254781049

254781049

succinyl-CoA synthetase subunit beta

GeneID in NCBI database:8210072Locus tag:CLIBASIA_04755
Protein GI in NCBI database:254781049Protein Accession:YP_003065462.1
Gene range:+(1050723, 1051919)Protein Length:398aa
Gene description:succinyl-CoA synthetase subunit beta
COG prediction:[C] Succinyl-CoA synthetase, beta subunit
KEGG prediction:sucC; succinyl-CoA synthetase subunit beta (EC:6.2.1.5); K01903 succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
SEED prediction:Succinyl-CoA ligase [ADP-forming] beta chain (EC 6.2.1.5)
Pathway involved in KEGG:Citrate cycle (TCA cycle) [PATH:las00020]
Propanoate metabolism [PATH:las00640]
C5-Branched dibasic acid metabolism
Subsystem involved in SEED:TCA Cycle
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------40
MNIHEYQAKALLRKYNVPVAKGVVISSVHAAESAIKTLPGPLYVVKSQIHAGGRGKGRFKELPADSKGGVRVESSLKSVISDIREILGSTLITKQTGPTGSRVNCVYVEDGADILRELYLSLLVDRTSGMVAFIASTQGGMDIEEVAKDYPQKIFKLLIDPLIGVTSEDVASLCDMLELQGQARIDGGDLFPNLYKAFCDKDMSLLEINPLIIMKNGRLRVLDSKISFDDNALYRHLDIQELRDVSEEDSREIEAKQHNLSYIALDGNIGCMVNGAGLAMATMDIIKLYGGAPANFLDVGGGADQDKVAAAFKIITSDSSVKGILINIFGGIMRCDVLVKGILSAVKEVKINIPLVMRLEGANVDIGNRLIAESGLNVITAIDLDDAAQKIVHAVKGV
ccccHHHHHHHHHHccccccccEEEccHHHHHHHHHHHcccEEEEEHHHcccccccccccccccccccEEEEEccHHHHHHHHHHHHccccccccccccccEEEEEEEEccccccEEEEEEEEEccccccEEEEEEccccccHHHHHHHcHHHcEEEEccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccEEEEccEEEcccccEEEEEEEEEEcccccccccccHHccccccccHHHHHHHHcccEEEEEccEEEEEEccHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHccccccEEEEEEEccHHHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHcc
cEccHHHHHHHHHHcccccccEEEEccHHHHHHHHHHHccccEEEEEccccccccccEEcccccccEccEEEEccHHHHHHHHHHHcccEEcccccccccEEcccEEEEEcccEEEEEEEEEEEEccccEEEEEEEccccccHHHHHHccHHHcEEEEEcccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEEEccccEEEcccccEEcHHHHHHcHHHHHHccHHHccHHHHHHHcccEEEEEccccEEEEEccHHHHHHHHHHHHHccccEcEEEEEcccccHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHcccEEEcccHHHHHHHHHHHHHcc
MNIHEYQAKALLRKYNVPVAKGVVISSVHAAESaiktlpgplyvvksqihaggrgkgrfkelpadskggvrveSSLKSVISDIREILGStlitkqtgptgsrvncvyvEDGADILRELYLSLLVDRTSGMVAFIAStqggmdieEVAKDYPQKIFKLLIdpligvtseDVASLCDMLELqgqaridggdlfpnlykafcdkdmslleinpliimkngrlrvldskisfddnalyrhLDIQELRDVSEEDSREIEAKQHNLsyialdgnigcmvngagLAMATMDIIKLyggapanfldvgggadqDKVAAAFKIITSDSSVKGILINIFGGIMRCDVLVKGILSAVKEVKINIplvmrleganvdiGNRLIAESGLnvitaidlddAAQKIVHAVKGV
MNIHEYQAKALLRKYNVPVAKGVVISSVHAAESaiktlpgplyVVKSQihaggrgkgrfkelpadskggvrvesslKSVISDIREILGstlitkqtgptgsrvNCVYVEDGADILRELYLSLLVDRTSGMVAFIASTQGGMDIEEVAKDYPQKIFKLLIDPLIGVTSEDVASLCDMLELQGQARIDGGDLFPNLYKAFCDKDMSLLEINPLIIMKNGRLRVLDSKISFDDNALYRHLDIQELRDVSEEDSREIEAKQHNLSYIALDGNIGCMVNGAGLAMATMDIIKLYGGAPANFLDVGGGADQDKVAAAFkiitsdssvkGILINIFGGIMRCDVLVKGILSAVKEVkiniplvmrlegANVDIGNRLIAESGLNVITAIDLDDAAQKIVHAVKGV
MNIHEYQAKALLRKYNVPVAKGVVISSVHAAESAIKTLPGPLYVVKSQIHAGGRGKGRFKELPADSKGGVRVESSLKSVISDIREILGSTLITKQTGPTGSRVNCVYVEDGADILRELYLSLLVDRTSGMVAFIASTQGGMDIEEVAKDYPQKIFKLLIDPLIGVTSEDVASLCDMLELQGQARIDGGDLFPNLYKAFCDKDMSLLEINPLIIMKNGRLRVLDSKISFDDNALYRHLDIQELRDVSEEDSREIEAKQHNLSYIALDGNIGCMVNGAGLAMATMDIIKLYGGAPANFLDVGGGADQDKVAAAFKIITSDSSVKGILINIFGGIMRCDVLVKGILSAVKEVKINIPLVMRLEGANVDIGNRLIAESGLNVITAIDLDDAAQKIVHAVKGV
MNIHEYQAKALLRKYNVPVAKGVVISSVHAAESAIKTLPGPLYVVKSQIHAGGRGKGRFKELPADSKGGVRVESSLKSVISDIREILGSTLITKQTGPTGSRVNCVYVEDGADILRELYLSLLVDRTSGMVAFIASTQGGMDIEEVAKDYPQKIFKLLIDPLIGVTSEDVASLCDMLELQGQARIDGGDLFPNLYKAFCDKDMSLLEINPLIIMKNGRLRVLDSKISFDDNALYRHLDIQELRDVSEEDSREIEAKQHNLSYIALDGNIGCMVNGAGLAMATMDIIKLYGGAPANFLDVGGGADQDKVAAAFKIITSDSSVKGILINIFGGIMRCDVLVKGILSAVKEVKINIPLVMRLEGANVDIGNRLIAESGLNVITAIDLDDAAQKIVHAVKGV
MNIHEYQAKALLRKYNVPVAKGVVISSVHAAESAIKTLPGPLYVVKSQIHAGGRGKGRFKELPADSKGGVRVESSLKSVISDIREILGSTLITKQTGPTGSRVNCVYVEDGADILRELYLSLLVDRTSGMVAFIASTQGGMDIEEVAKDYPQKIFKLLIDPLIGVTSEDVASLCDMLELQGQARIDGGDLFPNLYKAFCDKDMSLLEINPLIIMKNGRLRVLDSKISFDDNALYRHLDIQELR*********IEAKQHNLSYIALDGNIGCMVNGAGLAMATMDIIKLYGGAPANFLDVGGGADQDKVAAAFKIITSDSSVKGILINIFGGIMRCDVLVKGILSAVKEVKINIPLVMRLEGANVDIGNRLIAESGLNVITAIDLDDAAQKIVHAVKGV
MNIHEYQAKALLRKYNVPVAKGVVISSVHAAESAIKTLPGPLYVVKSQIHAGGRGKGRFKELPADSKGGVRVESSLKSVISDIREILGSTLITKQTGPTGSRVNCVYVEDGADILRELYLSLLVDRTSGMVAFIASTQGGMDIEEVAKDYPQKIFKLLIDPLIGVTSEDVASLCDMLELQGQARIDGGDLFPNLYKAFCDKDMSLLEINPLIIMKNGRLRVLDSKISFDDNALYRHLDIQELRDVSEEDSREIEAKQHNLSYIALDGNIGCMVNGAGLAMATMDIIKLYGGAPANFLDVGGGADQDKVAAAFKIITSDSSVKGILINIFGGIMRCDVLVKGILSAVKEVKINIPLVMRLEGANVDIGNRLIAESGLNVITAIDLDDAAQKIVHAVKGV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNIHEYQAKALLRKYNVPVAKGVVISSVHAAESAIKTLPGPLYVVKSQIHAGGRGKGRFKELPADSKGGVRVESSLKSVISDIREILGSTLITKQTGPTGSRVNCVYVEDGADILRELYLSLLVDRTSGMVAFIASTQGGMDIEEVAKDYPQKIFKLLIDPLIGVTSEDVASLCDMLELQGQARIDGGDLFPNLYKAFCDKDMSLLEINPLIIMKNGRLRVLDSKISFDDNALYRHLDxxxxxxxxxxxxxxxxxxxxxLSYIALDGNIGCMVNGAGLAMATMDIIKLYGGAPANFLDVGGGADQDKVAAAFKIITSDSSVKGILINIFGGIMRCDVLVKGILSAVKEVKINIPLVMRLEGANVDIGNRLIAESGLNVITAIDLDDAAQKIVHAVKGV
MNIHEYQAKALLRKYNVPVAKGVVISSVHAAESAIKTLPGPLYVVKSQIHAGGRGKGRFKELPADSKGGVRVESSLKSVISDIREILGSTLITKQTGPTGSRVNCVYVEDGADILRELYLSLLVDRTSGMVAFIASTQGGMDIEEVAKDYPQKIFKLLIDPLIGVTSEDVASLCDMLELQGQARIDGGDLFPNLYKAFCDKDMSLLEINPLIIMKNGRLRVLDSKISFDDNALYRHLDIQELRDVSEEDSREIEAKQHNLSYIALDGNIGCMVNGAGLAMATMDIIKLYGGAPANFLDVGGGADQDKVAAAFKIITSDSSVKGILINIFGGIMRCDVLVKGILSAVKEVKINIPLVMRLEGANVDIGNRLIAESGLNVITAIDLDDAAQKIVHAVKGV
MNIHEYQAKALLRKYNVPVAKGVVISSVHAAESAIKTLPGPLYVVKSQIHAGGRGKGRFKELPADSKGGVRVESSLKSVISDIREILGSTLITKQTGPTGSRVNCVYVEDGADILRELYLSLLVDRTSGMVAFIASTQGGMDIEEVAKDYPQKIFKLLIDPLIGVTSEDVASLCDMLELQGQARIDGGDLFPNLYKAFCDKDMSLLEINPLIIMKNGRLRVLDSKISFDDNALYRHLDIQELRDVSEEDSREIEAKQHNLSYIALDGNIGCMVNGAGLAMATMDIIKLYGGAPANFLDVGGGADQDKVAAAFKIITSDSSVKGILINIFGGIMRCDVLVKGILSAVKEVKINIPLVMRLEGANVDIGNRLIAESGLNVITAIDLDDAAQKIVHAVKGV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target398 succinyl-CoA synthetase subunit beta [Candidatus Liberi
315122387398 succinyl-CoA synthetase subunit beta [Candidatus Liberi 1 0.0
319404899398 succinyl-CoA synthetase, beta chain [Bartonella rochali 1 1e-165
319407858398 succinyl-CoA synthetase, beta chain [Bartonella sp. 1-1 1 1e-165
153008266398 succinyl-CoA synthetase subunit beta [Ochrobactrum anth 1 1e-163
239833053432 succinyl-CoA synthetase, beta subunit [Ochrobactrum int 1 1e-163
319406382398 succinyl-CoA synthetase, beta chain [Bartonella sp. AR 1 1e-163
319899504398 succinyl-CoA synthetase, beta chain [Bartonella clarrid 1 1e-162
254717987398 succinyl-CoA synthetase subunit beta [Brucella sp. 83/1 1 1e-161
240851388398 succinyl-CoA synthetase subunit beta [Bartonella graham 1 1e-161
17986422398 succinyl-CoA synthetase subunit beta [Brucella melitens 1 1e-160
>gi|315122387|ref|YP_004062876.1| succinyl-CoA synthetase subunit beta [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 398 Back     alignment and organism information
 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/398 (82%), Positives = 366/398 (91%)

Query: 1   MNIHEYQAKALLRKYNVPVAKGVVISSVHAAESAIKTLPGPLYVVKSQIHAGGRGKGRFK 60
           M+IHEYQAKALL++Y +PVA+GVV+SS+H A+SAIKTLPG LYVVKSQIHAGGRGKGRF+
Sbjct: 1   MDIHEYQAKALLKRYGIPVAEGVVVSSIHEADSAIKTLPGGLYVVKSQIHAGGRGKGRFR 60

Query: 61  ELPADSKGGVRVESSLKSVISDIREILGSTLITKQTGPTGSRVNCVYVEDGADILRELYL 120
            LPA+S+GGVR+E S++ V+SD+RE+LGS L+TKQTGP GS+VNC+Y+EDGADIL+ELYL
Sbjct: 61  GLPANSRGGVRLEKSIEGVLSDVREMLGSILVTKQTGPAGSKVNCLYIEDGADILKELYL 120

Query: 121 SLLVDRTSGMVAFIASTQGGMDIEEVAKDYPQKIFKLLIDPLIGVTSEDVASLCDMLELQ 180
           SLLVDR SG + F+ASTQGGMDIEEVAKDYPQKIFKL ID L+GVT +D+ +LCDMLEL+
Sbjct: 121 SLLVDRVSGKITFVASTQGGMDIEEVAKDYPQKIFKLPIDSLVGVTPKDIGNLCDMLELK 180

Query: 181 GQARIDGGDLFPNLYKAFCDKDMSLLEINPLIIMKNGRLRVLDSKISFDDNALYRHLDIQ 240
           GQARID   LFPNLYKAFCDKDMSLLEINPLIIM+NGRLRVLDSK+SFDDNALYR LDIQ
Sbjct: 181 GQARIDAESLFPNLYKAFCDKDMSLLEINPLIIMQNGRLRVLDSKVSFDDNALYRQLDIQ 240

Query: 241 ELRDVSEEDSREIEAKQHNLSYIALDGNIGCMVNGAGLAMATMDIIKLYGGAPANFLDVG 300
           EL D SEED REIEA++H LSYI LDGNIGCMVNGAGLAMATMDIIKLYGG PANFLDVG
Sbjct: 241 ELHDDSEEDVREIEARKHGLSYITLDGNIGCMVNGAGLAMATMDIIKLYGGEPANFLDVG 300

Query: 301 GGADQDKVAAAFKIITSDSSVKGILINIFGGIMRCDVLVKGILSAVKEVKINIPLVMRLE 360
           GG DQDKVAAAFKII  DSSVKGILINIFGGI+RCDVLVKGILSAVK+V +NIPLVMRLE
Sbjct: 301 GGTDQDKVAAAFKIIMLDSSVKGILINIFGGIVRCDVLVKGILSAVKDVNVNIPLVMRLE 360

Query: 361 GANVDIGNRLIAESGLNVITAIDLDDAAQKIVHAVKGV 398
           GA VDIGN+LI ESGLNVITAIDLDDAAQKIV AVKGV
Sbjct: 361 GAKVDIGNQLIVESGLNVITAIDLDDAAQKIVRAVKGV 398


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|319404899|emb|CBI78500.1| succinyl-CoA synthetase, beta chain [Bartonella rochalimae ATCC BAA-1498] Length = 398 Back     alignment and organism information
>gi|319407858|emb|CBI81511.1| succinyl-CoA synthetase, beta chain [Bartonella sp. 1-1C] Length = 398 Back     alignment and organism information
>gi|153008266|ref|YP_001369481.1| succinyl-CoA synthetase subunit beta [Ochrobactrum anthropi ATCC 49188] Length = 398 Back     alignment and organism information
>gi|239833053|ref|ZP_04681382.1| succinyl-CoA synthetase, beta subunit [Ochrobactrum intermedium LMG 3301] Length = 432 Back     alignment and organism information
>gi|319406382|emb|CBI80023.1| succinyl-CoA synthetase, beta chain [Bartonella sp. AR 15-3] Length = 398 Back     alignment and organism information
>gi|319899504|ref|YP_004159601.1| succinyl-CoA synthetase, beta chain [Bartonella clarridgeiae 73] Length = 398 Back     alignment and organism information
>gi|254717987|ref|ZP_05179798.1| succinyl-CoA synthetase subunit beta [Brucella sp. 83/13] Length = 398 Back     alignment and organism information
>gi|240851388|ref|YP_002972791.1| succinyl-CoA synthetase subunit beta [Bartonella grahamii as4aup] Length = 398 Back     alignment and organism information
>gi|17986422|ref|NP_539056.1| succinyl-CoA synthetase subunit beta [Brucella melitensis bv. 1 str. 16M] Length = 398 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target398 succinyl-CoA synthetase subunit beta [Candidatus Liberi
PRK00696388 PRK00696, sucC, succinyl-CoA synthetase subunit beta; P 1e-173
TIGR01016386 TIGR01016, sucCoAbeta, succinyl-CoA synthetase, beta su 1e-130
PRK14046392 PRK14046, PRK14046, malate--CoA ligase subunit beta; Pr 1e-122
PLN00124422 PLN00124, PLN00124, succinyl-CoA ligase [GDP-forming] s 1e-119
KOG1447412 KOG1447, KOG1447, KOG1447, GTP-specific succinyl-CoA sy 1e-103
KOG2799434 KOG2799, KOG2799, KOG2799, Succinyl-CoA synthetase, bet 6e-99
COG0045387 COG0045, SucC, Succinyl-CoA synthetase, beta subunit [E 1e-132
pfam08442202 pfam08442, ATP-grasp_2, ATP-grasp domain 4e-60
pfam00549128 pfam00549, Ligase_CoA, CoA-ligase 2e-26
PLN02235423 PLN02235, PLN02235, ATP citrate (pro-S)-lyase 8e-10
pfam01071193 pfam01071, GARS_A, Phosphoribosylglycinamide synthetase 0.004
>gnl|CDD|179088 PRK00696, sucC, succinyl-CoA synthetase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|162159 TIGR01016, sucCoAbeta, succinyl-CoA synthetase, beta subunit Back     alignment and domain information
>gnl|CDD|184474 PRK14046, PRK14046, malate--CoA ligase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|177736 PLN00124, PLN00124, succinyl-CoA ligase [GDP-forming] subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|36660 KOG1447, KOG1447, KOG1447, GTP-specific succinyl-CoA synthetase, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|38010 KOG2799, KOG2799, KOG2799, Succinyl-CoA synthetase, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|30394 COG0045, SucC, Succinyl-CoA synthetase, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|149489 pfam08442, ATP-grasp_2, ATP-grasp domain Back     alignment and domain information
>gnl|CDD|144220 pfam00549, Ligase_CoA, CoA-ligase Back     alignment and domain information
>gnl|CDD|177879 PLN02235, PLN02235, ATP citrate (pro-S)-lyase Back     alignment and domain information
>gnl|CDD|110097 pfam01071, GARS_A, Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 398 succinyl-CoA synthetase subunit beta [Candidatus Liberi
TIGR01016389 sucCoAbeta succinyl-CoA synthetase, beta subunit; Inter 100.0
PRK00696388 sucC succinyl-CoA synthetase subunit beta; Provisional 100.0
COG0045387 SucC Succinyl-CoA synthetase, beta subunit [Energy prod 100.0
KOG1447412 consensus 100.0
KOG2799434 consensus 100.0
COG1042 598 Acyl-CoA synthetase (NDP forming) [Energy production an 99.47
TIGR013691089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 98.78
PRK052941063 carB carbamoyl phosphate synthase large subunit; Review 98.45
PRK128151068 carB carbamoyl phosphate synthase large subunit; Review 98.42
pfam08442202 ATP-grasp_2 ATP-grasp domain. 100.0
PRK01372304 ddl D-alanine--D-alanine ligase; Reviewed 99.1
pfam07478201 Dala_Dala_lig_C D-ala D-ala ligase C-terminus. This fam 98.92
PRK01966344 ddl D-alanyl-alanine synthetase A; Reviewed 98.84
PRK08654497 pyruvate carboxylase subunit A; Validated 98.81
PRK07178471 acetyl-CoA carboxylase; Validated 98.8
TIGR01205375 D_ala_D_alaTIGR D-alanine--D-alanine ligase; InterPro: 98.55
TIGR01235 1169 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 97.75
pfam00549128 Ligase_CoA CoA-ligase. This family includes the CoA lig 99.95
pfam06263514 consensus 97.75
PRK06091555 membrane protein FdrA; Validated 97.48
PRK05678289 succinyl-CoA synthetase subunit alpha; Validated 97.4
PTZ00187309 succinyl-CoA synthetase alpha subunit; Provisional 97.34
cd01540289 PBP1_arabinose_binding Periplasmic L-arabinose-binding 96.02
cd07014177 S49_SppA Signal peptide peptidase A. Signal peptide pep 95.9
COG0074293 SucD Succinyl-CoA synthetase, alpha subunit [Energy pro 95.63
cd06287269 PBP1_LacI_like_8 Ligand-binding domain of uncharacteriz 95.6
cd06283267 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of DNA t 95.07
cd06300272 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-binding 95.07
pfam06263 514 consensus 95.04
cd06298268 PBP1_CcpA_like Ligand-binding domain of the catabolite 94.48
cd06284267 PBP1_LacI_like_6 Ligand-binding domain of an uncharacte 94.27
cd06285265 PBP1_LacI_like_7 Ligand-binding domain of uncharacteriz 94.11
PRK06091 555 membrane protein FdrA; Validated 94.1
cd06292273 PBP1_LacI_like_10 Ligand-binding domain of uncharacteri 93.75
cd06291265 PBP1_Qymf_like Ligand binding domain of the lacI-like t 93.64
PRK10401346 DNA-binding transcriptional regulator GalS; Provisional 93.42
cd06270268 PBP1_GalS_like Ligand binding domain of DNA transcripti 92.91
cd06273268 PBP1_GntR_like_1 This group includes the ligand-binding 92.78
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.54
PRK10423327 transcriptional repressor RbsR; Provisional 92.27
cd01537264 PBP1_Repressors_Sugar_Binding_like Ligand-binding domai 92.25
cd06286260 PBP1_CcpB_like Ligand-binding domain of a novel transcr 92.21
cd06294270 PBP1_ycjW_transcription_regulator_like Ligand-binding d 91.87
cd01575268 PBP1_GntR Ligand-binding domain of DNA transcription re 91.85
cd06295275 PBP1_CelR Ligand binding domain of a transcription regu 91.72
cd06267264 PBP1_LacI_sugar_binding_like Ligand binding domain of t 91.68
cd06271268 PBP1_AglR_RafR_like Ligand-binding domain of DNA transc 91.4
cd06293269 PBP1_LacI_like_11 Ligand-binding domain of uncharacteri 91.21
cd06272261 PBP1_hexuronate_repressor_like Ligand-binding domain of 90.85
cd06296270 PBP1_CatR_like Ligand-binding domain of a LacI-like tra 90.77
cd01542259 PBP1_TreR_like Ligand-binding domain of DNA transcripti 90.18
cd06297269 PBP1_LacI_like_12 Ligand-binding domain of uncharacteri 90.05
KOG1254 600 consensus 99.73
COG1042598 Acyl-CoA synthetase (NDP forming) [Energy production an 99.47
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 99.36
pfam01071193 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp 99.34
pfam02222171 ATP-grasp ATP-grasp domain. This family does not contai 99.25
PRK02186 892 argininosuccinate lyase; Provisional 99.25
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; Review 99.19
pfam02786211 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP b 99.16
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2; Val 99.1
TIGR02068 876 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011 99.01
PRK07206415 hypothetical protein; Provisional 98.96
PRK12767325 carbamoyl phosphate synthase-like protein; Provisional 98.87
pfam08443190 RimK RimK-like ATP-grasp domain. This ATP-grasp domain 98.84
PRK05586447 biotin carboxylase; Validated 98.83
PRK08462446 biotin carboxylase; Validated 98.81
PRK08591449 acetyl-CoA carboxylase biotin carboxylase subunit; Vali 98.79
PRK06111449 acetyl-CoA carboxylase biotin carboxylase subunit; Vali 98.78
TIGR00514451 accC acetyl-CoA carboxylase, biotin carboxylase; InterP 98.76
COG0458400 CarB Carbamoylphosphate synthase large subunit (split g 98.73
PRK08463478 acetyl-CoA carboxylase; Validated 98.7
PRK06019377 phosphoribosylaminoimidazole carboxylase ATPase subunit 98.64
COG0439449 AccC Biotin carboxylase [Lipid metabolism] 98.63
PRK12999 1147 pyruvate carboxylase; Reviewed 98.61
TIGR01161386 purK phosphoribosylaminoimidazole carboxylase, ATPase s 98.6
COG0026375 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR sy 98.59
PRK12833458 acetyl-CoA carboxylase biotin carboxylase subunit; Prov 98.55
KOG0237 788 consensus 98.53
KOG0238 670 consensus 98.51
COG4770 645 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid 98.46
pfam02655160 ATP-grasp_3 ATP-grasp domain. No functional information 98.41
TIGR03103547 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103. 98.23
COG0189318 RimK Glutathione synthase/Ribosomal protein S6 modifica 97.85
PRK02471753 bifunctional glutamate--cysteine ligase/glutathione syn 97.79
COG1038 1149 PycA Pyruvate carboxylase [Energy production and conver 97.76
COG1181317 DdlA D-alanine-D-alanine ligase and related ATP-grasp e 97.27
KOG0369 1176 consensus 96.87
KOG0370 1435 consensus 96.67
PRK06849387 hypothetical protein; Provisional 96.35
KOG0368 2196 consensus 96.31
PRK13277363 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuran 96.25
PRK13278356 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribo 96.11
COG1759361 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranos 95.95
TIGR01142407 purT phosphoribosylglycinamide formyltransferase 2; Int 95.58
COG3919415 Predicted ATP-grasp enzyme [General function prediction 94.82
TIGR02717457 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP formi 99.41
PRK05294 1063 carB carbamoyl phosphate synthase large subunit; Review 99.13
), forming GARS-AIRS-GART.; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00877">TIGR00877459 purD phosphoribosylamine--glycine ligase; InterPro: IPR 99.1
PRK00885424 phosphoribosylamine--glycine ligase; Provisional 99.08
PRK13789426 phosphoribosylamine--glycine ligase; Provisional 99.06
PRK13790415 phosphoribosylamine--glycine ligase; Provisional 99.01
COG0151428 PurD Phosphoribosylamine-glycine ligase [Nucleotide tra 99.0
PRK06395435 phosphoribosylamine--glycine ligase; Provisional 98.54
PRK05784485 phosphoribosylamine--glycine ligase; Provisional 98.13
TIGR02144289 LysX_arch Lysine biosynthesis enzyme LysX; InterPro: IP 98.67
PRK10446300 ribosomal protein S6 modification protein; Provisional 98.42
TIGR00768321 rimK_fam alpha-L-glutamate ligases, RimK family; InterP 98.17
COG0027394 PurT Formate-dependent phosphoribosylglycinamide formyl 98.01
TIGR02712 1226 urea_carbox urea carboxylase; InterPro: IPR014084 Membe 98.64
cd07022214 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K 96.29
cd07019211 S49_SppA_1 Signal peptide peptidase A (SppA), a serine 95.21
cd07023208 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serin 94.9
TIGR00706224 SppA_dom signal peptide peptidase SppA, 36K type; Inter 93.27
cd06319277 PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-bindin 94.74
cd06318282 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-binding 94.55
cd06321271 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-bindin 94.23
cd06313272 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-binding 93.57
cd01539303 PBP1_GGBP Periplasmic glucose/galactose-binding protein 93.39
cd06317275 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-binding 93.17
PRK10355330 xylF D-xylose transporter subunit XylF; Provisional 93.15
cd06308270 PBP1_sensor_kinase_like Periplasmic binding domain of t 93.13
cd06289268 PBP1_MalI_like Ligand-binding domain of MalI, a transcr 92.76
cd06310273 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-binding 92.49
cd06311274 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-binding 92.26
cd01574264 PBP1_LacI Ligand-binding domain of DNA transcription re 92.2
cd06275269 PBP1_PurR Ligand-binding domain of purine repressor, Pu 91.65
cd06320275 PBP1_allose_binding Periplasmic allose-binding domain o 91.65
PRK09701311 D-allose transporter subunit; Provisional 91.41
cd06303280 PBP1_LuxPQ_Quorum_Sensing Periplasmic binding protein ( 91.29
cd01538288 PBP1_ABC_xylose_binding Periplasmic xylose-binding comp 90.78
cd06301272 PBP1_rhizopine_binding_like Periplasmic binding protein 90.53
cd06316294 PBP1_ABC_sugar_binding_like_7 Periplasmic sugar-binding 90.28
>TIGR01016 sucCoAbeta succinyl-CoA synthetase, beta subunit; InterPro: IPR005809 There are four different enzymes that share a similar catalytic mechanism which involves the phosphorylation by ATP (or GTP) of a specific histidine residue in the active site Back     alignment and domain information
>PRK00696 sucC succinyl-CoA synthetase subunit beta; Provisional Back     alignment and domain information
>COG0045 SucC Succinyl-CoA synthetase, beta subunit [Energy production and conversion] Back     alignment and domain information
>KOG1447 consensus Back     alignment and domain information
>KOG2799 consensus Back     alignment and domain information
>COG1042 Acyl-CoA synthetase (NDP forming) [Energy production and conversion] Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>pfam08442 ATP-grasp_2 ATP-grasp domain Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>pfam07478 Dala_Dala_lig_C D-ala D-ala ligase C-terminus Back     alignment and domain information
>PRK01966 ddl D-alanyl-alanine synthetase A; Reviewed Back     alignment and domain information
>PRK08654 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PRK07178 acetyl-CoA carboxylase; Validated Back     alignment and domain information
>TIGR01205 D_ala_D_alaTIGR D-alanine--D-alanine ligase; InterPro: IPR005905 D-alanine--D-alanine ligase (6 Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 In the postabsorptive state, blood glucose concentration is kept constant by a combination of glycogenolysis and gluconeogenesis Back     alignment and domain information
>pfam00549 Ligase_CoA CoA-ligase Back     alignment and domain information
>pfam06263 consensus Back     alignment and domain information
>PRK06091 membrane protein FdrA; Validated Back     alignment and domain information
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>PTZ00187 succinyl-CoA synthetase alpha subunit; Provisional Back     alignment and domain information
>cd01540 PBP1_arabinose_binding Periplasmic L-arabinose-binding protein (ABP), a member of a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein superfamily Back     alignment and domain information
>cd07014 S49_SppA Signal peptide peptidase A Back     alignment and domain information
>COG0074 SucD Succinyl-CoA synthetase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>cd06287 PBP1_LacI_like_8 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06283 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of DNA transcription repressor RegR and other putative regulators such as KdgR and EndR Back     alignment and domain information
>cd06300 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-binding component of uncharacterized ABC-type transport systems that are members of the pentose/hexose sugar-binding protein family of the type I periplasmic binding protein superfamily Back     alignment and domain information
>pfam06263 consensus Back     alignment and domain information
>cd06298 PBP1_CcpA_like Ligand-binding domain of the catabolite control protein A (CcpA), which functions as the major transcriptional regulator of carbon catabolite repression/regulation Back     alignment and domain information
>cd06284 PBP1_LacI_like_6 Ligand-binding domain of an uncharacterized transcription regulator from Actinobacillus succinogenes and its close homologs from other bacteria Back     alignment and domain information
>cd06285 PBP1_LacI_like_7 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>PRK06091 membrane protein FdrA; Validated Back     alignment and domain information
>cd06292 PBP1_LacI_like_10 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06291 PBP1_Qymf_like Ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs Back     alignment and domain information
>PRK10401 DNA-binding transcriptional regulator GalS; Provisional Back     alignment and domain information
>cd06270 PBP1_GalS_like Ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism Back     alignment and domain information
>cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK10423 transcriptional repressor RbsR; Provisional Back     alignment and domain information
>cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems Back     alignment and domain information
>cd06286 PBP1_CcpB_like Ligand-binding domain of a novel transcription factor implicated in catabolite repression in Bacillus and Clostridium species Back     alignment and domain information
>cd06294 PBP1_ycjW_transcription_regulator_like Ligand-binding domain of uncharacterized transcription regulator ycjW which is a member of the LacI-GalR family repressors Back     alignment and domain information
>cd01575 PBP1_GntR Ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06295 PBP1_CelR Ligand binding domain of a transcription regulator of cellulose genes, CelR, which is highly homologous to the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06267 PBP1_LacI_sugar_binding_like Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily Back     alignment and domain information
>cd06271 PBP1_AglR_RafR_like Ligand-binding domain of DNA transcription repressors specific for raffinose (RafR) and alpha-glucosides (AglR) which are members of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06293 PBP1_LacI_like_11 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06272 PBP1_hexuronate_repressor_like Ligand-binding domain of DNA transcription repressor for the hexuronate utilization operon from Bacillus species and its close homologs from other bacteria, all of which are a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06296 PBP1_CatR_like Ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation Back     alignment and domain information
>cd01542 PBP1_TreR_like Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06297 PBP1_LacI_like_12 Ligand-binding domain of uncharacterized transcription regulators from Thermus thermophilus and close homologs Back     alignment and domain information
>KOG1254 consensus Back     alignment and domain information
>COG1042 Acyl-CoA synthetase (NDP forming) [Energy production and conversion] Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>pfam01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain Back     alignment and domain information
>pfam02222 ATP-grasp ATP-grasp domain Back     alignment and domain information
>PRK02186 argininosuccinate lyase; Provisional Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>pfam02786 CPSase_L_D2 Carbamoyl-phosphate synthase L chain, ATP binding domain Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>TIGR02068 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011810 Cyanophycin is an insoluble storage polymer for carbon, nitrogen, and energy, found in most Cyanobacteria Back     alignment and domain information
>PRK07206 hypothetical protein; Provisional Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>pfam08443 RimK RimK-like ATP-grasp domain Back     alignment and domain information
>PRK05586 biotin carboxylase; Validated Back     alignment and domain information
>PRK08462 biotin carboxylase; Validated Back     alignment and domain information
>PRK08591 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase; InterPro: IPR004549 This family represents the biotin carboxylase subunit found usually as a component of acetyl-CoA carboxylase Back     alignment and domain information
>COG0458 CarB Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism] Back     alignment and domain information
>PRK08463 acetyl-CoA carboxylase; Validated Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>COG0439 AccC Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, ATPase subunit; InterPro: IPR005875 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>COG0026 PurK Phosphoribosylaminoimidazole carboxylase (NCAIR synthetase) [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>KOG0237 consensus Back     alignment and domain information
>KOG0238 consensus Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>pfam02655 ATP-grasp_3 ATP-grasp domain Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>COG0189 RimK Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK02471 bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>COG1181 DdlA D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG0369 consensus Back     alignment and domain information
>KOG0370 consensus Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>KOG0368 consensus Back     alignment and domain information
>PRK13277 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase-like protein; Provisional Back     alignment and domain information
>PRK13278 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase; Provisional Back     alignment and domain information
>COG1759 5-formaminoimidazole-4-carboxamide-1-beta-D-ribofuranosyl 5'-monophosphate synthetase (purine biosynthesis) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2; InterPro: IPR005862 The formation of isosinate, a precursor of adenylate and guanylate, from 5-phosphoribosyl 1-pyrophosphate in the de novo purine biosynthesis pathway is basically composed of 10 steps of reactions Back     alignment and domain information
>COG3919 Predicted ATP-grasp enzyme [General function prediction only] Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain; InterPro: IPR014089 This group of ADP-dependent acetyl-CoA synthetases (ACS) act in the direction of acetate and ATP production in the organisms in which they have been characterised , , Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>TIGR00877 purD phosphoribosylamine--glycine ligase; InterPro: IPR000115 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PRK00885 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK13789 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK13790 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>COG0151 PurD Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06395 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK05784 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>TIGR02144 LysX_arch Lysine biosynthesis enzyme LysX; InterPro: IPR011870 The family of proteins found in this family include the characterised LysX from Thermus thermophilus which is part of a well-organised lysine biosynthesis gene cluster Back     alignment and domain information
>PRK10446 ribosomal protein S6 modification protein; Provisional Back     alignment and domain information
>TIGR00768 rimK_fam alpha-L-glutamate ligases, RimK family; InterPro: IPR004666 Escherichia coli RimK adds additional Glu residues to the native Glu-Glu C-terminus of ribosomal protein S6 Back     alignment and domain information
>COG0027 PurT Formate-dependent phosphoribosylglycinamide formyltransferase (GAR transformylase) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase; InterPro: IPR014084 Members of this family are ATP-dependent urea carboxylases, including characterised members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type; InterPro: IPR004635 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>cd06319 PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06318 PBP1_ABC_sugar_binding_like_9 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06321 PBP1_ABC_sugar_binding_like_11 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06313 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd01539 PBP1_GGBP Periplasmic glucose/galactose-binding protein (GGBP) involved in chemotaxis towards, and active transport of, glucose and galactose in various bacterial species Back     alignment and domain information
>cd06317 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PRK10355 xylF D-xylose transporter subunit XylF; Provisional Back     alignment and domain information
>cd06308 PBP1_sensor_kinase_like Periplasmic binding domain of two-component sensor kinase signaling systems Back     alignment and domain information
>cd06289 PBP1_MalI_like Ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria Back     alignment and domain information
>cd06310 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06311 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd01574 PBP1_LacI Ligand-binding domain of DNA transcription repressor LacI specific for lactose, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06275 PBP1_PurR Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli Back     alignment and domain information
>cd06320 PBP1_allose_binding Periplasmic allose-binding domain of bacterial transport systems that function as a primary receptor of active transport and chemotaxis Back     alignment and domain information
>PRK09701 D-allose transporter subunit; Provisional Back     alignment and domain information
>cd06303 PBP1_LuxPQ_Quorum_Sensing Periplasmic binding protein (LuxP) of autoinducer-2 (AI-2) receptor LuxPQ from Vibrio harveyi and its close homologs Back     alignment and domain information
>cd01538 PBP1_ABC_xylose_binding Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>cd06301 PBP1_rhizopine_binding_like Periplasmic binding proteins specific to rhizopines Back     alignment and domain information
>cd06316 PBP1_ABC_sugar_binding_like_7 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target398 succinyl-CoA synthetase subunit beta [Candidatus Liberi
1scu_B388 The Crystal Structure Of Succinyl-Coa Synthetase Fr 1e-107
1cqi_B385 Crystal Structure Of The Complex Of Adp And Mg2+ Wi 1e-106
1jll_B388 Crystal Structure Analysis Of The E197betaa Mutant 1e-106
2fp4_B395 Crystal Structure Of Pig Gtp-Specific Succinyl-Coa 1e-106
1euc_B396 Crystal Structure Of Dephosphorylated Pig Heart, Gt 1e-103
1eud_B396 Crystal Structure Of Phosphorylated Pig Heart, Gtp- 1e-103
3mwe_A425 Truncated Human Atp-Citrate Lyase With Tartrate Bou 2e-26
3mwd_A425 Truncated Human Atp-Citrate Lyase With Citrate Boun 2e-25
1wr2_A238 Crystal Structure Of Ph1788 From Pyrococcus Horikos 3e-10
1vkz_A412 Crystal Structure Of Phosphoribosylamine--Glycine L 5e-05
2yrw_A451 Crystal Structure Of Gar Synthetase From Geobacillu 2e-04
2qk4_A452 Human Glycinamide Ribonucleotide Synthetase Length 2e-04
2yw2_A424 Crystal Structure Of Gar Synthetase From Aquifex Ae 0.001
2xd4_A422 Nucleotide-Bound Structures Of Bacillus Subtilis Gl 0.002
1ulz_A451 Crystal Structure Of The Biotin Carboxylase Subunit 0.004
2csu_A457 Crystal Structure Of Ph0766 From Pyrococcus Horikos 5e-04
gi|1065086|pdb|1SCU|B Chain B, The Crystal Structure Of Succinyl-Coa Synthetase From Escherichia Coli At 2.5 Angstroms Resolution Length = 388 Back     alignment and structure
 Score =  393 bits (1009), Expect = e-107,   Method: Composition-based stats.
 Identities = 196/397 (49%), Positives = 265/397 (66%), Gaps = 10/397 (2%)

Query: 1   MNIHEYQAKALLRKYNVPVAKGVVISSVHAAESAIKTLPGPLYVVKSQIHAGGRGKGRFK 60
           MN+HEYQAK L  +Y +P   G   ++   AE A   +    +VVK Q+HAGGRGK    
Sbjct: 1   MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKA--- 57

Query: 61  ELPADSKGGVRVESSLKSVISDIREILGSTLITKQTGPTGSRVNCVYVEDGADILRELYL 120
                  GGV+V +S + + +     LG  L+T QT   G  VN + VE   DI +ELYL
Sbjct: 58  -------GGVKVVNSKEDIRAFAENWLGKRLVTYQTDANGQPVNQILVEAATDIAKELYL 110

Query: 121 SLLVDRTSGMVAFIASTQGGMDIEEVAKDYPQKIFKLLIDPLIGVTSEDVASLCDMLELQ 180
             +VDR+S  V F+AST+GG++IE+VA++ P  I K+ +DPL G        L   L L+
Sbjct: 111 GAVVDRSSRRVVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQGRELAFKLGLE 170

Query: 181 GQARIDGGDLFPNLYKAFCDKDMSLLEINPLIIMKNGRLRVLDSKISFDDNALYRHLDIQ 240
           G+       +F  L   F ++D++L+EINPL+I K G L  LD K+  D NAL+R  D++
Sbjct: 171 GKLVQQFTKIFMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQPDLR 230

Query: 241 ELRDVSEEDSREIEAKQHNLSYIALDGNIGCMVNGAGLAMATMDIIKLYGGAPANFLDVG 300
           E+RD S+ED RE +A Q  L+Y+ALDGNIGCMVNGAGLAM TMDI+KL+GG PANFLDVG
Sbjct: 231 EMRDQSQEDPREAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVG 290

Query: 301 GGADQDKVAAAFKIITSDSSVKGILINIFGGIMRCDVLVKGILSAVKEVKINIPLVMRLE 360
           GGA +++V  AFKII SD  VK +L+NIFGGI+RCD++  GI+ AV EV +N+P+V+RLE
Sbjct: 291 GGATKERVTEAFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLE 350

Query: 361 GANVDIGNRLIAESGLNVITAIDLDDAAQKIVHAVKG 397
           G N ++G + +A+SGLN+I A  L DAAQ++V AV+G
Sbjct: 351 GNNAELGAKKLADSGLNIIAAKGLTDAAQQVVAAVEG 387


>gi|6980728|pdb|1CQI|B Chain B, Crystal Structure Of The Complex Of Adp And Mg2+ With Dephosphorylated E. Coli Succinyl-Coa Synthetase Length = 385 Back     alignment and structure
>gi|18655528|pdb|1JLL|B Chain B, Crystal Structure Analysis Of The E197betaa Mutant Of E. Coli Scs Length = 388 Back     alignment and structure
>gi|90109555|pdb|2FP4|B Chain B, Crystal Structure Of Pig Gtp-Specific Succinyl-Coa Synthetase In Complex With Gtp Length = 395 Back     alignment and structure
>gi|9955020|pdb|1EUC|B Chain B, Crystal Structure Of Dephosphorylated Pig Heart, Gtp- Specific Succinyl-Coa Synthetase Length = 396 Back     alignment and structure
>gi|9955022|pdb|1EUD|B Chain B, Crystal Structure Of Phosphorylated Pig Heart, Gtp-Specific Succinyl-Coa Synthetase Length = 396 Back     alignment and structure
>gi|298508701|pdb|3MWE|A Chain A, Truncated Human Atp-Citrate Lyase With Tartrate Bound Length = 425 Back     alignment and structure
>gi|298508699|pdb|3MWD|A Chain A, Truncated Human Atp-Citrate Lyase With Citrate Bound Length = 425 Back     alignment and structure
gi|82407393|pdb|1WR2|A Chain A, Crystal Structure Of Ph1788 From Pyrococcus Horikoshii Ot3 Length = 238 Back     alignment and structure
>gi|52696133|pdb|1VKZ|A Chain A, Crystal Structure Of Phosphoribosylamine--Glycine Ligase (Tm1250) From Thermotoga Maritima At 2.30 A Resolution Length = 412 Back     alignment and structure
>gi|158431213|pdb|2YRW|A Chain A, Crystal Structure Of Gar Synthetase From Geobacillus Kaustophilus Length = 451 Back     alignment and structure
>gi|157835953|pdb|2QK4|A Chain A, Human Glycinamide Ribonucleotide Synthetase Length = 452 Back     alignment and structure
gi|159795596|pdb|2YW2|A Chain A, Crystal Structure Of Gar Synthetase From Aquifex Aeolicus In Complex With Atp Length = 424 Back     alignment and structure
gi|326634053|pdb|2XD4|A Chain A, Nucleotide-Bound Structures Of Bacillus Subtilis Glycinamide Ribonucleotide Synthetase Length = 422 Back     alignment and structure
>gi|47169244|pdb|1ULZ|A Chain A, Crystal Structure Of The Biotin Carboxylase Subunit Of Pyruvate Carboxylase Length = 451 Back     alignment and structure
>gi|112490214|pdb|2CSU|A Chain A, Crystal Structure Of Ph0766 From Pyrococcus Horikoshii Ot3 Length = 457 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target398 succinyl-CoA synthetase subunit beta [Candidatus Liberi
2nu8_B388 SCS-beta, succinyl-COA synthetase beta chain; citric ac 1e-115
2fp4_B395 Succinyl-COA ligase [GDP-forming] beta-chain, mitochond 1e-104
3mwd_A425 ATP-citrate synthase; ATP-grAsp, phosphohistidine, orga 2e-78
1wr2_A238 Hypothetical protein PH1789; structural genomics, NPPSF 3e-25
>2nu8_B SCS-beta, succinyl-COA synthetase beta chain; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, rossmann fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.23.4.1 d.142.1.4 PDB: 1scu_B* 2nu6_B* 1jkj_B* 2nu7_B* 2nu9_B* 2nua_B* 2scu_B* 1jll_B* 1cqj_B* 1cqi_B* Length = 388 Back     alignment and structure
 Score =  411 bits (1058), Expect = e-115
 Identities = 196/397 (49%), Positives = 265/397 (66%), Gaps = 10/397 (2%)

Query: 1   MNIHEYQAKALLRKYNVPVAKGVVISSVHAAESAIKTLPGPLYVVKSQIHAGGRGKGRFK 60
           MN+HEYQAK L  +Y +P   G   ++   AE A   +    +VVK Q+HAGGRGK    
Sbjct: 1   MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKA--- 57

Query: 61  ELPADSKGGVRVESSLKSVISDIREILGSTLITKQTGPTGSRVNCVYVEDGADILRELYL 120
                  GGV+V +S + + +     LG  L+T QT   G  VN + VE   DI +ELYL
Sbjct: 58  -------GGVKVVNSKEDIRAFAENWLGKRLVTYQTDANGQPVNQILVEAATDIAKELYL 110

Query: 121 SLLVDRTSGMVAFIASTQGGMDIEEVAKDYPQKIFKLLIDPLIGVTSEDVASLCDMLELQ 180
             +VDR+S  V F+AST+GG++IE+VA++ P  I K+ +DPL G        L   L L+
Sbjct: 111 GAVVDRSSRRVVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQGRELAFKLGLE 170

Query: 181 GQARIDGGDLFPNLYKAFCDKDMSLLEINPLIIMKNGRLRVLDSKISFDDNALYRHLDIQ 240
           G+       +F  L   F ++D++L+EINPL+I K G L  LD K+  D NAL+R  D++
Sbjct: 171 GKLVQQFTKIFMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQPDLR 230

Query: 241 ELRDVSEEDSREIEAKQHNLSYIALDGNIGCMVNGAGLAMATMDIIKLYGGAPANFLDVG 300
           E+RD S+ED RE +A Q  L+Y+ALDGNIGCMVNGAGLAM TMDI+KL+GG PANFLDVG
Sbjct: 231 EMRDQSQEDPREAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVG 290

Query: 301 GGADQDKVAAAFKIITSDSSVKGILINIFGGIMRCDVLVKGILSAVKEVKINIPLVMRLE 360
           GGA +++V  AFKII SD  VK +L+NIFGGI+RCD++  GI+ AV EV +N+P+V+RLE
Sbjct: 291 GGATKERVTEAFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLE 350

Query: 361 GANVDIGNRLIAESGLNVITAIDLDDAAQKIVHAVKG 397
           G N ++G + +A+SGLN+I A  L DAAQ++V AV+G
Sbjct: 351 GNNAELGAKKLADSGLNIIAAKGLTDAAQQVVAAVEG 387


>2fp4_B Succinyl-COA ligase [GDP-forming] beta-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.23.4.1 d.142.1.4 PDB: 2fpg_B* 2fpi_B* 2fpp_B* 1euc_B* 1eud_B* Length = 395 Back     alignment and structure
>3mwd_A ATP-citrate synthase; ATP-grAsp, phosphohistidine, organic acid, lyase, transferas; HET: CIT; 2.10A {Homo sapiens} PDB: 3mwe_A* Length = 425 Back     alignment and structure
>1wr2_A Hypothetical protein PH1789; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Pyrococcus horikoshii OT3} Length = 238 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target398 succinyl-CoA synthetase subunit beta [Candidatus Liberi
2fp4_B395 Succinyl-COA ligase [GDP-forming] beta-chain, mitochond 100.0
2nu8_B388 SCS-beta, succinyl-COA synthetase beta chain; citric ac 100.0
3mwd_A425 ATP-citrate synthase; ATP-grAsp, phosphohistidine, orga 100.0
1a9x_A1073 Carbamoyl phosphate synthetase (large chain); amidotran 98.77
1wr2_A238 Hypothetical protein PH1789; structural genomics, NPPSF 100.0
3lp8_A442 Phosphoribosylamine-glycine ligase; ssgcid, NIH, niaid, 99.15
2ip4_A417 PURD, phosphoribosylamine--glycine ligase; GAR syntheta 99.13
3mjf_A431 Phosphoribosylamine--glycine ligase; structural genomic 99.02
3ouz_A446 Biotin carboxylase; structural genomics, center for str 99.02
1ehi_A377 LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp 98.91
3e5n_A386 D-alanine-D-alanine ligase A; bacterial blight; 2.00A { 98.91
1iow_A306 DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphor 98.89
3i12_A364 D-alanine-D-alanine ligase A; D-alanyl-alanine syntheta 98.85
1e4e_A343 Vancomycin/teicoplanin A-type resistance protein VANA; 98.71
3eth_A355 Phosphoribosylaminoimidazole carboxylase ATPase subunit 98.68
3lwb_A373 D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine l 98.67
3k3p_A383 D-alanine--D-alanine ligase; D-alanyl-alanine synthetas 98.53
2fb9_A322 D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} 98.47
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amidotran 99.26
2yw2_A424 Phosphoribosylamine--glycine ligase; glycinamide ribonu 99.24
1vkz_A412 Phosphoribosylamine--glycine ligase; TM1250, structural 99.15
2qk4_A452 Trifunctional purine biosynthetic protein adenosine-3; 99.12
2yrx_A451 Phosphoribosylglycinamide synthetase; glycinamide ribon 99.1
1ulz_A451 Pyruvate carboxylase N-terminal domain; biotin carboxyl 98.97
2dwc_A433 PH0318, 433AA long hypothetical phosphoribosylglycinami 98.9
1w96_A554 ACC, acetyl-coenzyme A carboxylase; ligase, obesity, di 98.9
3glk_A540 Acetyl-COA carboxylase 2; ATP binding, alternative spli 98.84
2vpq_A451 Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, bio 98.82
2pvp_A367 D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori 98.81
2i87_A364 D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus 98.8
3jrx_A587 Acetyl-COA carboxylase 2; BC domain, soraphen A, altern 98.77
3n6r_A 681 Propionyl-COA carboxylase, alpha subunit; protein compl 98.76
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 98.75
2dzd_A461 Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A 98.69
2w70_A449 Biotin carboxylase; ligase, inhibitor, ATP-binding, fat 98.63
2r7k_A361 5-formaminoimidazole-4-carboxamide-1-(beta)-D- ribofura 98.57
3k5i_A403 Phosphoribosyl-aminoimidazole carboxylase; purine biosy 98.53
2r85_A334 PURP protein PF1517; ATP-grAsp superfamily, unknown fun 98.49
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi-funct 98.44
1kjq_A391 GART 2, phosphoribosylglycinamide formyltransferase 2, 98.4
2cqy_A108 Propionyl-COA carboxylase alpha chain, mitochondrial; P 98.35
2pn1_A331 Carbamoylphosphate synthase large subunit; ZP_00538348. 98.26
1i7n_A309 Synapsin II; synapse, phosphorylation, neuropeptide; 1. 97.04
1z2n_X324 Inositol 1,3,4-trisphosphate 5/6-kinase; inositol phosp 96.91
2z04_A365 Phosphoribosylaminoimidazole carboxylase ATPase subunit 96.77
2pbz_A320 Hypothetical protein; NYSGXRC, PSI-II, IMP biosynthesis 96.76
2p0a_A344 Synapsin-3, synapsin III; neurotransmitter release, sch 96.55
1pk8_A