254781042

254781042

succinate dehydrogenase hydrophobic membrane anchor

GeneID in NCBI database:8210065Locus tag:CLIBASIA_04720
Protein GI in NCBI database:254781042Protein Accession:YP_003065455.1
Gene range:+(1044471, 1044863)Protein Length:130aa
Gene description:succinate dehydrogenase hydrophobic membrane anchor
COG prediction:[C] Succinate dehydrogenase, hydrophobic anchor subunit
KEGG prediction:sdhD; succinate dehydrogenase hydrophobic membrane anchor; K00242 succinate dehydrogenase hydrophobic membrane anchor protein [EC:1.3.99.1]
SEED prediction:Succinate dehydrogenase hydrophobic membrane anchor protein
Pathway involved in KEGG:Citrate cycle (TCA cycle) [PATH:las00020]
Butanoate metabolism [PATH:las00650]
Oxidative phosphorylation [PATH:las00190]
Toluene degradation
Subsystem involved in SEED:Succinate dehydrogenase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM3 TM-Helix
TOPPRED3 TM-Helix
HMMTOP3 TM-Helix
MEMSAT3 TM-Helix
MEMSAT_SVM2 TM-Helix
PHOBIUS3 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAILGTL
ccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
ccccccccHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
mdfdmrsslgrvrgmgsakdgtgHFIKQRFTAIANIPFIIFFIAFFikygdapyEQIVSVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAILGTL
mdfdmrsslgrvrgmgsakdgtGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAILGTL
MDFDMRSSLGRVRGMGSAKDGTGHFIKQRftaianipfiiffiaffiKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNscfvllliifclfsllKIAILGTL
******S*********S*KDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAILGTL
MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAILGTL
***DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAILGTL
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAILGTL
MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAILGTL
MDFDMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKIAILGTL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target130 succinate dehydrogenase hydrophobic membrane anchor [Ca
315122381128 succinate dehydrogenase hydrophobic membrane anchor [Ca 1 4e-43
325294013126 succinate dehydrogenase hydrophobic membrane anchor [Ag 1 1e-34
241206663126 succinate dehydrogenase, hydrophobic membrane anchor pr 1 2e-34
209551263126 succinate dehydrogenase, hydrophobic membrane anchor pr 1 3e-34
86359477126 succinate dehydrogenase subunit D, membrane anchor prot 1 4e-34
116254177126 succinate dehydrogenase hydrophobic membrane anchor pro 1 4e-34
218671677126 succinate dehydrogenase protein, membrane anchor subuni 1 5e-34
190893745126 succinate dehydrogenase, membrane anchor subunit [Rhizo 1 1e-33
15889900126 succinate dehydrogenase hydrophobic membrane anchor [Ag 1 1e-33
222150047126 succinate dehydrogenase hydrophobic membrane anchor [Ag 1 1e-32
>gi|315122381|ref|YP_004062870.1| succinate dehydrogenase hydrophobic membrane anchor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 128 Back     alignment and organism information
 Score =  177 bits (449), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 113/126 (89%)

Query: 4   DMRSSLGRVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSN 63
           +MRSSLG+VRGMGSAKDGTGHF+KQRFTAIANIPF+IFFI FFI+YG AP+EQIVSV+SN
Sbjct: 2   NMRSSLGKVRGMGSAKDGTGHFLKQRFTAIANIPFVIFFIIFFIRYGSAPHEQIVSVVSN 61

Query: 64  VAVASIMGLGTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLK 123
           + VASIMGLG +SI  HMQLGMQVIIEDY+H +LLKI+ L +NS FVL + +FCLFS+LK
Sbjct: 62  LFVASIMGLGAVSIFFHMQLGMQVIIEDYVHSKLLKIVLLMLNSSFVLFMAVFCLFSILK 121

Query: 124 IAILGT 129
           I+ILG 
Sbjct: 122 ISILGN 127


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325294013|ref|YP_004279877.1| succinate dehydrogenase hydrophobic membrane anchor [Agrobacterium sp. H13-3] Length = 126 Back     alignment and organism information
>gi|241206663|ref|YP_002977759.1| succinate dehydrogenase, hydrophobic membrane anchor protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 126 Back     alignment and organism information
>gi|209551263|ref|YP_002283180.1| succinate dehydrogenase, hydrophobic membrane anchor protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 126 Back     alignment and organism information
>gi|86359477|ref|YP_471369.1| succinate dehydrogenase subunit D, membrane anchor protein [Rhizobium etli CFN 42] Length = 126 Back     alignment and organism information
>gi|116254177|ref|YP_770015.1| succinate dehydrogenase hydrophobic membrane anchor protein [Rhizobium leguminosarum bv. viciae 3841] Length = 126 Back     alignment and organism information
>gi|218671677|ref|ZP_03521346.1| succinate dehydrogenase protein, membrane anchor subunit [Rhizobium etli GR56] Length = 126 Back     alignment and organism information
>gi|190893745|ref|YP_001980287.1| succinate dehydrogenase, membrane anchor subunit [Rhizobium etli CIAT 652] Length = 126 Back     alignment and organism information
>gi|15889900|ref|NP_355581.1| succinate dehydrogenase hydrophobic membrane anchor [Agrobacterium tumefaciens str. C58] Length = 126 Back     alignment and organism information
>gi|222150047|ref|YP_002551004.1| succinate dehydrogenase hydrophobic membrane anchor [Agrobacterium vitis S4] Length = 126 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target130 succinate dehydrogenase hydrophobic membrane anchor [Ca
TIGR02968105 TIGR02968, succ_dehyd_anc, succinate dehydrogenase, hyd 3e-17
cd03495100 cd03495, SQR_TypeC_SdhD_like, Succinate:quinone oxidore 8e-16
pfam01127122 pfam01127, Sdh_cyt, Succinate dehydrogenase/Fumarate re 7e-05
cd0349499 cd03494, SQR_TypeC_SdhD, Succinate:quinone oxidoreducta 0.001
COG2142117 COG2142, SdhD, Succinate dehydrogenase, hydrophobic anc 3e-18
>gnl|CDD|163091 TIGR02968, succ_dehyd_anc, succinate dehydrogenase, hydrophobic membrane anchor protein Back     alignment and domain information
>gnl|CDD|48056 cd03495, SQR_TypeC_SdhD_like, Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase D (SdhD) subunit-like; composed of predominantly uncharacterized bacterial proteins with similarity to the E Back     alignment and domain information
>gnl|CDD|144645 pfam01127, Sdh_cyt, Succinate dehydrogenase/Fumarate reductase transmembrane subunit Back     alignment and domain information
>gnl|CDD|48055 cd03494, SQR_TypeC_SdhD, Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase D (SdhD) subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol Back     alignment and domain information
>gnl|CDD|32325 COG2142, SdhD, Succinate dehydrogenase, hydrophobic anchor subunit [Energy production and conversion] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 130 succinate dehydrogenase hydrophobic membrane anchor [Ca
TIGR02968105 succ_dehyd_anc succinate dehydrogenase, hydrophobic mem 100.0
COG2142117 SdhD Succinate dehydrogenase, hydrophobic anchor subuni 99.96
cd03495100 SQR_TypeC_SdhD_like Succinate:quinone oxidoreductase (S 99.96
PRK09488115 sdhD succinate dehydrogenase cytochrome b556 small memb 99.93
cd0349499 SQR_TypeC_SdhD Succinate:quinone oxidoreductase (SQR) T 99.91
cd03500106 SQR_TypeA_SdhD_like Succinate:quinone oxidoreductase (S 99.49
cd0349398 SQR_QFR_TM Succinate:quinone oxidoreductase (SQR) and Q 99.23
pfam05328107 CybS CybS. This family consists of several eukaryotic s 98.79
cd03496104 SQR_TypeC_CybS SQR catalyzes the oxidation of succinate 98.68
cd03526199 SQR_QFR_TypeB_TM Succinate:quinone oxidoreductase (SQR) 98.61
TIGR02970123 succ_dehyd_cytB succinate dehydrogenase, cytochrome b55 98.54
cd03501101 SQR_TypeA_SdhC_like Succinate:quinone oxidoreductase (S 98.41
cd03497207 SQR_TypeB_1_TM Succinate:quinone oxidoreductase (SQR) T 98.34
PRK09487129 sdhC succinate dehydrogenase cytochrome b556 large memb 98.26
pfam02967223 consensus 98.14
cd03499117 SQR_TypeC_SdhC Succinate:quinone oxidoreductase (SQR) T 98.11
KOG4097178 consensus 98.05
cd00581206 QFR_TypeB_TM Quinol:fumarate reductase (QFR) Type B sub 97.98
PRK13554241 fumarate reductase cytochrome b-556 subunit; Provisiona 97.8
cd03498209 SQR_TypeB_2_TM Succinate:quinone oxidoreductase (SQR)-l 97.64
PRK13553252 fumarate reductase cytochrome b-556 subunit; Provisiona 97.51
pfam01127122 Sdh_cyt Succinate dehydrogenase/Fumarate reductase tran 99.46
COG2009132 SdhC Succinate dehydrogenase/fumarate reductase, cytoch 97.41
cd00546124 QFR_TypeD_subunitC Quinol:fumarate reductase (QFR) Type 95.55
PRK04987129 fumarate reductase subunit C; Provisional 95.49
pfam02300128 Fumarate_red_C Fumarate reductase subunit C. Fumarate r 95.22
PRK13603126 fumarate reductase subunit C; Provisional 94.38
pfam02313118 Fumarate_red_D Fumarate reductase subunit D. Fumarate r 92.75
PRK05470118 fumarate reductase subunit D; Provisional 91.27
>TIGR02968 succ_dehyd_anc succinate dehydrogenase, hydrophobic membrane anchor protein; InterPro: IPR014312 In Escherichia coli and many other bacteria, two small, hydrophobic, mutually homologous subunits of succinate dehydrogenase (a TCA cycle enzyme) are SdhC and SdhD Back     alignment and domain information
>COG2142 SdhD Succinate dehydrogenase, hydrophobic anchor subunit [Energy production and conversion] Back     alignment and domain information
>cd03495 SQR_TypeC_SdhD_like Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase D (SdhD) subunit-like; composed of predominantly uncharacterized bacterial proteins with similarity to the E Back     alignment and domain information
>PRK09488 sdhD succinate dehydrogenase cytochrome b556 small membrane subunit; Provisional Back     alignment and domain information
>cd03494 SQR_TypeC_SdhD Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase D (SdhD) subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol Back     alignment and domain information
>cd03500 SQR_TypeA_SdhD_like Succinate:quinone oxidoreductase (SQR) Type A subfamily, Succinate dehydrogenase D (SdhD)-like subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol Back     alignment and domain information
>cd03493 SQR_QFR_TM Succinate:quinone oxidoreductase (SQR) and Quinol:fumarate reductase (QFR) family, transmembrane subunits; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol, while QFR catalyzes the reverse reaction Back     alignment and domain information
>pfam05328 CybS CybS Back     alignment and domain information
>cd03496 SQR_TypeC_CybS SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol Back     alignment and domain information
>cd03526 SQR_QFR_TypeB_TM Succinate:quinone oxidoreductase (SQR) and Quinol:fumarate reductase (QFR) Type B subfamily, transmembrane subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol, while QFR catalyzes the reverse reaction Back     alignment and domain information
>TIGR02970 succ_dehyd_cytB succinate dehydrogenase, cytochrome b556 subunit; InterPro: IPR014314 In E Back     alignment and domain information
>cd03501 SQR_TypeA_SdhC_like Succinate:quinone oxidoreductase (SQR) Type A subfamily, Succinate dehydrogenase C (SdhC)-like subunit; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol Back     alignment and domain information
>cd03497 SQR_TypeB_1_TM Succinate:quinone oxidoreductase (SQR) Type B subfamily 1, transmembrane subunit; composed of proteins similar to Bacillus subtilis SQR Back     alignment and domain information
>PRK09487 sdhC succinate dehydrogenase cytochrome b556 large membrane subunit; Provisional Back     alignment and domain information
>pfam02967 consensus Back     alignment and domain information
>cd03499 SQR_TypeC_SdhC Succinate:quinone oxidoreductase (SQR) Type C subfamily, Succinate dehydrogenase C (SdhC) subunit; composed of bacterial SdhC and eukaryotic large cytochrome b binding (CybL) proteins Back     alignment and domain information
>KOG4097 consensus Back     alignment and domain information
>cd00581 QFR_TypeB_TM Quinol:fumarate reductase (QFR) Type B subfamily, transmembrane subunit; QFR couples the reduction of fumarate to succinate to the oxidation of quinol to quinone, the opposite reaction to that catalyzed by the related protein, succinate:quinone oxidoreductase (SQR) Back     alignment and domain information
>PRK13554 fumarate reductase cytochrome b-556 subunit; Provisional Back     alignment and domain information
>cd03498 SQR_TypeB_2_TM Succinate:quinone oxidoreductase (SQR)-like Type B subfamily 2, transmembrane subunit; composed of proteins with similarity to the SQRs of Geobacter metallireducens and Corynebacterium glutamicum Back     alignment and domain information
>PRK13553 fumarate reductase cytochrome b-556 subunit; Provisional Back     alignment and domain information
>pfam01127 Sdh_cyt Succinate dehydrogenase/Fumarate reductase transmembrane subunit Back     alignment and domain information
>COG2009 SdhC Succinate dehydrogenase/fumarate reductase, cytochrome b subunit [Energy production and conversion] Back     alignment and domain information
>cd00546 QFR_TypeD_subunitC Quinol:fumarate reductase (QFR) Type D subfamily, 15kD hydrophobic subunit C; QFR couples the reduction of fumarate to succinate to the oxidation of quinol to quinone, the opposite reaction to that catalyzed by the related protein, succinate:quinine oxidoreductase (SQR) Back     alignment and domain information
>PRK04987 fumarate reductase subunit C; Provisional Back     alignment and domain information
>pfam02300 Fumarate_red_C Fumarate reductase subunit C Back     alignment and domain information
>PRK13603 fumarate reductase subunit C; Provisional Back     alignment and domain information
>pfam02313 Fumarate_red_D Fumarate reductase subunit D Back     alignment and domain information
>PRK05470 fumarate reductase subunit D; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target130 succinate dehydrogenase hydrophobic membrane anchor [Ca
1nek_D115 Complex Ii (Succinate Dehydrogenase) From E. Coli W 6e-08
2ws3_D115 Crystal Structure Of The E. Coli Succinate:quinone 5e-07
2wu5_D115 Crystal Structure Of The E. Coli Succinate:quinone 1e-06
gi|28948821|pdb|1NEK|D Chain D, Complex Ii (Succinate Dehydrogenase) From E. Coli With Ubiquinone Bound Length = 115 Back     alignment and structure
 Score = 61.0 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 48/105 (45%)

Query: 18  AKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISI 77
            ++G   FI  R TAI    +II+ + FF   G+  YE  +   ++        L   SI
Sbjct: 9   GRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVFTLLALFSI 68

Query: 78  SVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLL 122
            +H  +GM  ++ DY+    L++M   +    +++ +I+    + 
Sbjct: 69  LIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVW 113


>gi|304445615|pdb|2WS3|D Chain D, Crystal Structure Of The E. Coli Succinate:quinone Oxidoreductase (Sqr) Sdhd Tyr83phe Mutant Length = 115 Back     alignment and structure
>gi|304445643|pdb|2WU5|D Chain D, Crystal Structure Of The E. Coli Succinate:quinone Oxidoreductase (Sqr) Sdhd His71met Mutant Length = 115 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target130 succinate dehydrogenase hydrophobic membrane anchor [Ca
2wdq_D115 Succinate dehydrogenase hydrophobic membrane anchor sub 1e-12
2h88_D103 Succinate dehydrogenase cytochrome B, small subunit; co 5e-09
>2wdq_D Succinate dehydrogenase hydrophobic membrane anchor subunit; succinate dehydrogenase activity, cell inner membrane, tricarboxylic acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_D* 2acz_D* 1nek_D* 2wdr_D* 2wdv_D* Length = 115 Back     alignment and structure
 Score = 67.1 bits (164), Expect = 1e-12
 Identities = 25/112 (22%), Positives = 49/112 (43%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGL 72
                 ++G   FI  R TAI    +II+ + FF   G+  YE  +   ++        L
Sbjct: 4   NASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVFTLL 63

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
              SI +H  +GM  ++ DY+    L++M   +    +++ +I+    +  +
Sbjct: 64  ALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV 115


>2h88_D Succinate dehydrogenase cytochrome B, small subunit; complex II, membrane protein, heme protein, iron sulfur protein, oxidoreductase, redox enzyme; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_D* 1yq3_D* 2fbw_D* 2h89_D* 1zoy_D* 1zp0_D* Length = 103 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target130 succinate dehydrogenase hydrophobic membrane anchor [Ca
2wdq_D115 Succinate dehydrogenase hydrophobic membrane anchor sub 99.97
2h88_D103 Succinate dehydrogenase cytochrome B, small subunit; co 99.84
2bs2_C256 Quinol-fumarate reductase diheme cytochrome B subunit C 98.88
1zoy_C140 Large cytochrome binding protein, FAD-binding protein; 97.24
2h88_C140 Succinate dehydrogenase cytochrome B, large subunit; co 97.22
2wdq_C129 Succinate dehydrogenase cytochrome B556 subunit; succin 98.08
1kf6_C130 Fumarate reductase 15 kDa hydrophobic protein; respirat 94.87
1kf6_D119 Fumarate reductase 13 kDa hydrophobic protein; respirat 91.57
>2wdq_D Succinate dehydrogenase hydrophobic membrane anchor subunit; succinate dehydrogenase activity, cell inner membrane, tricarboxylic acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_D* 2acz_D* 1nek_D* 2wdr_D* 2wdv_D* 2wp9_D* 2wu2_D* 2ws3_D* 2wu5_D* Back     alignment and structure
Probab=99.97  E-value=5e-31  Score=198.76  Aligned_cols=112  Identities=23%  Similarity=0.463  Sum_probs=106.7

Q ss_pred             HHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             98305542210899999999999999999999999996289998999999946259999999999999999840488998
Q gi|254781042|r   11 RVRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQVIIE   90 (130)
Q Consensus        11 ~~rglgsa~~G~~hW~~QRiSAi~L~~l~i~~i~~~~~~~~~~y~~~~~~~~~~~~~il~~l~~~~~~~Ha~lGl~~Iie   90 (130)
                      +++++|  |+|++||+.||+||++++|+.+|+++++...++.|||++.+|+++|+|++++.++++++++|+++|+|+|+|
T Consensus         4 ~~~~~~--~sG~~~W~~qRiSAv~l~~l~~~~~~~~~~~~~~~y~~~~~~~~~~~~~i~~~l~~~~~~~Ha~lGl~~Iie   81 (115)
T 2wdq_D            4 NASALG--RNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVFTLLALFSILIHAWIGMWQVLT   81 (115)
T ss_dssp             ---------CHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSSCCHHHHHHHHHSHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CHHCCC--CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             132455--678999999999999999999999999998399999999999948599999999999999999971656789


Q ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             5127731899999999999999999999999999
Q gi|254781042|r   91 DYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI  124 (130)
Q Consensus        91 DYI~~~~~k~~~~~~~~~~~~~~~~~~i~~i~~i  124 (130)
                      ||+|+++.|..++.+.+++++++.+++++++|+|
T Consensus        82 DYi~~~~~r~~~~~~~~~~~~~~~~~~i~~lw~i  115 (115)
T 2wdq_D           82 DYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV  115 (115)
T ss_dssp             HHCCSHHHHHHHHHHHHHHHHHHHHHHHHHHTTC
T ss_pred             HHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             9559746999999999999999999999999729



>2h88_D Succinate dehydrogenase cytochrome B, small subunit; complex II, membrane protein, heme protein, iron sulfur protein, oxidoreductase, redox enzyme; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_D* 1yq3_D* 2fbw_D* 2h89_D* 2wqy_D* 1zoy_D* 1zp0_D* Back     alignment and structure
>2bs2_C Quinol-fumarate reductase diheme cytochrome B subunit C; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: f.21.2.1 PDB: 1qlb_C* 1e7p_C* 2bs3_C* 2bs4_C* Back     alignment and structure
>1zoy_C Large cytochrome binding protein, FAD-binding protein; succinate, ubiquinone oxidoreductase, mitochondrial respiratory complex II; HET: FAD HEM EPH UQ1; 2.40A {Sus scrofa} PDB: 1zp0_C* Back     alignment and structure
>2h88_C Succinate dehydrogenase cytochrome B, large subunit; complex II, membrane protein, heme protein, iron sulfur protein, oxidoreductase, redox enzyme; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 2h89_C* 1yq3_C* 1yq4_C* 2fbw_C* 2wqy_C* Back     alignment and structure
>2wdq_C Succinate dehydrogenase cytochrome B556 subunit; succinate dehydrogenase activity, cell inner membrane, tricarboxylic acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_C* 2acz_C* 1nek_C* 2wdr_C* 2wdv_C* 2wp9_C* 2ws3_C* 2wu5_C* 2wu2_C* Back     alignment and structure
>1kf6_C Fumarate reductase 15 kDa hydrophobic protein; respiration, fumarate reductace, succinate dehydrogenase, complex II, quinol, quinone; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: f.21.2.2 PDB: 1kfy_C* 1l0v_C* 2b76_C* 3cir_C* Back     alignment and structure
>1kf6_D Fumarate reductase 13 kDa hydrophobic protein; respiration, fumarate reductace, succinate dehydrogenase, complex II, quinol, quinone; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: f.21.2.2 PDB: 1kfy_D* 1l0v_D* 2b76_D* 3cir_D* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 130 succinate dehydrogenase hydrophobic membrane anchor [Ca
d1nekd_113 f.21.2.2 (D:) Succinate dehydrogenase subunit SdhD {Esc 7e-14
>d1nekd_ f.21.2.2 (D:) Succinate dehydrogenase subunit SdhD {Escherichia coli [TaxId: 562]} Length = 113 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Heme-binding four-helical bundle
superfamily: Fumarate reductase respiratory complex transmembrane subunits
family: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD)
domain: Succinate dehydrogenase subunit SdhD
species: Escherichia coli [TaxId: 562]
 Score = 69.7 bits (171), Expect = 7e-14
 Identities = 25/111 (22%), Positives = 49/111 (44%)

Query: 14  GMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLG 73
                ++G   FI  R TAI    +II+ + FF   G+  YE  +   ++        L 
Sbjct: 3   ASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVFTLLA 62

Query: 74  TISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
             SI +H  +GM  ++ DY+    L++M   +    +++ +I+    +  +
Sbjct: 63  LFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV 113


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target130 succinate dehydrogenase hydrophobic membrane anchor [Ca
d1nekd_113 Succinate dehydrogenase subunit SdhD {Escherichia coli 99.97
d2bs2c1254 Fumarate reductase respiratory complex cytochrome b sub 98.86
d1nekc_129 Succinate dehydrogenase subunit SdhC {Escherichia coli 97.96
d1kf6c_130 Fumarate reductase subunit FrdC {Escherichia coli [TaxI 94.66
d1kf6d_119 Fumarate reductase subunit FrdD {Escherichia coli [TaxI 90.35
>d1nekd_ f.21.2.2 (D:) Succinate dehydrogenase subunit SdhD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Heme-binding four-helical bundle
superfamily: Fumarate reductase respiratory complex transmembrane subunits
family: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD)
domain: Succinate dehydrogenase subunit SdhD
species: Escherichia coli [TaxId: 562]
Probab=99.97  E-value=3.5e-31  Score=198.29  Aligned_cols=109  Identities=23%  Similarity=0.441  Sum_probs=105.3

Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             54221089999999999999999999999999628999899999994625999999999999999984048899851277
Q gi|254781042|r   16 GSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQVIIEDYIHY   95 (130)
Q Consensus        16 gsa~~G~~hW~~QRiSAi~L~~l~i~~i~~~~~~~~~~y~~~~~~~~~~~~~il~~l~~~~~~~Ha~lGl~~IieDYI~~   95 (130)
                      +.+|+|++||+.||+||++++|+++|+++.+....+.|||++.+|+++|+|++++.+++++.++|+++|+|+|+|||+|+
T Consensus         5 ~~~rsG~~~W~~qRvSAv~l~~l~~~~~~~~~~~~~~~y~~~~~~~~~~~~~il~~l~l~~~~~H~~lGl~~IieDYi~~   84 (113)
T d1nekd_           5 ALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVFTLLALFSILIHAWIGMWQVLTDYVKP   84 (113)
T ss_dssp             SSSSSHHHHHHHHHHHHHHHHHHHHHHHHHHTTTSSCCHHHHHHHHSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCS
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             36556899999999999999999999999999829999999999993949999999999999999997075668995597


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             31899999999999999999999999999
Q gi|254781042|r   96 RLLKIMFLFMNSCFVLLLIIFCLFSLLKI  124 (130)
Q Consensus        96 ~~~k~~~~~~~~~~~~~~~~~~i~~i~~i  124 (130)
                      ++.|+.++.+++++++++++++++++|+|
T Consensus        85 ~~~r~~~~~~~~~~~~~~~~~~i~~lw~i  113 (113)
T d1nekd_          85 LALRLMLQLVIVVALVVYVIYGFVVVWGV  113 (113)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             46999999999999999999999999729



>d2bs2c1 f.21.2.1 (C:1-254) Fumarate reductase respiratory complex cytochrome b subunit, FrdC {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1nekc_ f.21.2.2 (C:) Succinate dehydrogenase subunit SdhC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kf6c_ f.21.2.2 (C:) Fumarate reductase subunit FrdC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kf6d_ f.21.2.2 (D:) Fumarate reductase subunit FrdD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 130 succinate dehydrogenase hydrophobic membrane ancho
2wdq_D_115 (D:) Succinate dehydrogenase hydrophobic membrane 6e-18
>2wdq_D (D:) Succinate dehydrogenase hydrophobic membrane anchor subunit; succinate dehydrogenase activity, cell inner membrane, tricarboxylic acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_D* 2acz_D* 1nek_D* 2wdr_D* 2wdv_D*Length = 115 Back     alignment and structure
 Score = 84.0 bits (208), Expect = 6e-18
 Identities = 25/112 (22%), Positives = 49/112 (43%)

Query: 13  RGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGL 72
                 ++G   FI  R TAI    +II+ + FF   G+  YE  +   ++        L
Sbjct: 4   NASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVFTLL 63

Query: 73  GTISISVHMQLGMQVIIEDYIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI 124
              SI +H  +GM  ++ DY+    L++M   +    +++ +I+    +  +
Sbjct: 64  ALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV 115


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target130 succinate dehydrogenase hydrophobic membrane anchor [Ca
2wdq_D_115 Succinate dehydrogenase hydrophobic membrane ancho 99.97
2h88_D_103 Succinate dehydrogenase cytochrome B, small subuni 98.99
2bs2_C_17-256240 Quinol-fumarate reductase diheme cytochrome B subu 98.72
1zoy_C_27-140114 Large cytochrome binding protein, FAD-binding prot 97.74
2h88_C_27-140114 Succinate dehydrogenase cytochrome B, large subuni 97.61
2wdq_C_129 Succinate dehydrogenase cytochrome B556 subunit; s 98.31
1kf6_C_1-9191 Fumarate reductase 15 kDa hydrophobic protein; res 95.19
1kf6_D_119 Fumarate reductase 13 kDa hydrophobic protein; res 91.36
>2wdq_D (D:) Succinate dehydrogenase hydrophobic membrane anchor subunit; succinate dehydrogenase activity, cell inner membrane, tricarboxylic acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_D* 2acz_D* 1nek_D* 2wdr_D* 2wdv_D* Back     alignment and structure
Probab=99.97  E-value=2.8e-31  Score=201.13  Aligned_cols=113  Identities=22%  Similarity=0.421  Sum_probs=110.8

Q ss_pred             HHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             83055422108999999999999999999999999962899989999999462599999999999999998404889985
Q gi|254781042|r   12 VRGMGSAKDGTGHFIKQRFTAIANIPFIIFFIAFFIKYGDAPYEQIVSVLSNVAVASIMGLGTISISVHMQLGMQVIIED   91 (130)
Q Consensus        12 ~rglgsa~~G~~hW~~QRiSAi~L~~l~i~~i~~~~~~~~~~y~~~~~~~~~~~~~il~~l~~~~~~~Ha~lGl~~IieD   91 (130)
                      .||+||+|+|++||+.||+||++++|+++|+++.+...++.|||++.+++++|++++++.+++.+.++|+++|+|+|+||
T Consensus         3 ~r~~~~~~~G~~~W~~qRiTav~L~~l~~~~i~~~~~~~~~~y~~~~~~~~~p~~~i~~~l~l~~~~~Ha~~G~~~iieD   82 (115)
T 2wdq_D            3 SNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVFTLLALFSILIHAWIGMWQVLTD   82 (115)
T ss_dssp             --------CHHHHHHHHHHHHHHHHHHHHHHHHHHTTCSSCCHHHHHHHHHSHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             12204556789999999999999999999999999982999999999999494999999999999999999989999999


Q ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             127731899999999999999999999999999
Q gi|254781042|r   92 YIHYRLLKIMFLFMNSCFVLLLIIFCLFSLLKI  124 (130)
Q Consensus        92 YI~~~~~k~~~~~~~~~~~~~~~~~~i~~i~~i  124 (130)
                      |+|+++.|...+.++++++.+.++.++++++|+
T Consensus        83 Yv~~~~~r~~~~~~~~~~~~~~~~~g~~~i~~i  115 (115)
T 2wdq_D           83 YVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV  115 (115)
T ss_dssp             HCCSHHHHHHHHHHHHHHHHHHHHHHHHHHTTC
T ss_pred             HCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             837466999999999999999999999999839



>2h88_D (D:) Succinate dehydrogenase cytochrome B, small subunit; complex II, membrane protein, heme protein, iron sulfur protein, oxidoreductase, redox enzyme; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_D* 1yq3_D* 2fbw_D* 2h89_D* 1zoy_D* 1zp0_D* Back     alignment and structure
>2bs2_C (C:17-256) Quinol-fumarate reductase diheme cytochrome B subunit C; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} Back     alignment and structure
>1zoy_C (C:27-140) Large cytochrome binding protein, FAD-binding protein; succinate, ubiquinone oxidoreductase, mitochondrial respiratory complex II; HET: FAD HEM EPH UQ1; 2.40A {Sus scrofa} PDB: 1zp0_C* Back     alignment and structure
>2h88_C (C:27-140) Succinate dehydrogenase cytochrome B, large subunit; complex II, membrane protein, heme protein, iron sulfur protein, oxidoreductase, redox enzyme; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 2h89_C* 1yq3_C* 1yq4_C* 2fbw_C* Back     alignment and structure
>2wdq_C (C:) Succinate dehydrogenase cytochrome B556 subunit; succinate dehydrogenase activity, cell inner membrane, tricarboxylic acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_C* 2acz_C* 1nek_C* 2wdr_C* 2wdv_C* Back     alignment and structure
>1kf6_C (C:1-91) Fumarate reductase 15 kDa hydrophobic protein; respiration, fumarate reductace, succinate dehydrogenase, complex II, quinol, quinone; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} Back     alignment and structure
>1kf6_D (D:) Fumarate reductase 13 kDa hydrophobic protein; respiration, fumarate reductace, succinate dehydrogenase, complex II, quinol, quinone; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} Back     alignment and structure