254781050

254781050

succinyl-CoA synthetase subunit alpha

GeneID in NCBI database:8210073Locus tag:CLIBASIA_04760
Protein GI in NCBI database:254781050Protein Accession:YP_003065463.1
Gene range:+(1051925, 1052827)Protein Length:300aa
Gene description:succinyl-CoA synthetase subunit alpha
COG prediction:[C] Succinyl-CoA synthetase, alpha subunit
KEGG prediction:sucD; succinyl-CoA synthetase subunit alpha (EC:6.2.1.5); K01902 succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
SEED prediction:Succinyl-CoA ligase [ADP-forming] alpha chain (EC 6.2.1.5)
Pathway involved in KEGG:Citrate cycle (TCA cycle) [PATH:las00020]
Propanoate metabolism [PATH:las00640]
C5-Branched dibasic acid metabolism
Subsystem involved in SEED:TCA Cycle
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300
MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL
cEEEEcccccEEEEccccccHHHHHHHHHHHccccEEEEEccccccEEEccccccccccccHHHHHHHccccEEEEEccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHcccEEEcccccEEEccccccEEEccccccccccEEEEEccHHHHHHHHHHHHHccccEEEEEEEcccccccccHHHHHHHHHHcccccEEEEEEEccccHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHcccccccHHHHHHHHHHcccEEcccHHHHHHHHHHHHHcc
cccccccccEEEEEccccHHHHHHHHHHHHHccEEEEEEcccccccEEccccEccEEEEccHHHHHHHHcccEEEEcccHHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHccEEEcccccEEEEcccEEEEccccccccEEEEEEEEccHHHHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccEccEccHHHHHHHHHHcccEEcccHHHHHHHHHHHcccc
msilvdknTKVLVQGLtgkagtfhtEQAILYCQtqvvggihpkkgstywtggnvnvpVFTTVAEAKERTAANasviyvppsgagdAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKsssrligpncpgiltpdsckigimpgsifrkgsvgilsrsgtlTYEAVFQTSqeglgqstavgiggdpvkgteFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAkrgrkkpivgfvagktappgrtmghagavisggkggaeDKINAMKEAgiciapsparIGRSLVELLGSL
msilvdkntkVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEksssrligpncpgilTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTsqeglgqstaVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKdeakrgrkkpivgfvagktappgrtmghAGAVISGGKGGAEDKINAMKEAGiciapspariGRSLVELLGSL
MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSaeeeaaQFLKDEAKRGRKKPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL
MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL
MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL
*SILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL
MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL
MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTTVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVGFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target300 succinyl-CoA synthetase subunit alpha [Candidatus Liber
315122388300 succinyl-CoA synthetase subunit alpha [Candidatus Liber 1 1e-150
241206655300 succinyl-CoA synthetase subunit alpha [Rhizobium legumi 1 1e-136
121602296300 succinyl-CoA synthetase subunit alpha [Bartonella bacil 1 1e-136
116254168300 succinyl-CoA synthetase subunit alpha [Rhizobium legumi 1 1e-135
86359470300 succinyl-CoA synthetase subunit alpha [Rhizobium etli C 1 1e-135
319780728300 succinyl-CoA synthetase subunit alpha [Mesorhizobium ci 1 1e-135
218671347300 succinyl-CoA synthetase subunit alpha [Rhizobium etli G 1 1e-135
13473638300 succinyl-CoA synthetase subunit alpha [Mesorhizobium lo 1 1e-135
327188906343 succinyl-CoA synthetase protein, alpha subunit [Rhizobi 1 1e-134
190893736300 succinyl-CoA synthetase, alpha subunit [Rhizobium etli 1 1e-134
>gi|315122388|ref|YP_004062877.1| succinyl-CoA synthetase subunit alpha [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 300 Back     alignment and organism information
 Score =  534 bits (1375), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 265/300 (88%), Positives = 281/300 (93%)

Query: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFT 60
           MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQ+VGGIHPKKG T W GGNVNVPVF 
Sbjct: 1   MSILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQIVGGIHPKKGGTCWVGGNVNVPVFV 60

Query: 61  TVAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKS 120
           +VAEAKE T ANASVIYVPPSGAGDAIIESI+AEIPLIVCITEGIP LDMVRVKA LE S
Sbjct: 61  SVAEAKEHTGANASVIYVPPSGAGDAIIESIKAEIPLIVCITEGIPFLDMVRVKAYLENS 120

Query: 121 SSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180
           SSRLIGPNCPG+LTP+ CKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA
Sbjct: 121 SSRLIGPNCPGVLTPEECKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTA 180

Query: 181 VGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV 240
           VGIGGDPVKG+EFID+LELFLAD+ TESI+MVGEIGGSAEE+AA FLKDEAK GRKKP+V
Sbjct: 181 VGIGGDPVKGSEFIDILELFLADKETESIIMVGEIGGSAEEDAANFLKDEAKCGRKKPVV 240

Query: 241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL 300
           GFVAGKTAPPGRTMGHAGAVI GG+G AEDKI AM+EAGI IA SPAR+G++LVELLG L
Sbjct: 241 GFVAGKTAPPGRTMGHAGAVIYGGQGSAEDKIAAMQEAGIRIASSPARMGKTLVELLGGL 300


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|241206655|ref|YP_002977751.1| succinyl-CoA synthetase subunit alpha [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 300 Back     alignment and organism information
>gi|121602296|ref|YP_988363.1| succinyl-CoA synthetase subunit alpha [Bartonella bacilliformis KC583] Length = 300 Back     alignment and organism information
>gi|116254168|ref|YP_770006.1| succinyl-CoA synthetase subunit alpha [Rhizobium leguminosarum bv. viciae 3841] Length = 300 Back     alignment and organism information
>gi|86359470|ref|YP_471362.1| succinyl-CoA synthetase subunit alpha [Rhizobium etli CFN 42] Length = 300 Back     alignment and organism information
>gi|319780728|ref|YP_004140204.1| succinyl-CoA synthetase subunit alpha [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 300 Back     alignment and organism information
>gi|218671347|ref|ZP_03521017.1| succinyl-CoA synthetase subunit alpha [Rhizobium etli GR56] Length = 300 Back     alignment and organism information
>gi|13473638|ref|NP_105206.1| succinyl-CoA synthetase subunit alpha [Mesorhizobium loti MAFF303099] Length = 300 Back     alignment and organism information
>gi|327188906|gb|EGE56098.1| succinyl-CoA synthetase protein, alpha subunit [Rhizobium etli CNPAF512] Length = 343 Back     alignment and organism information
>gi|190893736|ref|YP_001980278.1| succinyl-CoA synthetase, alpha subunit [Rhizobium etli CIAT 652] Length = 300 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target300 succinyl-CoA synthetase subunit alpha [Candidatus Liber
PRK05678291 PRK05678, PRK05678, succinyl-CoA synthetase subunit alp 1e-136
PTZ00187317 PTZ00187, PTZ00187, succinyl-CoA synthetase alpha subun 1e-120
TIGR01019286 TIGR01019, sucCoAalpha, succinyl-CoA synthetase, alpha 1e-112
KOG1255329 KOG1255, KOG1255, KOG1255, Succinyl-CoA synthetase, alp 1e-108
PLN00125300 PLN00125, PLN00125, Succinyl-CoA ligase [GDP-forming] s 1e-102
KOG1254 600 KOG1254, KOG1254, KOG1254, ATP-citrate lyase [Energy pr 2e-14
COG0074293 COG0074, SucD, Succinyl-CoA synthetase, alpha subunit [ 1e-109
pfam00549128 pfam00549, Ligase_CoA, CoA-ligase 7e-23
pfam0262996 pfam02629, CoA_binding, CoA binding domain 2e-17
PLN02522 608 PLN02522, PLN02522, ATP citrate (pro-S)-lyase 2e-17
COG1042 598 COG1042, COG1042, Acyl-CoA synthetase (NDP forming) [En 3e-09
TIGR02717 447 TIGR02717, AcCoA-syn-alpha, acetyl coenzyme A synthetas 4e-12
PRK06091 555 PRK06091, PRK06091, membrane protein FdrA; Validated 7e-05
>gnl|CDD|180194 PRK05678, PRK05678, succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|185505 PTZ00187, PTZ00187, succinyl-CoA synthetase alpha subunit; Provisional Back     alignment and domain information
>gnl|CDD|130091 TIGR01019, sucCoAalpha, succinyl-CoA synthetase, alpha subunit Back     alignment and domain information
>gnl|CDD|36469 KOG1255, KOG1255, KOG1255, Succinyl-CoA synthetase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|177737 PLN00125, PLN00125, Succinyl-CoA ligase [GDP-forming] subunit alpha Back     alignment and domain information
>gnl|CDD|36468 KOG1254, KOG1254, KOG1254, ATP-citrate lyase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|30423 COG0074, SucD, Succinyl-CoA synthetase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|144220 pfam00549, Ligase_CoA, CoA-ligase Back     alignment and domain information
>gnl|CDD|145665 pfam02629, CoA_binding, CoA binding domain Back     alignment and domain information
>gnl|CDD|178137 PLN02522, PLN02522, ATP citrate (pro-S)-lyase Back     alignment and domain information
>gnl|CDD|31244 COG1042, COG1042, Acyl-CoA synthetase (NDP forming) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|131764 TIGR02717, AcCoA-syn-alpha, acetyl coenzyme A synthetase (ADP forming), alpha domain Back     alignment and domain information
>gnl|CDD|180395 PRK06091, PRK06091, membrane protein FdrA; Validated Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 300 succinyl-CoA synthetase subunit alpha [Candidatus Liber
PRK05678289 succinyl-CoA synthetase subunit alpha; Validated 100.0
PTZ00187309 succinyl-CoA synthetase alpha subunit; Provisional 100.0
COG0074293 SucD Succinyl-CoA synthetase, alpha subunit [Energy pro 100.0
KOG1255329 consensus 100.0
TIGR02717 457 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP formi 100.0
TIGR01019288 sucCoAalpha succinyl-CoA synthetase, alpha subunit; Int 100.0
COG1042 598 Acyl-CoA synthetase (NDP forming) [Energy production an 100.0
KOG1254 600 consensus 100.0
TIGR02717457 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP formi 97.11
TIGR00978358 asd_EA aspartate-semialdehyde dehydrogenase; InterPro: 93.02
pfam06263 514 consensus 99.95
PRK06091 555 membrane protein FdrA; Validated 99.95
pfam00549128 Ligase_CoA CoA-ligase. This family includes the CoA lig 99.94
PRK10949 618 protease 4; Provisional 96.46
pfam0262996 CoA_binding CoA binding domain. This domain has a Rossm 99.77
pfam01408120 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossman 98.38
pfam01113122 DapB_N Dihydrodipicolinate reductase, N-terminus. Dihyd 98.26
COG2344211 AT-rich DNA-binding protein [General function predictio 98.0
PRK05472211 redox-sensing transcriptional repressor Rex; Provisiona 98.0
COG0673342 MviM Predicted dehydrogenases and related proteins [Gen 97.99
PRK11579346 putative oxidoreductase; Provisional 97.81
TIGR00036281 dapB dihydrodipicolinate reductase; InterPro: IPR011770 97.76
PRK10206345 putative dehydrogenase; Provisional 97.59
pfam03435384 Saccharop_dh Saccharopine dehydrogenase. This family co 95.76
pfam05368232 NmrA NmrA-like family. NmrA is a negative transcription 93.62
pfam03447116 NAD_binding_3 Homoserine dehydrogenase, NAD binding dom 93.3
pfam03446163 NAD_binding_2 NAD binding domain of 6-phosphogluconate 92.89
KOG2741351 consensus 92.55
CHL00194319 ycf39 Ycf39; Provisional 91.76
PRK08655 441 prephenate dehydrogenase; Provisional 91.54
PRK00436345 argC N-acetyl-gamma-glutamyl-phosphate reductase; Valid 91.33
TIGR02128338 G6PI_arch bifunctional phosphoglucose/phosphomannose is 91.01
PRK13303265 L-aspartate dehydrogenase; Provisional 90.91
PRK13304265 L-aspartate dehydrogenase; Reviewed 90.44
PRK11559295 garR tartronate semialdehyde reductase; Provisional 90.17
PRK00048265 dihydrodipicolinate reductase; Provisional 98.38
COG1832140 Predicted CoA-binding protein [General function predict 98.12
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid transpor 98.03
COG0059338 IlvC Ketol-acid reductoisomerase [Amino acid transport 97.18
PRK05479336 ketol-acid reductoisomerase; Provisional 96.75
PRK13403335 ketol-acid reductoisomerase; Provisional 96.37
pfam07991165 IlvN Acetohydroxy acid isomeroreductase, catalytic doma 95.96
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino acid tr 94.83
COG1748389 LYS9 Saccharopine dehydrogenase and related proteins [A 94.52
PRK05225 489 ketol-acid reductoisomerase; Validated 94.04
PRK06207406 aspartate aminotransferase; Provisional 93.14
pfam02593215 DUF166 Uncharacterized ArCR, COG1810. 92.11
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 91.44
PRK12490298 6-phosphogluconate dehydrogenase-like protein; Reviewed 91.04
pfam06263514 consensus 97.84
PRK06091555 membrane protein FdrA; Validated 97.41
TIGR02538 577 type_IV_pilB type IV-A pilus assembly ATPase PilB; Inte 91.82
PRK00696388 sucC succinyl-CoA synthetase subunit beta; Provisional 97.67
COG0045387 SucC Succinyl-CoA synthetase, beta subunit [Energy prod 97.58
TIGR01016389 sucCoAbeta succinyl-CoA synthetase, beta subunit; Inter 93.43
cd07019211 S49_SppA_1 Signal peptide peptidase A (SppA), a serine 96.76
TIGR00706224 SppA_dom signal peptide peptidase SppA, 36K type; Inter 96.63
cd07022214 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K 96.16
cd07014177 S49_SppA Signal peptide peptidase A. Signal peptide pep 95.72
cd07023208 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serin 95.29
cd00394161 Clp_protease_like Caseinolytic protease (ClpP) is an AT 93.17
cd07018222 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K 92.96
TIGR00705 614 SppA_67K signal peptide peptidase SppA, 67K type; Inter 95.67
COG0616317 SppA Periplasmic serine proteases (ClpP class) [Posttra 94.88
PRK08664350 aspartate-semialdehyde dehydrogenase; Reviewed 94.58
TIGR02124345 hypE hydrogenase expression/formation protein HypE; Int 94.31
pfam07755302 DUF1611 Protein of unknown function (DUF1611). This reg 94.09
PRK07366388 succinyldiaminopimelate transaminase; Validated 93.99
PRK09147397 aminotransferase; Provisional 92.76
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate de 93.52
pfam00208237 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine de 92.65
>PRK05678 succinyl-CoA synthetase subunit alpha; Validated Back     alignment and domain information
>PTZ00187 succinyl-CoA synthetase alpha subunit; Provisional Back     alignment and domain information
>COG0074 SucD Succinyl-CoA synthetase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>KOG1255 consensus Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain; InterPro: IPR014089 This group of ADP-dependent acetyl-CoA synthetases (ACS) act in the direction of acetate and ATP production in the organisms in which they have been characterised , , Back     alignment and domain information
>TIGR01019 sucCoAalpha succinyl-CoA synthetase, alpha subunit; InterPro: IPR005810 There are four different enzymes that share a similar catalytic mechanism which involves the phosphorylation by ATP (or GTP) of a specific histidine residue in the active site Back     alignment and domain information
>COG1042 Acyl-CoA synthetase (NDP forming) [Energy production and conversion] Back     alignment and domain information
>KOG1254 consensus Back     alignment and domain information
>TIGR02717 AcCoA-syn-alpha acetyl coenzyme A synthetase (ADP forming), alpha domain; InterPro: IPR014089 This group of ADP-dependent acetyl-CoA synthetases (ACS) act in the direction of acetate and ATP production in the organisms in which they have been characterised , , Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase; InterPro: IPR005676 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>pfam06263 consensus Back     alignment and domain information
>PRK06091 membrane protein FdrA; Validated Back     alignment and domain information
>pfam00549 Ligase_CoA CoA-ligase Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>pfam02629 CoA_binding CoA binding domain Back     alignment and domain information
>pfam01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold Back     alignment and domain information
>pfam01113 DapB_N Dihydrodipicolinate reductase, N-terminus Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase; InterPro: IPR011770 Dihydrodipicolinate reductase is an enzyme found in bacteria and higher plants which is involved in the biosynthesis of diaminopimelic acid, a component of bacterial cell walls, and the essential amino acid L-lysine Back     alignment and domain information
>PRK10206 putative dehydrogenase; Provisional Back     alignment and domain information
>pfam03435 Saccharop_dh Saccharopine dehydrogenase Back     alignment and domain information
>pfam05368 NmrA NmrA-like family Back     alignment and domain information
>pfam03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain Back     alignment and domain information
>pfam03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase Back     alignment and domain information
>KOG2741 consensus Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK08655 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>TIGR02128 G6PI_arch bifunctional phosphoglucose/phosphomannose isomerase; InterPro: IPR011857 Mannose-6-phosphate isomerase or phosphomannose isomerase (5 Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>COG1832 Predicted CoA-binding protein [General function prediction only] Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>pfam07991 IlvN Acetohydroxy acid isomeroreductase, catalytic domain Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05225 ketol-acid reductoisomerase; Validated Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>pfam02593 DUF166 Uncharacterized ArCR, COG1810 Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>pfam06263 consensus Back     alignment and domain information
>PRK06091 membrane protein FdrA; Validated Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB; InterPro: IPR013374 This model describes a protein involved in type IV pilus biogenesis designated PilB in Pseudomonas aeruginosa but PilF in Neisseria gonorrhoeae; the more common usage, reflected here, is PilB Back     alignment and domain information
>PRK00696 sucC succinyl-CoA synthetase subunit beta; Provisional Back     alignment and domain information
>COG0045 SucC Succinyl-CoA synthetase, beta subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01016 sucCoAbeta succinyl-CoA synthetase, beta subunit; InterPro: IPR005809 There are four different enzymes that share a similar catalytic mechanism which involves the phosphorylation by ATP (or GTP) of a specific histidine residue in the active site Back     alignment and domain information
>cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type; InterPro: IPR004635 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07014 S49_SppA Signal peptide peptidase A Back     alignment and domain information
>cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information
>cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type; InterPro: IPR004634 Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes Back     alignment and domain information
>COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02124 hypE hydrogenase expression/formation protein HypE; InterPro: IPR011854 This family contains HypE (or HupE), a protein required for expression of catalytically active hydrogenase in many systems Back     alignment and domain information
>pfam07755 DUF1611 Protein of unknown function (DUF1611) Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PRK09147 aminotransferase; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>pfam00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target300 succinyl-CoA synthetase subunit alpha [Candidatus Liber
1jkj_A288 E. Coli Scs Length = 288 1e-92
2nu7_A288 C123as Mutant Of E. Coli Succinyl-Coa Synthetase Le 3e-92
2nu8_A288 C123at Mutant Of E. Coli Succinyl-Coa Synthetase Le 6e-92
1cqi_A286 Crystal Structure Of The Complex Of Adp And Mg2+ Wi 8e-92
2nua_A288 C123av Mutant Of E. Coli Succinyl-Coa Synthetase Le 1e-91
2scu_A288 A Detailed Description Of The Structure Of Succinyl 1e-86
2nu9_A288 C123at Mutant Of E. Coli Succinyl-Coa Synthetase Or 6e-86
2nu6_A288 C123aa Mutant Of E. Coli Succinyl-Coa Synthetase Le 9e-86
2yv2_A297 Crystal Structure Of Succinyl-Coa Synthetase Alpha 1e-85
2yv1_A294 Crystal Structure Of Succinyl-Coa Synthetase Alpha 2e-79
2fpg_A305 Crystal Structure Of Pig Gtp-Specific Succinyl-Coa 3e-78
1oi7_A288 The Crystal Structure Of Succinyl-Coa Synthetase Al 3e-78
1euc_A311 Crystal Structure Of Dephosphorylated Pig Heart, Gt 6e-78
2fp4_A305 Crystal Structure Of Pig Gtp-Specific Succinyl-Coa 6e-76
1eud_A311 Crystal Structure Of Phosphorylated Pig Heart, Gtp- 1e-75
3mwe_B335 Truncated Human Atp-Citrate Lyase With Tartrate Bou 7e-56
3mwd_B334 Truncated Human Atp-Citrate Lyase With Citrate Boun 3e-53
2csu_A 457 Crystal Structure Of Ph0766 From Pyrococcus Horikos 3e-25
3dmy_A 480 Crystal Structure Of A Predicated Acyl-Coa Syntheta 4e-08
>gi|18655523|pdb|1JKJ|A Chain A, E. Coli Scs Length = 288 Back     alignment and structure
 Score =  344 bits (882), Expect = 1e-92,   Method: Composition-based stats.
 Identities = 172/297 (57%), Positives = 217/297 (73%), Gaps = 9/297 (3%)

Query: 2   SILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTT 61
           SIL+DKNTKV+ QG TG  GTFH+EQAI Y  T++VGG+ P KG T   G    +PVF T
Sbjct: 1   SILIDKNTKVICQGFTGSQGTFHSEQAIAY-GTKMVGGVTPGKGGTTHLG----LPVFNT 55

Query: 62  VAEAKERTAANASVIYVPPSGAGDAIIESIEAEIPLIVCITEGIPVLDMVRVKARLEKSS 121
           V EA   T A ASVIYVP     D+I+E+I+A I LI+ ITEGIP LDM+ VK +L+++ 
Sbjct: 56  VREAVAATGATASVIYVPAPFCKDSILEAIDAGIKLIITITEGIPTLDMLTVKVKLDEAG 115

Query: 122 SRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSGTLTYEAVFQTSQEGLGQSTAV 181
            R+IGPNCPG++TP  CKIGI PG I + G VGI+SRSGTLTYEAV QT+  G GQST V
Sbjct: 116 VRMIGPNCPGVITPGECKIGIQPGHIHKPGKVGIVSRSGTLTYEAVKQTTDYGFGQSTCV 175

Query: 182 GIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIVG 241
           GIGGDP+ G+ FID+LE+F  D  TE+IVM+GEIGGSAEEEAA ++K+       KP+VG
Sbjct: 176 GIGGDPIPGSNFIDILEMFEKDPQTEAIVMIGEIGGSAEEEAAAYIKEH----VTKPVVG 231

Query: 242 FVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLG 298
           ++AG TAP G+ MGHAGA+I+GGKG A++K  A++ AG+    S A IG +L  +L 
Sbjct: 232 YIAGVTAPKGKRMGHAGAIIAGGKGTADEKFAALEAAGVKTVRSLADIGEALKTVLK 288


>gi|157835426|pdb|2NU7|A Chain A, C123as Mutant Of E. Coli Succinyl-Coa Synthetase Length = 288 Back     alignment and structure
>gi|157835430|pdb|2NU8|A Chain A, C123at Mutant Of E. Coli Succinyl-Coa Synthetase Length = 288 Back     alignment and structure
>gi|6980727|pdb|1CQI|A Chain A, Crystal Structure Of The Complex Of Adp And Mg2+ With Dephosphorylated E. Coli Succinyl-Coa Synthetase Length = 286 Back     alignment and structure
>gi|157835442|pdb|2NUA|A Chain A, C123av Mutant Of E. Coli Succinyl-Coa Synthetase Length = 288 Back     alignment and structure
>gi|5822495|pdb|2SCU|A Chain A, A Detailed Description Of The Structure Of Succinyl-Coa Synthetase From Escherichia Coli Length = 288 Back     alignment and structure
>gi|157835434|pdb|2NU9|A Chain A, C123at Mutant Of E. Coli Succinyl-Coa Synthetase Orthorhombic Crystal Form Length = 288 Back     alignment and structure
>gi|157835422|pdb|2NU6|A Chain A, C123aa Mutant Of E. Coli Succinyl-Coa Synthetase Length = 288 Back     alignment and structure
>gi|158431280|pdb|2YV2|A Chain A, Crystal Structure Of Succinyl-Coa Synthetase Alpha Chain From Aeropyrum Pernix K1 Length = 297 Back     alignment and structure
gi|158431279|pdb|2YV1|A Chain A, Crystal Structure Of Succinyl-Coa Synthetase Alpha Chain From Methanocaldococcus Jannaschii Dsm 2661 Length = 294 Back     alignment and structure
>gi|90109572|pdb|2FPG|A Chain A, Crystal Structure Of Pig Gtp-Specific Succinyl-Coa Synthetase In Complex With Gdp Length = 305 Back     alignment and structure
>gi|33357757|pdb|1OI7|A Chain A, The Crystal Structure Of Succinyl-Coa Synthetase Alpha Subunit From Thermus Thermophilus Length = 288 Back     alignment and structure
>gi|9955019|pdb|1EUC|A Chain A, Crystal Structure Of Dephosphorylated Pig Heart, Gtp- Specific Succinyl-Coa Synthetase Length = 311 Back     alignment and structure
>gi|90109554|pdb|2FP4|A Chain A, Crystal Structure Of Pig Gtp-Specific Succinyl-Coa Synthetase In Complex With Gtp Length = 305 Back     alignment and structure
>gi|9955021|pdb|1EUD|A Chain A, Crystal Structure Of Phosphorylated Pig Heart, Gtp-Specific Succinyl-Coa Synthetase Length = 311 Back     alignment and structure
>gi|298508702|pdb|3MWE|B Chain B, Truncated Human Atp-Citrate Lyase With Tartrate Bound Length = 335 Back     alignment and structure
>gi|298508700|pdb|3MWD|B Chain B, Truncated Human Atp-Citrate Lyase With Citrate Bound Length = 334 Back     alignment and structure
>gi|112490214|pdb|2CSU|A Chain A, Crystal Structure Of Ph0766 From Pyrococcus Horikoshii Ot3 Length = 457 Back     alignment and structure
>gi|195927598|pdb|3DMY|A Chain A, Crystal Structure Of A Predicated Acyl-Coa Synthetase From E.Coli Length = 480 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target300 succinyl-CoA synthetase subunit alpha [Candidatus Liber
3mwd_B334 ATP-citrate synthase; ATP-grAsp, phosphohistidine, orga 4e-87
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, riken 5e-82
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mitochon 2e-72
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; citric 2e-70
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding domain 1e-66
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; COA-bi 7e-66
3dmy_A 480 Protein FDRA; predicted actyl-COA synthetase, nysgrc, P 7e-50
2csu_A 457 457AA long hypothetical protein; structural genomics, P 9e-28
3dmy_A480 Protein FDRA; predicted actyl-COA synthetase, nysgrc, P 5e-04
>3mwd_B ATP-citrate synthase; ATP-grAsp, phosphohistidine, organic acid, lyase, transferas; HET: CIT; 2.10A {Homo sapiens} PDB: 3mwe_B* Length = 334 Back     alignment and structure
 Score =  316 bits (811), Expect = 4e-87
 Identities = 86/319 (26%), Positives = 143/319 (44%), Gaps = 22/319 (6%)

Query: 1   MSILVDKNTKVLVQGLTGKA--GTFHTEQAILYCQTQVVGGIHPKKGST----YWTGGNV 54
            + L  ++TK +V G+  +A  G    +      +  V   ++P  G      YW    +
Sbjct: 3   STTLFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQKFYWGHKEI 62

Query: 55  NVPVFTTVAEAKERT-AANASVIYVPPSGAGDAIIESIE-AEIPLIVCITEGIPVLDMVR 112
            +PVF  +A+A  +    +  + +     A D+ +E++  A+I  I  I EGIP     +
Sbjct: 63  LIPVFKNMADAMRKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRK 122

Query: 113 VKARLEKSSSRLIGPNCPGILTPDSCKIG--------IMPGSIFRKGSVGILSRSGTLTY 164
           +  + ++    +IGP   G + P   KIG        I+   ++R GSV  +SRSG ++ 
Sbjct: 123 LIKKADQKGVTIIGPATVGGIKPGCFKIGNTGGMLDNILASKLYRPGSVAYVSRSGGMSN 182

Query: 165 EAVFQTSQEGLGQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAA 224
           E     S+   G    V IGGD   G+ F+D +  +      + IV++GEIGG+ E +  
Sbjct: 183 ELNNIISRTTDGVYEGVAIGGDRYPGSTFMDHVLRYQDTPGVKMIVVLGEIGGTEEYKIC 242

Query: 225 QFLKDEAKRGRKKPIVGFVAGKTA---PPGRTMGHAGAVISGGKGGAEDKINAMKEAGIC 281
           + +K+       KPIV +  G  A         GHAGA  +     A  K  A+KEAG+ 
Sbjct: 243 RGIKE---GRLTKPIVCWCIGTCATMFSSEVQFGHAGACANQASETAVAKNQALKEAGVF 299

Query: 282 IAPSPARIGRSLVELLGSL 300
           +  S   +G  +  +   L
Sbjct: 300 VPRSFDELGEIIQSVYEDL 318


>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Length = 288 Back     alignment and structure
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Length = 305 Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, rossmann fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Length = 288 Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix K1} Length = 297 Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii DSM2661} Length = 294 Back     alignment and structure
>3dmy_A Protein FDRA; predicted actyl-COA synthetase, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.07A {Escherichia coli K12} Length = 480 Back     alignment and structure
>2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii OT3} SCOP: c.2.1.8 c.23.4.1 c.23.4.1 Length = 457 Back     alignment and structure
>3dmy_A Protein FDRA; predicted actyl-COA synthetase, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.07A {Escherichia coli K12} Length = 480 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target300 succinyl-CoA synthetase subunit alpha [Candidatus Liber
2fp4_A305 Succinyl-COA ligase [GDP-forming] alpha-chain, mitochon 100.0
3mwd_B334 ATP-citrate synthase; ATP-grAsp, phosphohistidine, orga 100.0
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; COA-bi 100.0
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; citric 100.0
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding domain 100.0
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, riken 100.0
2csu_A 457 457AA long hypothetical protein; structural genomics, P 100.0
3dmy_A 480 Protein FDRA; predicted actyl-COA synthetase, nysgrc, P 100.0
2duw_A145 Putative COA-binding protein; ligand binding protein; N 99.67
1y81_A138 Conserved hypothetical protein; hyperthermophIle, struc 99.66
2d59_A144 Hypothetical protein PH1109; COA binding, structural ge 99.52
1iuk_A140 Hypothetical protein TT1466; structural genomics, riken 99.44
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 2, p 99.23
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural genomic 98.58
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET: NDP 98.44
3euw_A344 MYO-inositol dehydrogenase; protein structure initiativ 98.44
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural genomic 98.35
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, deco 98.33
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, structural 98.27
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, MCSG 98.26
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhi 98.18
3ezy_A344 Dehydrogenase; structural genomics, unknown function, P 98.17
3db2_A354 Putative NADPH-dependent oxidoreductase; ZP_01370612.1, 98.17
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, PSI- 98.17
3ec7_A357 Putative dehydrogenase; alpha-beta, structural genomics 98.17
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural genomic 98.13
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreductase 98.12
3kux_A352 Putative oxidoreductase; oxidoreductase family, csgid, 98.12
1ydw_A362 AX110P-like protein; structural genomics, protein struc 98.1
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI- 98.09
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural genomi 98.04
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI- 98.03
1tlt_A319 Putative oxidoreductase (virulence factor MVIM homolog) 97.99
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2, NYS 97.97
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO- 97.97
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural genomics 97.96
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, 97.88
1zh8_A340 Oxidoreductase; TM0312, structural genomics, joint cent 97.85
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependent red 97.83
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CI 97.77
1vm6_A228 DHPR, dihydrodipicolinate reductase; TM1520, structural 97.77
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lysine b 97.7
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase 97.69
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural genomic 97.68
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; reductive methylat 97.58
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomics, J 97.55
2nvw_A 479 Galactose/lactose metabolism regulatory protein GAL80; 97.54
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; prot 97.51
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrrole, b 97.45
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural genomic 97.44
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxidoreduc 97.41
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI-2, p 97.18
3btv_A 438 Galactose/lactose metabolism regulatory protein GAL80; 97.12
3oqb_A383 Oxidoreductase; structural genomics, protein structure 97.04
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha-amin 96.99
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenase, ox 96.93
3dty_A398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, P 96.82
3ic5_A118 Putative saccharopine dehydrogenase; structural genomic 96.27
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, sacc 96.14
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eight kno 95.66
1yrl_A 491 Ketol-acid reductoisomerase; branched-chain amino acid 95.47
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; HET: 95.24
3dzb_A317 Prephenate dehydrogenase; domain SWAP, PSI2, NYSGXRC, t 95.21
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, s 94.66
1vpd_A299 Tartronate semialdehyde reductase; structural genomics, 94.27
3fr7_A 525 Putative ketol-acid reductoisomerase (OS05G0573700 prot 94.03
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysi 93.75
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine cata 93.56
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC6014, ps 93.06
1yb4_A295 Tartronic semialdehyde reductase; structural genomics, 92.99
2zyd_A 480 6-phosphogluconate dehydrogenase, decarboxylating; NADP 92.77
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, 92.26
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydroxybut 91.45
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural 91.31
2iz1_A 474 6-phosphogluconate dehydrogenase, decarboxylating; NADP 91.11
1yqg_A263 Pyrroline-5-carboxylate reductase; structural genomics, 90.76
3l6d_A306 Putative oxidoreductase; structural genomics, protein s 90.68
1mb4_A370 Aspartate-semialdehyde dehydrogenase; enzyme, complex, 90.56
3dmy_A480 Protein FDRA; predicted actyl-COA synthetase, nysgrc, P 98.6
2csu_A457 457AA long hypothetical protein; structural genomics, P 98.42
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreducta 98.15
2o4u_X334 Dimeric dihydrodiol dehydrogenase; NADP-binding rossman 97.83
2g0t_A350 Conserved hypothetical protein; TM0796, structural geno 97.15
2obn_A349 Hypothetical protein; protein of unknown function DUF16 96.47
2vt3_A215 REX, redox-sensing transcriptional repressor REX; trans 97.95
3keo_A212 Redox-sensing transcriptional repressor REX; DNA bindin 97.66
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossmann f 97.65
3d1l_A266 Putative NADP oxidoreductase BF3122; structural genomic 94.49
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reductase; s 94.47
2fp4_B395 Succinyl-COA ligase [GDP-forming] beta-chain, mitochond 97.54
2nu8_B388 SCS-beta, succinyl-COA synthetase beta chain; citric ac 97.52
2b0j_A358 5,10-methenyltetrahydromethanopterin hydrogenase; rossm 95.83
3bf0_A 593 Protease 4; bacterial, hydrolase, inner membrane, membr 95.75
3mwd_A425 ATP-citrate synthase; ATP-grAsp, phosphohistidine, orga 92.94
>2fp4_A Succinyl-COA ligase [GDP-forming] alpha-chain, mitochondrial; active site phosphohistidine residue; HET: NEP GTP; 2.08A {Sus scrofa} SCOP: c.2.1.8 c.23.4.1 PDB: 2fpg_A* 2fpi_A* 2fpp_A* 1euc_A* 1eud_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=662.11  Aligned_cols=294  Identities=61%  Similarity=1.022  Sum_probs=285.2

Q ss_pred             EEEEECCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCEEECCCCCCCCCCCCHHHHCCCCCCCEEEEECCHH
Q ss_conf             56771797399988884377999999986269818997658998868727745775314078503578863688621204
Q gi|254781050|r    2 SILVDKNTKVLVQGLTGKAGTFHTEQAILYCQTQVVGGIHPKKGSTYWTGGNVNVPVFTTVAEAKERTAANASVIYVPPS   81 (300)
Q Consensus         2 sil~~~~t~vivqGitg~~g~~~~~~~~~y~gt~ivagV~Pgkgg~~~~g~~~~iPvy~sv~ea~~~~~~D~avI~VP~~   81 (300)
                      +||+||||||||||||||+|+||+++|++| |||||+||||+|||+++.|    +|||+||+||++++++|+++|||||+
T Consensus         8 ~i~~~~~t~v~vqGitg~~g~~~~~~m~~y-gt~iv~GV~P~kgG~~v~G----vPvy~SV~ea~~~~~~d~aiI~vPa~   82 (305)
T 2fp4_A            8 HLYVDKNTKVICQGFTGKQGTFHSQQALEY-GTNLVGGTTPGKGGKTHLG----LPVFNTVKEAKEQTGATASVIYVPPP   82 (305)
T ss_dssp             GGCCCTTCEEEEETTTSHHHHHHHHHHHHH-TCEEEEEECTTCTTCEETT----EEEESSHHHHHHHHCCCEEEECCCHH
T ss_pred             CEEECCCCEEEEECCCCCHHHHHHHHHHHH-CCCEEEEECCCCCCCEEEC----CCCCCCHHHHHHCCCCCEEEECCCHH
T ss_conf             289779986999879884766999999984-8967985579978734338----43538299996241753166514878


Q ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHH-HHHHCCCCEEEECCCCEEECCCCHHCCEECCCCCCCCCEEEEEECC
Q ss_conf             567889999853995899805884688899999-9840177189406851013555100020011235778679998054
Q gi|254781050|r   82 GAGDAIIESIEAEIPLIVCITEGIPVLDMVRVK-ARLEKSSSRLIGPNCPGILTPDSCKIGIMPGSIFRKGSVGILSRSG  160 (300)
Q Consensus        82 ~v~dai~Ea~~agik~iviiteGip~~d~~~l~-~~A~~~g~riiGPNc~Gii~p~~~~lgi~p~~~~~pG~VgivSqSG  160 (300)
                      +++|+++||+++|+|.+||||||||++|+++++ ++|+++++|||||||+|+++|+..+++++|...++||+||++||||
T Consensus        83 ~v~~ai~ea~~~gi~~iViit~Gf~e~~~~~~~~~~a~~~g~riiGPNc~Gii~p~~~~~~~~~~~~~~~G~vgiiSqSG  162 (305)
T 2fp4_A           83 FAAAAINEAIDAEVPLVVCITEGIPQQDMVRVKHRLLRQGKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSG  162 (305)
T ss_dssp             HHHHHHHHHHHTTCSEEEECCCCCCHHHHHHHHHHHTTCSSCEEECSSSCEEEETTTEEEESSCGGGCCEEEEEEEESCS
T ss_pred             HHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHCCCCEEECCCCCCCCCCCCCEEEECCCCCCCCCCEEEEEECC
T ss_conf             88999999875567889990599975537999999974289689889987663766245751675346776614998224


Q ss_pred             CHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCHHHHHHHHHCCCCCCEEEEEEECCCHHHHHHHHHHHHHHHCCCCCCEE
Q ss_conf             14789999999719951676405567446789999999997399872889997058724899999999864226755268
Q gi|254781050|r  161 TLTYEAVFQTSQEGLGQSTAVGIGGDPVKGTEFIDVLELFLADEATESIVMVGEIGGSAEEEAAQFLKDEAKRGRKKPIV  240 (300)
Q Consensus       161 ~l~~e~~~~~~~~g~G~S~~VsiG~D~~~G~~~~d~L~~~~~Dp~T~~Ivl~gEiGG~~E~~aa~fi~~~~~~~~~KPVv  240 (300)
                      +|++++++|++++|+|||++||+|||+++|++|.|+|+||++||+|++|+||+|++|+.|+.+++|++++++..++||||
T Consensus       163 ~l~~~i~~~~~~~G~G~S~~Vs~Gn~~~~g~~~~D~L~~l~~Dp~Tk~I~ly~E~~~~~e~~~~~~~~a~~~~~~~KPVV  242 (305)
T 2fp4_A          163 TLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFTDCLEIFLNDPATEGIILIGEIGGNAEENAAEFLKQHNSGPKSKPVV  242 (305)
T ss_dssp             HHHHHHHHHHHHTTCCEEEEEECCSSSSCSCCHHHHHHHHHHCTTCCEEEEEEESSSSHHHHHHHHHHHHSCSTTCCCEE
T ss_pred             HHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCHHHHHHHHHCCCCCCEEEEEEEECCCHHHHHHHHHHHHHHCCCCCCEE
T ss_conf             38999999999769987999807988668998899999985498873899998644746778889999997467787579


Q ss_pred             EEEEEECCCCCCCCCEEEEECCCCCCCHHHHHHHHHHCCCEECCCHHHHHHHHHHHHHCC
Q ss_conf             998430157655322001122488889999999999889757889899999999998439
Q gi|254781050|r  241 GFVAGKTAPPGRTMGHAGAVISGGKGGAEDKINAMKEAGICIAPSPARIGRSLVELLGSL  300 (300)
Q Consensus       241 a~~~GrtAp~g~~~gHaGAi~~~~~g~a~~k~~al~~aGv~v~~s~~el~~~l~~~l~~l  300 (300)
                      +||+|||+|.+++||||||+++++.++++.|.++||||||+++++|+||+++|+++|.++
T Consensus       243 a~k~Grsa~~~~a~sHtGAia~~~~g~~~~~~aa~rqaGVi~v~s~~El~~~l~~~~~~~  302 (305)
T 2fp4_A          243 SFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKITALQSAGVVVSMSPAQLGTTIYKEFEKR  302 (305)
T ss_dssp             EEEECTTCCTTCCCSSTTCCCBTTBCCHHHHHHHHHHTTCEECSSTTCHHHHHHHHHHHT
T ss_pred             EEEECCCCCCCCCCCCHHHHCCCCCCCHHHHHHHHHHCCCEECCCHHHHHHHHHHHHHHC
T ss_conf             998324478656466265410478888999999999888868699999999999999864



>3mwd_B ATP-citrate synthase; ATP-grAsp, phosphohistidine, organic acid, lyase, transferas; HET: CIT; 2.10A {Homo sapiens} PDB: 3mwe_B* Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, rossmann fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix K1} Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>2csu_A 457AA long hypothetical protein; structural genomics, PH0766, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.20A {Pyrococcus horikoshii OT3} SCOP: c.2.1.8 c.23.4.1 c.23.4.1 Back     alignment and structure
>3dmy_A Protein FDRA; predicted actyl-COA synthetase, nysgrc, PSI-II, structural genomics, protein structure initiative; 2.07A {Escherichia coli K12} Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.65A {Pyrococcus horikoshii OT3} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- 2, protein structure initiative, midwest center for structural genomics; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis W83} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genomics, protein structure initiative, PSI; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; ZP_01370612.1, structural genomics, joint center for structural genomics, JCSG; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium LT2} Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase family, NAD-binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum ms-1} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center for structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM homolog); structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; HET: MSE NAP; 2.50A {Thermotoga maritima MSB8} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, JCSG, protein structure initiative, PSI; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>2ho3_A Oxidoreductase, GFO/IDH/MOCA family; reductive methylation, structural genomics, PSI 2, protein structure initiative; HET: MLY; 2.00A {Streptococcus pneumoniae} PDB: 2ho5_A Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3btu_A Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, PSI-2, protein structure initiative; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure