.0
2h88_C_27-140114 Succinate dehydrogenase cytochrome B, large subuni 100.0
2wdq_D_115 Succinate dehydrogenase hydrophobic membrane ancho 98.97
2bs2_C_17-256240 Quinol-fumarate reductase diheme cytochrome B subu 98.4
1kf6_D_119 Fumarate reductase 13 kDa hydrophobic protein; res 93.48
2bs2_C_17-256 240 Quinol-fumarate reductase diheme cytochrome B subu 97.08
1kf6_C_1-9191 Fumarate reductase 15 kDa hydrophobic protein; res 93.56
>2wdq_C (C:) Succinate dehydrogenase cytochrome B556 subunit; succinate dehydrogenase activity, cell inner membrane, tricarboxylic acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_C* 2acz_C* 1nek_C* 2wdr_C* 2wdv_C* Back     alignment and structure
Probab=100.00  E-value=2.2e-43  Score=255.92  Aligned_cols=125  Identities=18%  Similarity=0.341  Sum_probs=120.1

Q ss_pred             CCCCCCCCCCCCCCCEECCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             96200498999773510266659999999999999999999999999998516303554675306831699999999999
Q gi|254781041|r    1 MSSIKNNRPLSPHLQIYRLIPTMFVSIVHRITGSVVYLGTPVVVFWFFCIANGEHTLSSLRCYMDGSVFEVCLFLYTWAV   80 (129)
Q Consensus         1 m~~m~~~RPlsphL~iyk~~~t~~~SI~HRitGi~l~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~   80 (129)
                      +.|||+|||+||||||||+|++|++||+||+||++++++++++.+++.....+||+|+.+...++++++|++++++.+++
T Consensus         2 a~~~~~~RP~sPhL~iYr~~~~~~~SIlHRiTG~~L~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~   81 (129)
T 2wdq_C            2 IRNVKKQRPVNLDLQTIRFPITAIASILHRVSGVITFVAVGILLWLLGTSLSSPEGFEQASAIMGSFFVKFIMWGILTAL   81 (129)
T ss_dssp             ------CCCBCCCGGGSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHSHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             10014699999985624632999999999999999999999999999997223027999999997799999999999999


Q ss_pred             HHHHHHHHHHHHHHCCHHCC-HHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999989999985212335-8999999999999999999999999
Q gi|254781041|r   81 IHHMLGGIRYLIWDVSLCLD-KKIATQMAKINIIASILTVLIVWII  125 (129)
Q Consensus        81 ~yH~~nGiRHL~wD~g~g~~-~~~~~~s~~~vl~~sil~~~~~~~i  125 (129)
                      .||++||+||++||+|+|++ +++++++++++++++++.++..|+.
T Consensus        82 ~yH~~nGiRHL~~D~g~g~~~~~~~~~s~~~v~~~s~~~t~~~~~~  127 (129)
T 2wdq_C           82 AYHVVVGIRHMMMDFGYLEETFEAGKRSAKISFVITVVLSLLAGVL  127 (129)
T ss_dssp             HHHHHHHHHHHHHHTTSSCCSHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999983999999823003468999999999999999999999999



>1zoy_C (C:27-140) Large cytochrome binding protein, FAD-binding protein; succinate, ubiquinone oxidoreductase, mitochondrial respiratory complex II; HET: FAD HEM EPH UQ1; 2.40A {Sus scrofa} PDB: 1zp0_C* Back     alignment and structure
>2h88_C (C:27-140) Succinate dehydrogenase cytochrome B, large subunit; complex II, membrane protein, heme protein, iron sulfur protein, oxidoreductase, redox enzyme; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 2h89_C* 1yq3_C* 1yq4_C* 2fbw_C* Back     alignment and structure
>2wdq_D (D:) Succinate dehydrogenase hydrophobic membrane anchor subunit; succinate dehydrogenase activity, cell inner membrane, tricarboxylic acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_D* 2acz_D* 1nek_D* 2wdr_D* 2wdv_D* Back     alignment and structure
>2bs2_C (C:17-256) Quinol-fumarate reductase diheme cytochrome B subunit C; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} Back     alignment and structure
>1kf6_D (D:) Fumarate reductase 13 kDa hydrophobic protein; respiration, fumarate reductace, succinate dehydrogenase, complex II, quinol, quinone; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>2bs2_C (C:17-256) Quinol-fumarate reductase diheme cytochrome B subunit C; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} Back     alignment and structure
>1kf6_C (C:1-91) Fumarate reductase 15 kDa hydrophobic protein; respiration, fumarate reductace, succinate dehydrogenase, complex II, quinol, quinone; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} Back     alignment and structure