254781043

254781043

succinate dehydrogenase flavoprotein subunit

GeneID in NCBI database:8210066Locus tag:CLIBASIA_04725
Protein GI in NCBI database:254781043Protein Accession:YP_003065456.1
Gene range:+(1044860, 1046695)Protein Length:611aa
Gene description:succinate dehydrogenase flavoprotein subunit
COG prediction:[C] Succinate dehydrogenase/fumarate reductase, flavoprotein subunit
KEGG prediction:sdhA; succinate dehydrogenase flavoprotein subunit (EC:1.3.99.1); K00239 succinate dehydrogenase flavoprotein subunit [EC:1.3.99.1]
SEED prediction:Succinate dehydrogenase flavoprotein subunit (EC 1.3.99.1)
Pathway involved in KEGG:Citrate cycle (TCA cycle) [PATH:las00020]
Butanoate metabolism [PATH:las00650]
Oxidative phosphorylation [PATH:las00190]
Toluene degradation
Subsystem involved in SEED:TCA Cycle;
Succinate dehydrogenase
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-
MKNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKARVY
cccHHHcccccccccccccEEEEcccHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccccccEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHcccEEEEEEEEEEEEEcccccEEEEEEEEcccccEEEEEccEEEEEccccHHHHHcccccccccHHHHHHHHHcccEEEcccEEEEEEEEEcccccccccHHccccEEEEccccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHccHHHHHHHHHHHHHHHHHHcccccccccEEEEcccccccccEEEcccEEEEEccccccccccccEEEEcHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccEEEcHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEccccccccccccccccHHEEEEEEEccccccEEEEEccccccccccccEEcccccccccc
ccccHHHHcccccccccccEEEEcccHHHHHHHHHHHcccccEEEEccccHHHcHHHHccccEEccccccccccHHHHHccccccccccccHHHHHHHHHHcHHHHHHHHHccccccccccccEEEEcccccccccccccccEEEccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHEEEEccEEEEEEEEEcccccEEEEEccEEEEcccccHHHcccEccccccccHHHHHHHHccccEEccccEEEEEEEEcccccEcccHHHHcccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHccccEcccccEEEEEcccccHHHHHHHcccccHHHHHHccccccccccccccEEEEcccccccccccEEEEccccccccccccEEEcHHHEEcccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccEEccHHHHHHHHHHHHHHHHHHccccEcccccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHEEEEEcccccEEEEEEcccEcccccccccccccccccccc
mknssnlkssytyvdhsYDVVVVGAGGAGLRATLGMAEKGFKTACitkvfptrshtvaAQGGIAaslanmtpdswqwhlydtikgsdwlgdVDAIQYLAMEapqsvyelehygvpfsrneagkiyqrpfgghmqnygegppvqrtcaaadrtGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGygrayfsatsahtctgdgagmvaraglplqdmefvqfhptgiygagclitegargeggylvnskgerfmeryapsakdlasrdvVSRCMMMEIregrgvgkskdHIHLYLNHldpavlqerlpgisesarifagvdvtrdpipviptvhynmggiptnywgevldansknperfapglmaigeagcasvhganrlgsnsliDLVVFGRAAVIRASemidksspipsldisscdRIMDRFDRlrhadghvpTAALREKMQRAMQLDAgvfrtqdslsdgcrNLSCLWDEMADlkvhdrsliwnsDLVETLELQNLMINAIATVYSAEarkesrgsharedfkdgefggrddvnwrkhslcwvdwntgkikldyrpvhtellcggvdyskiapkarvy
mknssnlkssytyvDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMEryapsakdlasrdvVSRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARifagvdvtrdpiPVIPTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRasemidksspipsldissCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGvfrtqdslsDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEArkesrgsharedfkdgefggrddvnwrKHSLCWVDwntgkikldyrPVHTellcggvdyskiapkarvy
MKNSSNLKSSYTYVDHSYDvvvvgaggagLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKARVY
************YVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRASEM****************RIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKARVY
*********SYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSA***********REDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKARVY
**NS*NLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEAR****************FGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPK****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKARVY
MKNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKARVY
MKNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQGGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNEAGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDLIINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARAGLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVVSRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVIPTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVVFGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLDAGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSAEARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVDYSKIAPKARVY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target611 succinate dehydrogenase flavoprotein subunit [Candidatu
254780842384 2-octaprenyl-6-methoxyphenyl hydroxylase [Candidat 0.003
>gi|254780842|ref|YP_003065255.1| 2-octaprenyl-6-methoxyphenyl hydroxylase [Candidatus Liberibacter asiaticus str. psy62] Length = 384 Back     alignment
 Score = 35.4 bits (80), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 23/30 (76%)

Query: 18 YDVVVVGAGGAGLRATLGMAEKGFKTACIT 47
          +DV+++G+G AG  A +G A+KGF TA ++
Sbjct: 4  FDVIIIGSGLAGSVAAIGAAKKGFLTALVS 33

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target611 succinate dehydrogenase flavoprotein subunit [Candidatu
315122382611 succinate dehydrogenase flavoprotein subunit [Candidatu 1 0.0
325294012613 succinate dehydrogenase flavoprotein subunit [Agrobacte 1 0.0
15889899613 succinate dehydrogenase flavoprotein subunit [Agrobacte 1 0.0
222087467613 succinate dehydrogenase, flavoprotein subunit [Agrobact 1 0.0
116254176613 succinate dehydrogenase flavoprotein subunit [Rhizobium 1 0.0
86359476613 succinate dehydrogenase flavoprotein subunit [Rhizobium 1 0.0
241206662613 succinate dehydrogenase flavoprotein subunit [Rhizobium 1 0.0
209551262613 succinate dehydrogenase flavoprotein subunit [Rhizobium 1 0.0
190893744613 succinate dehydrogenase, flavoprotein subunit [Rhizobiu 1 0.0
222150046618 succinate dehydrogenase flavoprotein subunit [Agrobacte 1 0.0
>gi|315122382|ref|YP_004062871.1| succinate dehydrogenase flavoprotein subunit [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 611 Back     alignment and organism information
 Score = 1190 bits (3079), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/611 (91%), Positives = 592/611 (96%)

Query: 1   MKNSSNLKSSYTYVDHSYDVVVVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ 60
           MK+ SN KSSYTYVDHSYDV++VGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ
Sbjct: 1   MKDISNFKSSYTYVDHSYDVIIVGAGGAGLRATLGMAEKGFKTACITKVFPTRSHTVAAQ 60

Query: 61  GGIAASLANMTPDSWQWHLYDTIKGSDWLGDVDAIQYLAMEAPQSVYELEHYGVPFSRNE 120
           GGIAASLANMTPDSWQWHLYDT+KGSDWLGDVDAIQYLAMEAP+SVYELEHYGVPFSRNE
Sbjct: 61  GGIAASLANMTPDSWQWHLYDTVKGSDWLGDVDAIQYLAMEAPKSVYELEHYGVPFSRNE 120

Query: 121 AGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNNAEFFIEYFALDL 180
            GKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKN+AEFFIEYFALDL
Sbjct: 121 EGKIYQRPFGGHMQNYGEGPPVQRTCAAADRTGHAILHTLYGQALKNDAEFFIEYFALDL 180

Query: 181 IINSEGCCVGVVAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMVARA 240
           I+N+EG CVGV+AWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGM+ARA
Sbjct: 181 IMNAEGRCVGVIAWQLETGEIHRFSAKLVVLATGGYGRAYFSATSAHTCTGDGAGMIARA 240

Query: 241 GLPLQDMEFVQFHPTGIYGAGCLITEGARGEGGYLVNSKGERFMERYAPSAKDLASRDVV 300
           GLPLQDMEFVQFHPTGIYG+GCLITEG RGEGGYLVNS+GERFMERYAPSAKDLASRDVV
Sbjct: 241 GLPLQDMEFVQFHPTGIYGSGCLITEGVRGEGGYLVNSEGERFMERYAPSAKDLASRDVV 300

Query: 301 SRCMMMEIREGRGVGKSKDHIHLYLNHLDPAVLQERLPGISESARIFAGVDVTRDPIPVI 360
           SRCMM+EIREGRGVGK+KDHIHLYLNHLDPA+L ERLPGISESARIFAG+DVTRDPIPVI
Sbjct: 301 SRCMMIEIREGRGVGKNKDHIHLYLNHLDPAILHERLPGISESARIFAGIDVTRDPIPVI 360

Query: 361 PTVHYNMGGIPTNYWGEVLDANSKNPERFAPGLMAIGEAGCASVHGANRLGSNSLIDLVV 420
           PTVHYNMGGIPTNYWGEVLD++SKNPER APGLMAIGEAGCASVHGANRLGSNSLIDLVV
Sbjct: 361 PTVHYNMGGIPTNYWGEVLDSDSKNPERLAPGLMAIGEAGCASVHGANRLGSNSLIDLVV 420

Query: 421 FGRAAVIRASEMIDKSSPIPSLDISSCDRIMDRFDRLRHADGHVPTAALREKMQRAMQLD 480
           FGRAAVIRA+E+IDKSSPIPSLD+S+CD IM+RFDRLR+ADGH+ TA LREKMQRAMQLD
Sbjct: 421 FGRAAVIRAAEIIDKSSPIPSLDVSACDSIMERFDRLRYADGHISTAVLREKMQRAMQLD 480

Query: 481 AGVFRTQDSLSDGCRNLSCLWDEMADLKVHDRSLIWNSDLVETLELQNLMINAIATVYSA 540
           A VFRTQ+SL+ GCRNLS LWDEMA LKV+DRSLIWNSDLVETLELQNLMINAIATVYSA
Sbjct: 481 AAVFRTQESLAAGCRNLSILWDEMAHLKVYDRSLIWNSDLVETLELQNLMINAIATVYSA 540

Query: 541 EARKESRGSHAREDFKDGEFGGRDDVNWRKHSLCWVDWNTGKIKLDYRPVHTELLCGGVD 600
           EARKESRGSHARED+KDG F GRDDVNWRKHSLCWVD  TGKIKLDYRPV TELLCGG+D
Sbjct: 541 EARKESRGSHAREDYKDGAFSGRDDVNWRKHSLCWVDHKTGKIKLDYRPVRTELLCGGID 600

Query: 601 YSKIAPKARVY 611
           Y+KIAPKARVY
Sbjct: 601 YAKIAPKARVY 611


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325294012|ref|YP_004279876.1| succinate dehydrogenase flavoprotein subunit [Agrobacterium sp. H13-3] Length = 613 Back     alignment and organism information
>gi|15889899|ref|NP_355580.1| succinate dehydrogenase flavoprotein subunit [Agrobacterium tumefaciens str. C58] Length = 613 Back     alignment and organism information
>gi|222087467|ref|YP_002546004.1| succinate dehydrogenase, flavoprotein subunit [Agrobacterium radiobacter K84] Length = 613 Back     alignment and organism information
>gi|116254176|ref|YP_770014.1| succinate dehydrogenase flavoprotein subunit [Rhizobium leguminosarum bv. viciae 3841] Length = 613 Back     alignment and organism information
>gi|86359476|ref|YP_471368.1| succinate dehydrogenase flavoprotein subunit [Rhizobium etli CFN 42] Length = 613 Back     alignment and organism information
>gi|241206662|ref|YP_002977758.1| succinate dehydrogenase flavoprotein subunit [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 613 Back     alignment and organism information
>gi|209551262|ref|YP_002283179.1| succinate dehydrogenase flavoprotein subunit [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 613 Back     alignment and organism information
>gi|190893744|ref|YP_001980286.1| succinate dehydrogenase, flavoprotein subunit [Rhizobium etli CIAT 652] Length = 613 Back     alignment and organism information
>gi|222150046|ref|YP_002551003.1| succinate dehydrogenase flavoprotein subunit [Agrobacterium vitis S4] Length = 618 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target611 succinate dehydrogenase flavoprotein subunit [Candidatu
COG1053562 COG1053, SdhA, Succinate dehydrogenase/fumarate reducta 0.0
PRK09078598 PRK09078, sdhA, succinate dehydrogenase flavoprotein su 0.0
PTZ00139617 PTZ00139, PTZ00139, Succinate dehydrogenase [ubiquinone 0.0
PLN00128635 PLN00128, PLN00128, Succinate dehydrogenase [ubiquinone 0.0
TIGR01816565 TIGR01816, sdhA_forward, succinate dehydrogenase, flavo 0.0
TIGR01812566 TIGR01812, sdhA_frdA_Gneg, succinate dehydrogenase or f 0.0
PRK08205583 PRK08205, sdhA, succinate dehydrogenase flavoprotein su 0.0
PRK07057591 PRK07057, sdhA, succinate dehydrogenase flavoprotein su 0.0
PRK08958588 PRK08958, sdhA, succinate dehydrogenase flavoprotein su 0.0
PRK05675570 PRK05675, sdhA, succinate dehydrogenase flavoprotein su 0.0
PRK06069577 PRK06069, sdhA, succinate dehydrogenase flavoprotein su 1e-165
PRK05945575 PRK05945, sdhA, succinate dehydrogenase flavoprotein su 1e-160
PRK09231582 PRK09231, PRK09231, fumarate reductase flavoprotein sub 1e-137
PRK06452566 PRK06452, sdhA, succinate dehydrogenase flavoprotein su 1e-131
TIGR01176580 TIGR01176, fum_red_Fp, fumarate reductase, flavoprotein 1e-126
PRK08626657 PRK08626, PRK08626, fumarate reductase flavoprotein sub 1e-113
PRK07803626 PRK07803, sdhA, succinate dehydrogenase flavoprotein su 1e-103
COG0029518 COG0029, NadB, Aspartate oxidase [Coenzyme metabolism] 1e-102
PRK08071510 PRK08071, PRK08071, L-aspartate oxidase; Provisional 2e-85
PRK07395553 PRK07395, PRK07395, L-aspartate oxidase; Provisional 4e-84
PRK07804541 PRK07804, PRK07804, L-aspartate oxidase; Provisional 2e-76
PRK08641589 PRK08641, sdhA, succinate dehydrogenase flavoprotein su 5e-76
TIGR01811603 TIGR01811, sdhA_Bsu, succinate dehydrogenase or fumarat 3e-72
PRK07573640 PRK07573, sdhA, succinate dehydrogenase flavoprotein su 2e-51
PRK08275554 PRK08275, PRK08275, putative oxidoreductase; Provisiona 6e-20
PRK06854608 PRK06854, PRK06854, adenylylsulfate reductase subunit a 2e-14
PRK13800 897 PRK13800, PRK13800, putative oxidoreductase/HEAT repeat 2e-11
TIGR02061614 TIGR02061, aprA, adenosine phosphosulphate reductase, a 2e-10
KOG2403642 KOG2403, KOG2403, KOG2403, Succinate dehydrogenase, fla 0.0
PRK06263543 PRK06263, sdhA, succinate dehydrogenase flavoprotein su 1e-107
TIGR00551488 TIGR00551, nadB, L-aspartate oxidase 5e-91
PLN02815594 PLN02815, PLN02815, L-aspartate oxidase 4e-84
PRK09077536 PRK09077, PRK09077, L-aspartate oxidase; Provisional 7e-83
PRK07512513 PRK07512, PRK07512, L-aspartate oxidase; Provisional 4e-72
PRK08401466 PRK08401, PRK08401, L-aspartate oxidase; Provisional 2e-56
pfam00890401 pfam00890, FAD_binding_2, FAD binding domain 1e-106
TIGR01813439 TIGR01813, flavo_cyto_c, flavocytochrome c 1e-40
PRK06481506 PRK06481, PRK06481, fumarate reductase flavoprotein sub 5e-32
KOG2404477 KOG2404, KOG2404, KOG2404, Fumarate reductase, flavopro 7e-28
PRK06175433 PRK06175, PRK06175, L-aspartate oxidase; Provisional 2e-69
pfam02910127 pfam02910, Succ_DH_flav_C, domain 5e-42
PTZ00306 1167 PTZ00306, PTZ00306, NADH-dependent fumarate reductase; 1e-11
PTZ003061167 PTZ00306, PTZ00306, NADH-dependent fumarate reductase; 3e-09
COG0445621 COG0445, GidA, NAD/FAD-utilizing enzyme apparently invo 2e-07
TIGR00136617 TIGR00136, gidA, glucose-inhibited division protein A 2e-06
pfam01134391 pfam01134, GIDA, Glucose inhibited division protein A 3e-06
COG0665387 COG0665, DadA, Glycine/D-amino acid oxidases (deaminati 0.001
pfam01266309 pfam01266, DAO, FAD dependent oxidoreductase 0.002
KOG1335506 KOG1335, KOG1335, KOG1335, Dihydrolipoamide dehydrogena 6e-05
PRK05192618 PRK05192, PRK05192, tRNA uridine 5-carboxymethylaminome 4e-04
PRK07494388 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl hydrox 7e-04
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy p 0.001
PRK07843557 PRK07843, PRK07843, 3-ketosteroid-delta-1-dehydrogenase 0.001
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase com 0.002
PRK06327475 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Val 0.003
PRK12844557 PRK12844, PRK12844, 3-ketosteroid-delta-1-dehydrogenase 0.003
PRK07121492 PRK07121, PRK07121, hypothetical protein; Validated 0.003
>gnl|CDD|31253 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|181641 PRK09078, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|185473 PTZ00139, PTZ00139, Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>gnl|CDD|177739 PLN00128, PLN00128, Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>gnl|CDD|130875 TIGR01816, sdhA_forward, succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>gnl|CDD|162542 TIGR01812, sdhA_frdA_Gneg, succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>gnl|CDD|181289 PRK08205, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|180814 PRK07057, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181594 PRK08958, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|180193 PRK05675, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|180382 PRK06069, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|180319 PRK05945, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181714 PRK09231, PRK09231, fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>gnl|CDD|180567 PRK06452, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|162238 TIGR01176, fum_red_Fp, fumarate reductase, flavoprotein subunit Back     alignment and domain information
>gnl|CDD|181507 PRK08626, PRK08626, fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>gnl|CDD|181124 PRK07803, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|30379 COG0029, NadB, Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|181220 PRK08071, PRK08071, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|180957 PRK07395, PRK07395, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|181125 PRK07804, PRK07804, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|181516 PRK08641, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|130870 TIGR01811, sdhA_Bsu, succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>gnl|CDD|181040 PRK07573, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181346 PRK08275, PRK08275, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|180733 PRK06854, PRK06854, adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|184334 PRK13800, PRK13800, putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|162677 TIGR02061, aprA, adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>gnl|CDD|37614 KOG2403, KOG2403, KOG2403, Succinate dehydrogenase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|180495 PRK06263, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|161923 TIGR00551, nadB, L-aspartate oxidase Back     alignment and domain information
>gnl|CDD|178411 PLN02815, PLN02815, L-aspartate oxidase Back     alignment and domain information
>gnl|CDD|181640 PRK09077, PRK09077, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|181010 PRK07512, PRK07512, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|181412 PRK08401, PRK08401, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|144475 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|162543 TIGR01813, flavo_cyto_c, flavocytochrome c Back     alignment and domain information
>gnl|CDD|180584 PRK06481, PRK06481, fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>gnl|CDD|37615 KOG2404, KOG2404, KOG2404, Fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|180442 PRK06175, PRK06175, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|145850 pfam02910, Succ_DH_flav_C, domain Back     alignment and domain information
>gnl|CDD|140327 PTZ00306, PTZ00306, NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>gnl|CDD|140327 PTZ00306, PTZ00306, NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>gnl|CDD|30794 COG0445, GidA, NAD/FAD-utilizing enzyme apparently involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|129242 TIGR00136, gidA, glucose-inhibited division protein A Back     alignment and domain information
>gnl|CDD|144651 pfam01134, GIDA, Glucose inhibited division protein A Back     alignment and domain information
>gnl|CDD|31009 COG0665, DadA, Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|144747 pfam01266, DAO, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|36549 KOG1335, KOG1335, KOG1335, Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|179960 PRK05192, PRK05192, tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>gnl|CDD|181001 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|30989 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|181140 PRK07843, PRK07843, 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|31441 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|180529 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|183787 PRK12844, PRK12844, 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180854 PRK07121, PRK07121, hypothetical protein; Validated Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 611 succinate dehydrogenase flavoprotein subunit [Candidatu
TIGR01812636 sdhA_frdA_Gneg succinate dehydrogenase or fumarate redu 100.0
TIGR01816615 sdhA_forward succinate dehydrogenase, flavoprotein subu 100.0
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; Revi 100.0
PTZ00139622 succinate dehydrogenase (flavoprotein) subunit; Provisi 100.0
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; Revi 100.0
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; Revi 100.0
PRK08626657 fumarate reductase flavoprotein subunit; Provisional 100.0
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; Revi 100.0
PRK05675570 sdhA succinate dehydrogenase flavoprotein subunit; Revi 100.0
PRK07573638 sdhA succinate dehydrogenase flavoprotein subunit; Revi 100.0
PRK09231582 fumarate reductase flavoprotein subunit; Validated 100.0
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; Revi 100.0
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; Revi 100.0
PRK06069582 sdhA succinate dehydrogenase flavoprotein subunit; Revi 100.0
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; Revi 100.0
TIGR01176585 fum_red_Fp fumarate reductase, flavoprotein subunit; In 100.0
PRK07803631 sdhA succinate dehydrogenase flavoprotein subunit; Revi 100.0
PRK07395556 L-aspartate oxidase; Provisional 100.0
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, flavop 100.0
PRK07804533 L-aspartate oxidase; Provisional 100.0
KOG2403642 consensus 100.0
PRK08275554 putative oxidoreductase; Provisional 100.0
TIGR01811620 sdhA_Bsu succinate dehydrogenase or fumarate reductase, 100.0
PRK06854610 adenylylsulfate reductase; Validated 100.0
PRK13800 894 putative oxidoreductase/HEAT repeat-containing protein; 100.0
TIGR02061651 aprA adenylylsulfate reductase, alpha subunit; InterPro 100.0
PRK06263539 sdhA succinate dehydrogenase flavoprotein subunit; Revi 100.0
PRK09077535 L-aspartate oxidase; Provisional 100.0
TIGR00551546 nadB L-aspartate oxidase; InterPro: IPR005288 L-asparta 100.0
PRK07512507 L-aspartate oxidase; Provisional 100.0
PRK08071510 L-aspartate oxidase; Provisional 100.0
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 100.0
PRK08401464 L-aspartate oxidase; Provisional 100.0
PRK06175433 L-aspartate oxidase; Provisional 100.0
TIGR02023408 BchP-ChlP geranylgeranyl reductase; InterPro: IPR010253 98.02
PTZ003061167 NADH-dependent fumarate reductase; Provisional 100.0
TIGR01813487 flavo_cyto_c flavocytochrome c; InterPro: IPR010960 Thi 100.0
PRK06481506 fumarate reductase flavoprotein subunit; Validated 100.0
pfam00890401 FAD_binding_2 FAD binding domain. This family includes 100.0
PRK07121491 hypothetical protein; Validated 100.0
PRK08274456 tricarballylate dehydrogenase; Validated 100.0
PRK12844552 3-ketosteroid-delta-1-dehydrogenase; Reviewed 100.0
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 100.0
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 100.0
PRK12845566 3-ketosteroid-delta-1-dehydrogenase; Reviewed 100.0
PRK12839574 hypothetical protein; Provisional 100.0
PRK12843576 putative FAD-binding dehydrogenase; Reviewed 100.0
PRK12837515 3-ketosteroid-delta-1-dehydrogenase; Provisional 100.0
PRK07843560 3-ketosteroid-delta-1-dehydrogenase; Reviewed 100.0
PRK12842567 putative succinate dehydrogenase; Reviewed 100.0
KOG2404477 consensus 100.0
PRK06134579 putative FAD-binding dehydrogenase; Reviewed 100.0
TIGR02485467 CobZ_N-term precorrin 3B synthase CobZ; InterPro: IPR01 100.0
pfam03486405 HI0933_like HI0933-like protein. 99.97
COG3573552 Predicted oxidoreductase [General function prediction o 99.97
COG2081408 Predicted flavoproteins [General function prediction on 99.96
KOG2403642 consensus 99.53
TIGR02053494 MerA mercuric reductase; InterPro: IPR011796 This entry 99.32
TIGR01790419 carotene-cycl lycopene cyclase family protein; InterPro 98.81
TIGR01318480 gltD_gamma_fam glutamate synthase, small subunit; Inter 98.54
KOG0404322 consensus 97.59
TIGR01789392 lycopene_cycl lycopene cyclase; InterPro: IPR008461 Thi 96.98
pfam02910127 Succ_DH_flav_C domain. This family contains fumarate re 100.0
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. This enz 99.69
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductase F s 99.67
PRK11101545 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; P 99.66
PRK10157428 putative oxidoreductase FixC; Provisional 99.66
PRK12266503 glpD glycerol-3-phosphate dehydrogenase; Reviewed 99.6
pfam01266309 DAO FAD dependent oxidoreductase. This family includes 99.6
PRK10015429 hypothetical protein; Provisional 99.6
PRK07845467 flavoprotein disulfide reductase; Reviewed 99.59
PRK13369503 glycerol-3-phosphate dehydrogenase; Provisional 99.58
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreductase. T 99.57
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.57
KOG0042680 consensus 99.56
PRK11259377 solA N-methyltryptophan oxidase; Provisional 99.55
pfam01946229 Thi4 Thi4 family. This family includes a putative thiam 99.53
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy product 99.52
PRK12409410 D-amino acid dehydrogenase small subunit; Provisional 99.51
PRK00711416 D-amino acid dehydrogenase small subunit; Validated 99.44
COG0492305 TrxB Thioredoxin reductase [Posttranslational modificat 99.42
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy production 99.41
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRP 99.41
PRK05192621 tRNA uridine 5-carboxymethylaminomethyl modification en 99.37
TIGR02352357 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727 99.31
pfam01134391 GIDA Glucose inhibited division protein A. 99.31
PRK11728400 hypothetical protein; Provisional 99.31
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR03364. T 99.31
PRK06467472 dihydrolipoamide dehydrogenase; Reviewed 99.29
COG0579429 Predicted dehydrogenase [General function prediction on 99.27
PRK06185409 hypothetical protein; Provisional 99.25
KOG2415621 consensus 99.24
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [Amino 99.22
pfam01494349 FAD_binding_3 FAD binding domain. This domain is involv 99.21
TIGR01350481 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: 99.2
PRK01747660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 99.2
COG0445621 GidA Flavin-dependent tRNA uridine 5-carboxymethylamino 99.18
PRK09564443 coenzyme A disulfide reductase; Reviewed 99.17
PRK06126545 hypothetical protein; Provisional 99.15
PRK07364413 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 99.14
PRK06183554 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validat 99.14
PRK06184503 hypothetical protein; Provisional 99.14
PRK09126392 hypothetical protein; Provisional 99.12
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and relat 99.11
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 99.09
PRK08774402 consensus 99.07
PRK07608389 hypothetical protein; Provisional 99.05
PRK08244494 hypothetical protein; Provisional 99.05
TIGR02733499 desat_CrtD C-3',4' desaturase CrtD; InterPro: IPR014104 99.03
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.02
PRK06834488 hypothetical protein; Provisional 99.02
PRK08294634 phenol 2-monooxygenase; Provisional 99.0
TIGR02730506 carot_isom carotene isomerase; InterPro: IPR014101 Memb 99.0
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 98.99
PRK06475400 salicylate hydroxylase; Provisional 98.98
PRK08163396 salicylate hydroxylase; Provisional 98.97
PRK07190480 hypothetical protein; Provisional 98.96
PRK08132549 hypothetical protein; Provisional 98.95
PRK08013400 hypothetical protein; Provisional 98.93
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 98.92
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit [Post 98.9
TIGR01292321 TRX_reduct thioredoxin-disulfide reductase; InterPro: I 98.9
PRK10262321 thioredoxin reductase; Provisional 98.9
PRK07045388 putative monooxygenase; Reviewed 98.9
PRK07494386 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 98.89
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validated 98.87
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.87
PRK11445348 putative oxidoreductase; Provisional 98.85
PRK07538413 hypothetical protein; Provisional 98.84
pfam07992277 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreducta 98.84
PRK06996397 hypothetical protein; Provisional 98.84
KOG2311679 consensus 98.82
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 98.8
TIGR01438513 TGR thioredoxin and glutathione reductase; InterPro: IP 98.77
PRK06847375 hypothetical protein; Provisional 98.74
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 98.74
TIGR01988445 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/Ub 98.72
KOG1335506 consensus 98.69
PRK08948392 consensus 98.69
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 98.55
KOG2820399 consensus 98.54
TIGR01377401 soxA_mon sarcosine oxidase, monomeric form; InterPro: I 98.48
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.46
pfam06039489 Mqo Malate:quinone oxidoreductase (Mqo). This family co 98.46
PRK07588391 hypothetical protein; Provisional 98.43
KOG2853509 consensus 98.4
PRK05868372 hypothetical protein; Validated 98.32
KOG0405478 consensus 98.27
KOG2844 856 consensus 98.13
pfam00743532 FMO-like Flavin-binding monooxygenase-like. This family 98.11
PRK08255 770 salicylyl-CoA 5-hydroxylase; Reviewed 98.01
PRK05257499 malate:quinone oxidoreductase; Validated 97.97
TIGR01984425 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase; InterP 97.94
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [General fun 97.71
PRK09897535 hypothetical protein; Provisional 97.65
KOG2665453 consensus 97.51
KOG1399448 consensus 97.51
TIGR01320487 mal_quin_oxido malate:quinone-oxidoreductase; InterPro: 97.43
KOG2852380 consensus 97.06
TIGR02360393 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase; Inter 96.25
TIGR02731454 phytoene_desat phytoene desaturase; InterPro: IPR014102 95.44
PRK06370459 mercuric reductase; Validated 99.61
PRK05976464 dihydrolipoamide dehydrogenase; Validated 99.54
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 99.54
TIGR01372 1026 soxA sarcosine oxidase, alpha subunit family; InterPro: 99.54
PRK06292460 dihydrolipoamide dehydrogenase; Validated 99.52
PRK06116450 glutathione reductase; Validated 99.52
PRK06327475 dihydrolipoamide dehydrogenase; Validated 99.51
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihy 99.47
PRK07818467 dihydrolipoamide dehydrogenase; Reviewed 99.46
PRK13748561 putative mercuric reductase; Provisional 99.43
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 99.35
PRK12770350 putative glutamate synthase subunit beta; Provisional 99.34
PTZ00052541 thioredoxin reductase; Provisional 99.24
PRK05249465 soluble pyridine nucleotide transhydrogenase; Provision 99.2
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 99.07
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amin 99.01
KOG4716503 consensus 98.96
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 98.82
PRK07846453 mycothione/glutathione reductase; Reviewed 98.78
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a gluta 98.74
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Provision 98.7
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Provision 98.7
PTZ00153673 lipoamide dehydrogenase; Provisional 98.68
PRK07236386 hypothetical protein; Provisional 98.45
COG2072443 TrkA Predicted flavoprotein involved in K+ transport [I 98.43
PRK06753373 hypothetical protein; Provisional 98.35
COG1148622 HdrA Heterodisulfide reductase, subunit A and related p 98.19
PRK11883452 protoporphyrinogen oxidase; Reviewed 98.0
KOG0029501 consensus 97.99
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biogenesi 97.84
KOG2614420 consensus 97.81
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] 97.65
COG3349485 Uncharacterized conserved protein [Function unknown] 97.65
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Members of 97.64
COG1231450 Monoamine oxidase [Amino acid transport and metabolism] 97.62
COG4529474 Uncharacterized protein conserved in bacteria [Function 97.59
pfam05834374 Lycopene_cycl Lycopene cyclase protein. This family con 97.57
PRK04965378 nitric oxide reductase; Provisional 97.46
PRK12416466 protoporphyrinogen oxidase; Provisional 97.42
pfam00996439 GDI GDP dissociation inhibitor. 97.25
TIGR00137444 gid gid protein; InterPro: IPR004417 The gid proteins a 97.15
KOG0685498 consensus 97.14
TIGR00136630 gidA glucose-inhibited division protein A; InterPro: IP 97.09
TIGR01989481 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6; InterP 96.97
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 96.84
PRK11749460 putative oxidoreductase; Provisional 96.63
PRK12831464 putative oxidoreductase; Provisional 96.6
TIGR02374 813 nitri_red_nirB nitrite reductase [NAD(P)H], large subun 96.53
PRK12814652 putative NADPH-dependent glutamate synthase small subun 96.47
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2; Val 96.25
KOG1276491 consensus 96.24
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreduct 96.1
COG2907447 Predicted NAD/FAD-binding protein [General function pre 96.04
PTZ00318514 NADH dehydrogenase; Provisional 95.9
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases 95.79
COG0493457 GltD NADPH-dependent glutamate synthase beta chain and 95.74
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in tran 95.73
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 95.71
KOG0399 2142 consensus 95.48
pfam0007082 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 95.45
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [Energy 95.42
PTZ00188506 adrenodoxin reductase; Provisional 95.19
KOG1439440 consensus 95.06
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase; InterPro: IPR0 94.93
KOG4405547 consensus 94.75
KOG2755334 consensus 94.3
COG5044434 MRS6 RAB proteins geranylgeranyltransferase component A 93.97
KOG3855481 consensus 93.94
PRK13512438 coenzyme A disulfide reductase; Provisional 93.93
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 93.91
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary metabo 93.84
PRK02006501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.85
PRK00141476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.44
PRK01438481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.03
PRK05562222 precorrin-2 dehydrogenase; Provisional 91.76
pfam00743532 FMO-like Flavin-binding monooxygenase-like. This family 91.72
PRK02472450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.54
PRK06718202 precorrin-2 dehydrogenase; Reviewed 90.86
KOG3851446 consensus 90.69
PRK01390457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.63
TIGR02356210 adenyl_thiF thiazole biosynthesis adenylyltransferase T 90.59
PRK06719157 precorrin-2 dehydrogenase; Validated 90.56
PRK03369487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.55
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.4
KOG3923342 consensus 90.29
PRK05329425 anaerobic glycerol-3-phosphate dehydrogenase subunit B; 99.61
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, ana 99.61
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 99.02
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 98.99
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 98.95
PRK12778760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 98.88
PRK13984604 putative oxidoreductase; Provisional 98.82
TIGR01316462 gltA glutamate synthase (NADPH), homotetrameric; InterP 98.73
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 98.49
PRK098531032 putative selenate reductase subunit YgfK; Provisional 98.44
PRK12779944 putative bifunctional glutamate synthase subunit beta/2 97.67
TIGR00313502 cobQ cobyric acid synthase CobQ; InterPro: IPR004459 Co 94.41
PRK02106555 choline dehydrogenase; Validated 99.32
COG2509486 Uncharacterized FAD-dependent dehydrogenases [General f 99.22
PRK07233430 hypothetical protein; Provisional 99.09
TIGR03467430 HpnE squalene-associated FAD-dependent desaturase. The 99.04
PRK07208474 hypothetical protein; Provisional 98.99
COG1233487 Phytoene dehydrogenase and related proteins [Secondary 98.97
COG2303542 BetA Choline dehydrogenase and related flavoproteins [A 98.77
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, ana 98.69
PRK13512438 coenzyme A disulfide reductase; Provisional 98.69
KOG1238623 consensus 98.36
pfam01593444 Amino_oxidase Flavin containing amine oxidoreductase. T 98.28
KOG4254561 consensus 98.16
pfam04820457 Trp_halogenase Tryptophan halogenase. Tryptophan haloge 98.14
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine 98.02
TIGR02734526 crtI_fam phytoene desaturase; InterPro: IPR014105 Phyto 97.96
TIGR01810540 betA choline dehydrogenase; InterPro: IPR011533 Choline 97.79
pfam06100500 Strep_67kDa_ant Streptococcal 67 kDa myosin-cross-react 97.76
PRK13977577 myosin-cross-reactive antigen; Provisional 97.65
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 97.34
PRK07818467 dihydrolipoamide dehydrogenase; Reviewed 97.3
PRK05976464 dihydrolipoamide dehydrogenase; Validated 97.26
PRK12775993 putative trifunctional 2-polyprenylphenol hydroxylase/g 97.1
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.08
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.06
PRK06116450 glutathione reductase; Validated 97.04
PRK05249465 soluble pyridine nucleotide transhydrogenase; Provision 96.72
pfam00732218 GMC_oxred_N GMC oxidoreductase. This family of proteins 96.37
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 95.72
COG2072443 TrkA Predicted flavoprotein involved in K+ transport [I 95.33
TIGR02374 813 nitri_red_nirB nitrite reductase [NAD(P)H], large subun 95.21
PRK04965378 nitric oxide reductase; Provisional 95.18
KOG1336478 consensus 93.2
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Provision 92.08
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Provision 90.84
TIGR02032343 GG-red-SF geranylgeranyl reductase family; InterPro: IP 99.3
KOG1298509 consensus 98.87
TIGR01373407 soxB sarcosine oxidase, beta subunit family; InterPro: 98.87
TIGR00275411 TIGR00275 conserved hypothetical protein TIGR00275; Int 97.84
TIGR01317517 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small sub 97.81
TIGR01423486 trypano_reduc trypanothione-disulfide reductase; InterP 97.05
TIGR02028401 ChlP geranylgeranyl reductase; InterPro: IPR011774 This 95.17
TIGR00292283 TIGR00292 thiazole biosynthesis enzyme; InterPro: IPR00 99.24
KOG2960328 consensus 97.94
TIGR01424478 gluta_reduc_2 glutathione-disulfide reductase; InterPro 99.0
TIGR01421475 gluta_reduc_1 glutathione-disulfide reductase; InterPro 98.53
PRK12831464 putative oxidoreductase; Provisional 98.99
PRK11749460 putative oxidoreductase; Provisional 98.94
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 98.93
PRK12814652 putative NADPH-dependent glutamate synthase small subun 98.68
PRK12775993 putative trifunctional 2-polyprenylphenol hydroxylase/g 98.64
PRK05335434 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 97.86
PRK09564443 coenzyme A disulfide reductase; Reviewed 97.15
PRK06370459 mercuric reductase; Validated 96.95
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. This enz 96.93
PRK10262321 thioredoxin reductase; Provisional 96.9
PRK06327475 dihydrolipoamide dehydrogenase; Validated 96.84
PRK06292460 dihydrolipoamide dehydrogenase; Validated 96.78
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 96.56
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 96.51
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 96.49
TIGR01350481 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: 96.43
PRK07845467 flavoprotein disulfide reductase; Reviewed 96.36
TIGR01292321 TRX_reduct thioredoxin-disulfide reductase; InterPro: I 96.31
TIGR01316462 gltA glutamate synthase (NADPH), homotetrameric; InterP 96.26
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 96.24
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 95.78
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductase F s 95.78
PRK098531032 putative selenate reductase subunit YgfK; Provisional 95.69
PRK13748561 putative mercuric reductase; Provisional 95.55
PRK12779 944 putative bifunctional glutamate synthase subunit beta/2 95.22
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 94.67
PRK13984604 putative oxidoreductase; Provisional 94.18
TIGR00292283 TIGR00292 thiazole biosynthesis enzyme; InterPro: IPR00 92.63
PRK06467472 dihydrolipoamide dehydrogenase; Reviewed 91.98
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a gluta 91.64
PRK07846453 mycothione/glutathione reductase; Reviewed 91.52
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRP 90.13
TIGR00031390 UDP-GALP_mutase UDP-galactopyranose mutase; InterPro: I 98.11
PRK12778 760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 96.15
KOG1800468 consensus 95.3
TIGR01318480 gltD_gamma_fam glutamate synthase, small subunit; Inter 95.1
PRK09424510 pntA NAD(P) transhydrogenase subunit alpha; Provisional 94.85
pfam07992277 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreducta 92.05
TIGR00692341 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627 L- 94.76
TIGR00507286 aroE shikimate 5-dehydrogenase; InterPro: IPR011342 The 90.35
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunit; InterPro: IPR014006 Succinate:quinone oxidoreductase (1 Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit; InterPro: IPR011281 Succinate dehydrogenase and fumarate reductase are homologous enzymes reversible in principle but favoured under different circumstances Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00139 succinate dehydrogenase (flavoprotein) subunit; Provisional Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit; InterPro: IPR005884 In bacteria two distinct, membrane-bound, enzyme complexes are responsible for the interconversion of fumarate and succinate (1 Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG2403 consensus Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit; InterPro: IPR011280 This entry represents the succinate dehydrogenase flavoprotein subunit as found in the low-GC Gram-positive bacteria and a few other lineages Back     alignment and domain information
>PRK06854 adenylylsulfate reductase; Validated Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information