254781051

254781051

alpha-ketoglutarate decarboxylase

GeneID in NCBI database:8210074Locus tag:CLIBASIA_04765
Protein GI in NCBI database:254781051Protein Accession:YP_003065464.1
Gene range:+(1052903, 1055776)Protein Length:957aa
Gene description:alpha-ketoglutarate decarboxylase
COG prediction:[C] 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes
KEGG prediction:kgd; alpha-ketoglutarate decarboxylase (EC:1.2.4.2); K00164 2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
SEED prediction:2-oxoglutarate dehydrogenase E1 component (EC 1.2.4.2)
Pathway involved in KEGG:Citrate cycle (TCA cycle) [PATH:las00020]
Lysine degradation [PATH:las00310]
Tryptophan metabolism [PATH:las00380]
Subsystem involved in SEED:TCA Cycle
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------
MLQDLNKMFSLSSFLDGTNCCYIEDLYKSYQEDPSSVCKDWYPLFSFLDENSEEYDNLEDGIASFLKEESVASAVFSQKKSAVESSCSLGETQSVKDFFQVMKMIDAYRSYGHFKANIDPLGYNSHQKDLSELSPAHYGFVKADYDRKICMKGVLGLESATIPEIVDVLSHLYCSNIGVEFMHIVDSIERDWVRNTIEDYDFSSNFSKEEQRDILDKLVRAEGFEKFIDIKYKGAKRFGADGSEVIIPAIEEIIRQGVQQGVDEMILGMAHRGRLNVLSQIMNKLPRSIFYEFKGKGPSEKEYSGDVKYHLGLCCNRQICGKDVKLLLQSNPSHLEFVDPVVIGSVRARQDLKAGIVGEKSISLVERSRVLPLIIHGDAAFAGQGIVSETFGLSGLSGYTVAGNIHLIINNQIGFTTNPSSARSCTYASDISKSIGIPIFHVNGDDPEAVIRVVRMAVSFRMKFHKSVVIDIVCYRRFGHNEGDEPSFTQPMMYKTIRSHKSVLQLYADSLMKNQVISKQELQSLANNWHKYLEAEYKESESYCPEKLGLLHNGENERKNSVSKEILKKIGSSIIRLPKSFNTHKIVERLMANRQKMIETGKGIDWSMAESLAFGSLCYEGYKVRLSGQDCERGTFSHRHAILCDQETGKRYFPLGNISKDQGHCEVVNSFLSEQAVLGFEYGYSLNNLNALTIWEAQFGDFANGAQVILDQFITAGEQKWLCTSNLVCLLPHGYEGQGPEHSSARLERFLQMCAENNMYVANCTSPANYFHILRRQIYDRSSRPLIMMAPKSLLRHKRVVSSLSDMTCGSVFQAVLSDDAEYHGKTSVKLKEDSHIRRVILCTGKVYYDLLDNRDMRNIADIYLLRIEQLYPFPEDYLIKVLSRFVQAEIVWCQEEPQNMGAWTFIEPYLEKVLHSIGADYSRVRYVGRLPSASTAVGHMSRHLEQLSSFIEDALK
ccccHHHHHHHccccccccHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccccccccccccccHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHccccccccccccccccccHHHccccHHHHccEEEcccccccccccHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccEEccccHHHHHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHcccHHHHHHHHcccccccccccccccEEEEccccccccccEEEEEEccccHHHHccccEEEEEccccccccccccHHHHccccccccEEEEEEEccccccccHHHHHHHHHHHHHccccccEEEEEEEccEEEEEcHHHHcccccHHHHHHHHcccEEEEccccHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHccccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccEEEEEEcccccccccEEEEEEEcccccEEEEEcccccccccEEEEcccccHHHHHHHHHHHHHcccccEEEccHHHHcccccHHHHHHHHHHHHHHHHHHcccEEEEcccccccccccccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccccEEEEccHHHHHcccccccHHHHccccccEEccccccccccccccccccHHHEEEEEEEccHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHHHccccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHc
ccccHHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHccccccccccccccccHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccHHcccccccccccccccccccHHHccccHHHccccEEcccccccccccHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccEcccccHHHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHHccccHHHHHHHHccccccccccccccEEccccccccccccccEEEEEEEcccccEEEcccEEEEEEEcccccccccccccccccccccEEEEEEEccHHHHcccEHHHHHHHccccccccccEEEEEEEcccccccccccccccccccHHHHHccccEEEEccccHHHHHHHHHHHHHHHHHHcccEEEEEEEEEccccccccccccccHHHHHHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccEEEEccccccccEEccEEEEEEccccccEEEHHHcccccccEEEEEccccHHHHHHHHHcccccccccEEEEEHEccccccccEEEEEHHccccHHHHHHHcHHHHEcccccccccccccHHHHHHHHHHHHHcccEEEccccHHHHHHHHHHHHHHcccccEEEEccHHHHccHHHHccHHHHHccccccEEccccHccccccccccccHHHcEEEEEEccHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHHHHcccccEEEEcccccccccEEEccHHHHHHHHHHcccccccEEcccccccccHHHHHHHHHHHHHHHHHHHHc
mlqdlnkmfslssfldgtnccyiEDLYKsyqedpssvckdwyplfsfldenseeydnLEDGIASFLKEESVASAVFSQKKSAvesscslgetqsVKDFFQVMKMIDAYrsyghfkanidplgynshqkdlselspahygfvkadydrkicmkgvlglesatiPEIVDVLSHLYCSNIGVEFMHIVDSIERDWVrntiedydfssnfskeEQRDILDKLVRAEGFEKFIDIKYKGakrfgadgsevIIPAIEEIIRQGVQQGVDEMILGMAHRGRLNVLSQIMNKLPRSifyefkgkgpsekeysgdvkYHLGlccnrqicgkdvklllqsnpshlefvdpvvigsvrarqdlkagivgeKSISLVersrvlpliihgdaafagqgivsetfglsglsgytvaGNIHLIINnqigfttnpssarsctyasdisksigipifhvngddpEAVIRVVRMAVSFRMKFHKSVVIDIVCYrrfghnegdepsftqpmmykTIRSHKSVLQLYADSLMKNQVISKQELQSLANNWHKYLEAEYKesesycpeklgllhngenerknSVSKEILKKIGSSiirlpksfnTHKIVERLMANRQKMIETGKGIDWSMAESLAFGSLCYEgykvrlsgqdcergtfshrhailcdqetgkryfplgniskdqghcEVVNSFLSEQAVLGFEYGYSLNNLNALTIWEAQFGDFANGAQVILDQFITAGEQKWlctsnlvcllphgyegqgpehssARLERFLQMCAENNmyvanctspanyFHILRRQiydrssrplimmapkSLLRHKrvvsslsdmtcgSVFQAVlsddaeyhgktsvklkedsHIRRVILCTGKVYydlldnrdmrNIADIYLLRIeqlypfpedYLIKVLSRFVQAEIVWcqeepqnmgawtFIEPYLEKVLHSIgadysrvryvgrlpsastavGHMSRHLEQLSSFIEDALK
MLQDLNKMFSLSSFLDGTNCCYIEDLYKSYQEDPSSVCKDWYPLFSFLDENSEEYDNLEDGIASFLKEESVASAVFSQKKSavesscslgetqsvkDFFQVMKMIDAYRSYGHFKANIDPLGYNSHQKDLSELSPAHYGFVKADYDRKICMKGVLGLESATIPEIVDVLSHLYCSNIGVEFMHIVDSIERDWVRNTIEdydfssnfskeeqRDILDKLVRAEGFEKFIDIKYKGAKRFGADGSEVIIPAIEEIIRQGVQQGVDEMILGMAHRGRLNVLSQIMNKLPRSIFYEFKGKGPSEKEYSGDVKYHLGLCCNRQICGKDVKLLLQSNPSHLEFVDPVVIGSVRArqdlkagivgeksislveRSRVLPLIIHGDAAFAGQGIVSETFGLSGLSGYTVAGNIHLIINNQIGFTTNPSSARSCTYASDISKSIGIPIFHVNGDDPEAVIRVVRMAVSFRMKFHKSVVIDIVCYRRFGhnegdepsftqpMMYKTIRSHKSVLQLYADSLMKNQVISKQELQSLANNWHKYLEAEYKESESYCPEKLGllhngenerknsVSKEILKKIgssiirlpksfnTHKIVERLMANRQKMIETGKGIDWSMAESLAFGSLCYEGYKVRLSGQDCERGTFSHRHAILCDQETGKRYFPLGNISKDQGHCEVVNSFLSEQAVLGFEYGYSLNNLNALTIWEAQFGDFANGAQVILDQFITAGEQKWLCTSNLVCLLPHGYEGQGPEHSSARLERFLQMCAENNMYVANCTSPANYFHILRRQIYDRSSRPLIMMAPKSLLRHKRVVSSLSDMTCGSVFQAVLSDDAEYHGKtsvklkedshirrvILCTGKvyydlldnrDMRNIADIYLLRIEQLYPFPEDYLIKVLSRFVQAEIVWCQEEPQNMGAWTFIEPYLEKVLHSIGADYSRVRYVGRLPSASTAVGHMSRHLEQLSSFIEDALK
MLQDLNKMFSLSSFLDGTNCCYIEDLYKSYQEDPSSVCKDWYPLFSFLDENSEEYDNLEDGIASFLKEESVASAVFSQKKSAVESSCSLGETQSVKDFFQVMKMIDAYRSYGHFKANIDPLGYNSHQKDLSELSPAHYGFVKADYDRKICMKGVLGLESATIPEIVDVLSHLYCSNIGVEFMHIVDSIERDWVRNTIEDYDFSSNFSKEEQRDILDKLVRAEGFEKFIDIKYKGAKRFGADGSEVIIPAIEEIIRQGVQQGVDEMILGMAHRGRLNVLSQIMNKLPRSIFYEFKGKGPSEKEYSGDVKYHLGLCCNRQICGKDVKLLLQSNPSHLEFVDPVVIGSVRARQDLKAGIVGEKSISLVERSRVLPLIIHGDAAFAGQGIVSETFGLSGLSGYTVAGNIHLIINNQIGFTTNPSSARSCTYASDISKSIGIPIFHVNGDDPEAVIRVVRMAVSFRMKFHKSVVIDIVCYRRFGHNEGDEPSFTQPMMYKTIRSHKSVLQLYADSLMKNQVISKQELQSLANNWHKYLEAEYKESESYCPEKLGLLHNGENERKNSVSKEILKKIGSSIIRLPKSFNTHKIVERLMANRQKMIETGKGIDWSMAESLAFGSLCYEGYKVRLSGQDCERGTFSHRHAILCDQETGKRYFPLGNISKDQGHCEVVNSFLSEQAVLGFEYGYSLNNLNALTIWEAQFGDFANGAQVILDQFITAGEQKWLCTSNLVCLLPHGYEGQGPEHSSARLERFLQMCAENNMYVANCTSPANYFHILRRQIYDRSSRPLIMMAPKSLLRHKRVVSSLSDMTCGSVFQAVLSDDAEYHGKTSVKLKEDSHIRRVILCTGKVYYDLLDNRDMRNIADIYLLRIEQLYPFPEDYLIKVLSRFVQAEIVWCQEEPQNMGAWTFIEPYLEKVLHSIGADYSRVRYVGRLPSASTAVGHMSRHLEQLSSFIEDALK
************SFLDGTNCCYIEDLYKSYQEDPSSVCKDWYPLFSFLD************************************************FFQVMKMIDAYRSYGHFKANIDPLGYNSHQKDLSELSPAHYGFVKADYDRKICMKGVLGLESATIPEIVDVLSHLYCSNIGVEFMHIVDSIERDWVRNTIEDY*******KEEQRDILDKLVRAEGFEKFIDIKYKGAKRFGADGSEVIIPAIEEIIRQGVQQGVDEMILGMAHRGRLNVLSQIMNKLPRSIFYEFKGKG***KE*SGDVKYHLGLCCNRQICGKDVKLLLQSNPSHLEFVDPVVIGSVRARQDLKAGIVGEKSISLVERSRVLPLIIHGDAAFAGQGIVSETFGLSGLSGYTVAGNIHLIINNQIGFTTNPSSARSCTYASDISKSIGIPIFHVNGDDPEAVIRVVRMAVSFRMKFHKSVVIDIVCYRRFGHNEGDEPSFTQPMMYKTIRSHKSVLQLYADSLMKNQVISKQELQSLANNWHKYLEAEYKESESYCPEKLGLLHNGENERKNSVSKEILKKIGSSIIRLPKSFNTHKIVERLMANRQKMIETGKGIDWSMAESLAFGSLCYEGYKVRLSGQDCERGTFSHRHAILCDQETGKRYFPLGNISKDQGHCEVVNSFLSEQAVLGFEYGYSLNNLNALTIWEAQFGDFANGAQVILDQFITAGEQKWLCTSNLVCLLPHGYEGQGPEHSSARLERFLQMCAENNMYVANCTSPANYFHILRRQIYDRSSRPLIMMAPKSLLRHKRVVSSLSDMTCGSVFQAVLSDDAEYHGK*****KEDSHIRRVILCTGKVYYDLLDNRDMRNIADIYLLRIEQLYPFPEDYLIKVLSRFVQAEIVWCQEEPQNMGAWTFIEPYLEKVLHSIGADYSRVRYVGRLPSASTAVGHMSRHLEQLSSFIEDALK
MLQDLNKMFSLSSFLDGTNCCYIEDLYKSYQEDPSSVCKDWYPLFSFLDENSEEYDNLEDGIASFLKEESV******************GETQSVKDFFQVMKMIDAYRSYGHFKANIDPLGYNSHQKDLSELSPAHYGFVKADYDRKICMKGVLGLESATIPEIVDVLSHLYCSNIGVEFMHIVDSIERDWVRNTIEDYDFSSNFSKEEQRDILDKLVRAEGFEKFIDIKYKGAKRFGADGSEVIIPAIEEIIRQGVQQGVDEMILGMAHRGRLNVLSQIMNKLPRSIFYEFKGKGPSEKEYSGDVKYHLGLCCNRQICGKDVKLLLQSNPSHLEFVDPVVIGSVRARQDLKAGIVGEKSISLVERSRVLPLIIHGDAAFAGQGIVSETFGLSGLSGYTVAGNIHLIINNQIGFTTNPSSARSCTYASDISKSIGIPIFHVNGDDPEAVIRVVRMAVSFRMKFHKSVVIDIVCYRRFGHNEGDEPSFTQPMMYKTIRSHKSVLQLYADSLMKNQVISKQELQSLANNWHKYLEAEYKESESYCPEKLGLLHNGENERKNSVSKEILKKIGSSIIRLPKSFNTHKIVERLMANRQKMIETGKGIDWSMAESLAFGSLCYEGYKVRLSGQDCERGTFSHRHAILCDQETGKRYFPLGNISKDQGHCEVVNSFLSEQAVLGFEYGYSLNNLNALTIWEAQFGDFANGAQVILDQFITAGEQKWLCTSNLVCLLPHGYEGQGPEHSSARLERFLQMCAENNMYVANCTSPANYFHILRRQIYDRSSRPLIMMAPKSLLRHKRVVSSLSDMTCGSVFQAVLSDDAEYHGKTSVKLKEDSHIRRVILCTGKVYYDLLDNRDMRNIADIYLLRIEQLYPFPEDYLIKVLSRFVQAEIVWCQEEPQNMGAWTFIEPYLEKVLHSIGADYSRVRYVGRLPSASTAVGHMSRHLEQLSSFIEDALK
***DLNKMFSLSSFLDGTNCCYIEDLYKSYQEDPSSVCKDWYPLFSFLDENSEEYDNLEDGIASFLKEESVASAVFSQKKSAVESSCSLGETQSVKDFFQVMKMIDAYRSYGHFKANIDPLGYNSHQKDLSELSPAHYGFVKADYDRKICMKGVLGLESATIPEIVDVLSHLYCSNIGVEFMHIVDSIERDWVRNTIEDYDFSSNFSKEEQRDILDKLVRAEGFEKFIDIKYKGAKRFGADGSEVIIPAIEEIIRQGVQQGVDEMILGMAHRGRLNVLSQIMNKLPRSIFYEFKGKGPSEKEYSGDVKYHLGLCCNRQICGKDVKLLLQSNPSHLEFVDPVVIGSVRARQDLKAGIVGEKSISLVERSRVLPLIIHGDAAFAGQGIVSETFGLSGLSGYTVAGNIHLIINNQIGFTTNPSSARSCTYASDISKSIGIPIFHVNGDDPEAVIRVVRMAVSFRMKFHKSVVIDIVCYRRFGHNEGDEPSFTQPMMYKTIRSHKSVLQLYADSLMKNQVISKQELQSLANNWHKYLEAEYKESESYCPEKLGLLHNGENERKNSVSKEILKKIGSSIIRLPKSFNTHKIVERLMANRQKMIETGKGIDWSMAESLAFGSLCYEGYKVRLSGQDCERGTFSHRHAILCDQETGKRYFPLGNISKDQGHCEVVNSFLSEQAVLGFEYGYSLNNLNALTIWEAQFGDFANGAQVILDQFITAGEQKWLCTSNLVCLLPHGYEGQGPEHSSARLERFLQMCAENNMYVANCTSPANYFHILRRQIYDRSSRPLIMMAPKSLLRHKRVVSSLSDMTCGSVFQAVLSDDAEYHGKTSVKLKEDSHIRRVILCTGKVYYDLLDNRDMRNIADIYLLRIEQLYPFPEDYLIKVLSRFVQAEIVWCQEEPQNMGAWTFIEPYLEKVLHSIGADYSRVRYVGRLPSASTAVGHMSRHLEQLSSFIEDALK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLQDLNKMFSLSSFLDGTNCCYIEDLYKSYQEDPSSVCKDWYPLFSFxxxxxxxxxxxxxxxxxxxxxESVASAVFSQKKSAVESSCSLGETQSVKDFFQVMKMIDAYRSYGHFKANIDPLGYNSHQKDLSELSPAHYGFVKADYDRKICMKGVLGLESATIPEIVDVLSHLYCSNIGVEFMHIVDSIERDWVRNTIEDYDFSSNFSKEEQRDILDKLVRAEGFEKFIDIKYKGAKRFGADGSEVIIPAIEEIIRQGVQQGVDEMILGMAHRGRLNVLSQIMNKLPRSIFYEFKGKGPSEKEYSGDVKYHLGLCCNRQICGKDVKLLLQSNPSHLEFVDPVVIGSVRARQDLKAGIVGEKSISLVERSRVLPLIIHGDAAFAGQGIVSETFGLSGLSGYTVAGNIHLIINNQIGFTTNPSSARSCTYASDISKSIGIPIFHVNGDDPEAVIRVVRMAVSFRMKFHKSVVIDIVCYRRFGHNEGDEPSFTQPMMYKTIRSHKSVLQLYADSLMKNQVISKQELQSLANNWHKYLEAEYKESESYCPEKLGLLHNGENERKNSVSKEILKKIGSSIIRLPKSFNTHKIVERLMANRQKMIETGKGIDWSMAESLAFGSLCYEGYKVRLSGQDCERGTFSHRHAILCDQETGKRYFPLGNISKDQGHCEVVNSFLSEQAVLGFEYGYSLNNLNALTIWEAQFGDFANGAQVILDQFITAGEQKWLCTSNLVCLLPHGYEGQGPEHSSARLERFLQMCAENNMYVANCTSPANYFHILRRQIYDRSSRPLIMMAPKSLLRHKRVVSSLSDMTCGSVFQAVLSDDAEYHGKTSVKLKEDSHIRRVILCTGKVYYDLLDNRDMRNIADIYLLRIEQLYPFPEDYLIKVLSRFVQAEIVWCQEEPQNMGAWTFIEPYLEKVLHSIGADYSRVRYVGRLPSASTAVGHMSRHLEQLSSFIEDALK
MLQDLNKMFSLSSFLDGTNCCYIEDLYKSYQEDPSSVCKDWYPLFSFLDENSEEYDNLEDGIASFLKEESVASAVFSQKKSAVESSCSLGETQSVKDFFQVMKMIDAYRSYGHFKANIDPLGYNSHQKDLSELSPAHYGFVKADYDRKICMKGVLGLESATIPEIVDVLSHLYCSNIGVEFMHIVDSIERDWVRNTIEDYDFSSNFSKEEQRDILDKLVRAEGFEKFIDIKYKGAKRFGADGSEVIIPAIEEIIRQGVQQGVDEMILGMAHRGRLNVLSQIMNKLPRSIFYEFKGKGPSEKEYSGDVKYHLGLCCNRQICGKDVKLLLQSNPSHLEFVDPVVIGSVRARQDLKAGIVGEKSISLVERSRVLPLIIHGDAAFAGQGIVSETFGLSGLSGYTVAGNIHLIINNQIGFTTNPSSARSCTYASDISKSIGIPIFHVNGDDPEAVIRVVRMAVSFRMKFHKSVVIDIVCYRRFGHNEGDEPSFTQPMMYKTIRSHKSVLQLYADSLMKNQVISKQELQSLANNWHKYLEAEYKESESYCPEKLGLLHNGENERKNSVSKEILKKIGSSIIRLPKSFNTHKIVERLMANRQKMIETGKGIDWSMAESLAFGSLCYEGYKVRLSGQDCERGTFSHRHAILCDQETGKRYFPLGNISKDQGHCEVVNSFLSEQAVLGFEYGYSLNNLNALTIWEAQFGDFANGAQVILDQFITAGEQKWLCTSNLVCLLPHGYEGQGPEHSSARLERFLQMCAENNMYVANCTSPANYFHILRRQIYDRSSRPLIMMAPKSLLRHKRVVSSLSDMTCGSVFQAVLSDDAEYHGKTSVKLKEDSHIRRVILCTGKVYYDLLDNRDMRNIADIYLLRIEQLYPFPEDYLIKVLSRFVQAEIVWCQEEPQNMGAWTFIEPYLEKVLHSIGADYSRVRYVGRLPSASTAVGHMSRHLEQLSSFIEDALK
MLQDLNKMFSLSSFLDGTNCCYIEDLYKSYQEDPSSVCKDWYPLFSFLDENSEEYDNLEDGIASFLKEESVASAVFSQKKSAVESSCSLGETQSVKDFFQVMKMIDAYRSYGHFKANIDPLGYNSHQKDLSELSPAHYGFVKADYDRKICMKGVLGLESATIPEIVDVLSHLYCSNIGVEFMHIVDSIERDWVRNTIEDYDFSSNFSKEEQRDILDKLVRAEGFEKFIDIKYKGAKRFGADGSEVIIPAIEEIIRQGVQQGVDEMILGMAHRGRLNVLSQIMNKLPRSIFYEFKGKGPSEKEYSGDVKYHLGLCCNRQICGKDVKLLLQSNPSHLEFVDPVVIGSVRARQDLKAGIVGEKSISLVERSRVLPLIIHGDAAFAGQGIVSETFGLSGLSGYTVAGNIHLIINNQIGFTTNPSSARSCTYASDISKSIGIPIFHVNGDDPEAVIRVVRMAVSFRMKFHKSVVIDIVCYRRFGHNEGDEPSFTQPMMYKTIRSHKSVLQLYADSLMKNQVISKQELQSLANNWHKYLEAEYKESESYCPEKLGLLHNGENERKNSVSKEILKKIGSSIIRLPKSFNTHKIVERLMANRQKMIETGKGIDWSMAESLAFGSLCYEGYKVRLSGQDCERGTFSHRHAILCDQETGKRYFPLGNISKDQGHCEVVNSFLSEQAVLGFEYGYSLNNLNALTIWEAQFGDFANGAQVILDQFITAGEQKWLCTSNLVCLLPHGYEGQGPEHSSARLERFLQMCAENNMYVANCTSPANYFHILRRQIYDRSSRPLIMMAPKSLLRHKRVVSSLSDMTCGSVFQAVLSDDAEYHGKTSVKLKEDSHIRRVILCTGKVYYDLLDNRDMRNIADIYLLRIEQLYPFPEDYLIKVLSRFVQAEIVWCQEEPQNMGAWTFIEPYLEKVLHSIGADYSRVRYVGRLPSASTAVGHMSRHLEQLSSFIEDALK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target957 alpha-ketoglutarate decarboxylase [Candidatus Liberibac
255764490364 dehydrogenase, E1 component [Candidatus Liberibact 1e-10
>gi|255764490|ref|YP_003065085.2| dehydrogenase, E1 component [Candidatus Liberibacter asiaticus str. psy62] Length = 364 Back     alignment
 Score = 60.8 bits (146), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 85/177 (48%), Gaps = 6/177 (3%)

Query: 367 RSRVLPLIIHGDAAFAGQGIVSETFGLSGLSGYTVAGNIHLIINNQIGFTTNPSSARSCT 426
           RS  + ++  GD A A QG V E+F ++ L    V   I++I NNQ    T+ S A + T
Sbjct: 178 RSDKICVVCFGDGA-ANQGQVYESFNIAALWNLNV---IYVIENNQYAMGTSVSRASAQT 233

Query: 427 YASDISKSIGIPIFHVNGDDPEAVIRVVRMAVSFRMKFHKSVVIDIVCYRRFGHNEGDEP 486
             S    S  IP   V+G D  AV   +  AV++       ++I+++ YR  GH+  D  
Sbjct: 234 NFSKRGVSFNIPGMQVDGMDIRAVKATMDKAVAYCRAHKGPIIIEMLTYRYRGHSMSDPA 293

Query: 487 SFTQPMMYKTIRSHKSVLQLYADSLMKNQVISKQELQSLANNWHKYLE--AEYKESE 541
           ++        +RS+   ++     L+ N+  S+ +L+ +  N  K +    E+ +S+
Sbjct: 294 NYRTREEINEMRSNHDPIEQVRKRLLHNKWASEGDLKEIEMNVRKIINNSVEFAQSD 350

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target957 alpha-ketoglutarate decarboxylase [Candidatus Liberibac
315122389967 alpha-ketoglutarate decarboxylase [Candidatus Liberibac 1 0.0
2398330511000 2-oxoglutarate dehydrogenase, E1 component [Ochrobactru 1 0.0
190893735994 oxoglutarate dehydrogenase E1 protein [Rhizobium etli C 1 0.0
209551253994 2-oxoglutarate dehydrogenase E1 component [Rhizobium le 1 0.0
1530082681001 2-oxoglutarate dehydrogenase E1 component [Ochrobactrum 1 0.0
86359469994 alpha-ketoglutarate decarboxylase [Rhizobium etli CFN 4 1 0.0
150398138998 2-oxoglutarate dehydrogenase E1 component [Sinorhizobiu 1 0.0
222150038998 2-oxoglutarate dehydrogenase E1 component [Agrobacteriu 1 0.0
15966806998 alpha-ketoglutarate decarboxylase [Sinorhizobium melilo 1 0.0
307301634998 2-oxoglutarate dehydrogenase, E1 subunit [Sinorhizobium 1 0.0
>gi|315122389|ref|YP_004062878.1| alpha-ketoglutarate decarboxylase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 967 Back     alignment and organism information
 Score = 1455 bits (3766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 716/967 (74%), Positives = 821/967 (84%), Gaps = 10/967 (1%)

Query: 1   MLQDLNKMFSLSSFLDGTNCCYIEDLYKSYQEDPSSVCKDWYPLFSFLDENSEEYDNLED 60
           M QDLNK  SLSSFL+G N  YIEDLYK Y+ DPSSVC+DW+ LF F D+NS++YD LED
Sbjct: 1   MQQDLNKRLSLSSFLNGANFSYIEDLYKHYKTDPSSVCEDWHRLFLFFDDNSQDYDQLED 60

Query: 61  GIASFLKEESVASAVFSQKKSAVESSCSLGETQSVKDFFQVMKMIDAYRSYGHFKANIDP 120
            I+SF ++ESV+  V S+KK     S S   +QS+KDFFQ MKMIDAYRSYGHF A+ DP
Sbjct: 61  CISSFSQQESVSKVVVSEKKKKDARSFSSDNSQSLKDFFQAMKMIDAYRSYGHFSAHTDP 120

Query: 121 LGYNSHQKDLSELSPAHYGFVKADYDRKICMKGVLGLESATIPEIVDVLSHLYCSNIGVE 180
           LG+NSH  D +ELSPA YGF +ADY+RKI M+G+LG E ATI EI++ LS LYCSNIGVE
Sbjct: 121 LGFNSHHIDFAELSPAFYGFTEADYNRKIFMQGILGFEYATIIEILETLSRLYCSNIGVE 180

Query: 181 FMHIVDSIERDWVRNTIEDYDFSSNFSKEEQRDILDKLVRAEGFEKFIDIKYKGAKRFGA 240
           FMHI++S ERDW+R+  E+ DFS+  S +E++ IL KLV AEGFEKFIDIKYKGAKRFGA
Sbjct: 181 FMHIINSKERDWIRDVFENPDFSNKLSNDERKSILKKLVEAEGFEKFIDIKYKGAKRFGA 240

Query: 241 DGSEVIIPAIEEIIRQGVQQGVDEMILGMAHRGRLNVLSQIMNKLPRSIFYEFKGKGPSE 300
           DGSEVIIPAIEEIIRQGVQQG+ EMILGMAHRGRLNVLSQ+MNK PRSIFYEFKG+G  +
Sbjct: 241 DGSEVIIPAIEEIIRQGVQQGIAEMILGMAHRGRLNVLSQVMNKPPRSIFYEFKGEGSVD 300

Query: 301 KEYSGDVKYHLGLCCNRQICGKDVKLLLQSNPSHLEFVDPVVIGSVRARQDLKAGIVGEK 360
           KEYSGDVKYHLG CC+RQI GK+V LLL +NPSHLEFVD V IGSVRARQDLK  + GE+
Sbjct: 301 KEYSGDVKYHLGACCSRQISGKNVDLLLCNNPSHLEFVDSVAIGSVRARQDLKTNVSGEE 360

Query: 361 SISLVERSRVLPLIIHGDAAFAGQGIVSETFGLSGLSGYTVAGNIHLIINNQIGFTTNPS 420
           S+SL +RS+ LP+IIHGDAAF GQG+VSET  LSGL GYTVAGNIHLI+NNQIGFTTNPS
Sbjct: 361 SVSLSDRSKFLPIIIHGDAAFIGQGVVSETLALSGLHGYTVAGNIHLIVNNQIGFTTNPS 420

Query: 421 SARSCTYASDISKSIGIPIFHVNGDDPEAVIRVVRMAVSFRMKFHKSVVIDIVCYRRFGH 480
           SARS  Y+SDI+KSIGIPIFHVNGDDPE+V+RV+RMAV +RMKFHKSVVIDI+CYRRFGH
Sbjct: 421 SARSSPYSSDIAKSIGIPIFHVNGDDPESVVRVIRMAVLYRMKFHKSVVIDILCYRRFGH 480

Query: 481 NEGDEPSFTQPMMYKTIRSHKSVLQLYADSLMKNQVISKQELQSLANNWHKYLEAEYKES 540
           NE D+PSFTQP+MY+ IRSHKSVLQ+YAD+L++++VIS QE QSL +NW  YLE E+KES
Sbjct: 481 NECDDPSFTQPVMYQRIRSHKSVLQIYADTLVQDKVISTQEFQSLVSNWRTYLEKEFKES 540

Query: 541 ESYCPEKLGLLHNG---ENERKNS-------VSKEILKKIGSSIIRLPKSFNTHKIVERL 590
           E+Y PEK+  L N     + RKN        VS+++LK+IGS I  LP SF  HKIVERL
Sbjct: 541 ENYRPEKVSALSNCFPVPSVRKNDKEVQNGFVSQKMLKEIGSKISCLPNSFKAHKIVERL 600

Query: 591 MANRQKMIETGKGIDWSMAESLAFGSLCYEGYKVRLSGQDCERGTFSHRHAILCDQETGK 650
           M NR++MIE   GIDW+MAE+LAFGSLC EGY+VRLSGQDCERGTFSHRH++L DQET K
Sbjct: 601 MKNRREMIEKDAGIDWAMAEALAFGSLCCEGYRVRLSGQDCERGTFSHRHSVLYDQETEK 660

Query: 651 RYFPLGNISKDQGHCEVVNSFLSEQAVLGFEYGYSLNNLNALTIWEAQFGDFANGAQVIL 710
           RY PL NI +DQG  EVVNS LSEQAVLGFEYGYSL N N+LTIWEAQFGDFANGAQ+IL
Sbjct: 661 RYVPLNNILQDQGRYEVVNSLLSEQAVLGFEYGYSLENPNSLTIWEAQFGDFANGAQIIL 720

Query: 711 DQFITAGEQKWLCTSNLVCLLPHGYEGQGPEHSSARLERFLQMCAENNMYVANCTSPANY 770
           DQF+++GEQKWL  S+LVCLLPHGYEGQGPEHSSARLERFLQMCAENNM VANCTSPANY
Sbjct: 721 DQFVSSGEQKWLRVSHLVCLLPHGYEGQGPEHSSARLERFLQMCAENNMRVANCTSPANY 780

Query: 771 FHILRRQIYDRSSRPLIMMAPKSLLRHKRVVSSLSDMTCGSVFQAVLSDDAEYHGKTSVK 830
           FHILRRQIYDRSS+PLIMM PKSLLRHK+VVS+LS+M+  + FQ VLSD A+  GK S+K
Sbjct: 781 FHILRRQIYDRSSKPLIMMTPKSLLRHKQVVSTLSEMSDETAFQPVLSDHADCSGKVSIK 840

Query: 831 LKEDSHIRRVILCTGKVYYDLLDNRDMRNIADIYLLRIEQLYPFPEDYLIKVLSRFVQAE 890
           L EDS IRRVILCTGKVYYDLL+NR++RNI DIYL+RIEQLYPFPED L K+L RF QA+
Sbjct: 841 LVEDSRIRRVILCTGKVYYDLLENRNIRNIVDIYLIRIEQLYPFPEDCLKKILLRFAQAD 900

Query: 891 IVWCQEEPQNMGAWTFIEPYLEKVLHSIGADYSRVRYVGRLPSASTAVGHMSRHLEQLSS 950
           +VWCQEEPQNMGAW FIEPYLEKVL SI A  SRVRYVGR  SASTAVG+MSRHLEQLSS
Sbjct: 901 MVWCQEEPQNMGAWAFIEPYLEKVLGSISASCSRVRYVGRPQSASTAVGNMSRHLEQLSS 960

Query: 951 FIEDALK 957
            ++DAL+
Sbjct: 961 LVKDALE 967


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|239833051|ref|ZP_04681380.1| 2-oxoglutarate dehydrogenase, E1 component [Ochrobactrum intermedium LMG 3301] Length = 1000 Back     alignment and organism information
>gi|190893735|ref|YP_001980277.1| oxoglutarate dehydrogenase E1 protein [Rhizobium etli CIAT 652] Length = 994 Back     alignment and organism information
>gi|209551253|ref|YP_002283170.1| 2-oxoglutarate dehydrogenase E1 component [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 994 Back     alignment and organism information
>gi|153008268|ref|YP_001369483.1| 2-oxoglutarate dehydrogenase E1 component [Ochrobactrum anthropi ATCC 49188] Length = 1001 Back     alignment and organism information
>gi|86359469|ref|YP_471361.1| alpha-ketoglutarate decarboxylase [Rhizobium etli CFN 42] Length = 994 Back     alignment and organism information
>gi|150398138|ref|YP_001328605.1| 2-oxoglutarate dehydrogenase E1 component [Sinorhizobium medicae WSM419] Length = 998 Back     alignment and organism information
>gi|222150038|ref|YP_002550995.1| 2-oxoglutarate dehydrogenase E1 component [Agrobacterium vitis S4] Length = 998 Back     alignment and organism information
>gi|15966806|ref|NP_387159.1| alpha-ketoglutarate decarboxylase [Sinorhizobium meliloti 1021] Length = 998 Back     alignment and organism information
>gi|307301634|ref|ZP_07581393.1| 2-oxoglutarate dehydrogenase, E1 subunit [Sinorhizobium meliloti BL225C] Length = 998 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target957 alpha-ketoglutarate decarboxylase [Candidatus Liberibac
KOG04501017 KOG0450, KOG0450, KOG0450, 2-oxoglutarate dehydrogenase 0.0
PRK09404924 PRK09404, sucA, 2-oxoglutarate dehydrogenase E1 compone 0.0
TIGR00239929 TIGR00239, 2oxo_dh_E1, 2-oxoglutarate dehydrogenase, E1 0.0
COG0567906 COG0567, SucA, 2-oxoglutarate dehydrogenase complex, de 0.0
KOG0451913 KOG0451, KOG0451, KOG0451, Predicted 2-oxoglutarate deh 0.0
PRK122701228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Revie 0.0
cd02016265 cd02016, TPP_E1_OGDC_like, Thiamine pyrophosphate (TPP) 1e-113
pfam02779174 pfam02779, Transket_pyr, Transketolase, pyrimidine bind 2e-45
smart00861168 smart00861, Transket_pyr, Transketolase, pyrimidine bin 3e-30
pfam00676303 pfam00676, E1_dh, Dehydrogenase E1 component 3e-44
cd02000293 cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate ( 1e-10
COG1071358 COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogenase co 5e-10
TIGR03182315 TIGR03182, PDH_E1_alph_y, pyruvate dehydrogenase E1 com 2e-07
KOG0225394 KOG0225, KOG0225, KOG0225, Pyruvate dehydrogenase E1, a 8e-05
PTZ00182355 PTZ00182, PTZ00182, 3-methyl-2-oxobutanate dehydrogenas 0.003
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Revie 0.004
>gnl|CDD|35671 KOG0450, KOG0450, KOG0450, 2-oxoglutarate dehydrogenase, E1 subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|181824 PRK09404, sucA, 2-oxoglutarate dehydrogenase E1 component; Reviewed Back     alignment and domain information
>gnl|CDD|161785 TIGR00239, 2oxo_dh_E1, 2-oxoglutarate dehydrogenase, E1 component Back     alignment and domain information
>gnl|CDD|30913 COG0567, SucA, 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|35672 KOG0451, KOG0451, KOG0451, Predicted 2-oxoglutarate dehydrogenase, E1 subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|183391 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|48179 cd02016, TPP_E1_OGDC_like, Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC) Back     alignment and domain information
>gnl|CDD|145763 pfam02779, Transket_pyr, Transketolase, pyrimidine binding domain Back     alignment and domain information
>gnl|CDD|129094 smart00861, Transket_pyr, Transketolase, pyrimidine binding domain Back     alignment and domain information
>gnl|CDD|144320 pfam00676, E1_dh, Dehydrogenase E1 component Back     alignment and domain information
>gnl|CDD|48163 cd02000, TPP_E1_PDC_ADC_BCADC, Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>gnl|CDD|31269 COG1071, AcoA, Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|163176 TIGR03182, PDH_E1_alph_y, pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>gnl|CDD|35446 KOG0225, KOG0225, KOG0225, Pyruvate dehydrogenase E1, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|185502 PTZ00182, PTZ00182, 3-methyl-2-oxobutanate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183391 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 957 alpha-ketoglutarate decarboxylase [Candidatus Liberibac
PRK09404931 kgd alpha-ketoglutarate decarboxylase; Reviewed 100.0
KOG04501017 consensus 100.0
COG0567906 SucA 2-oxoglutarate dehydrogenase complex, dehydrogenas 100.0
TIGR00239990 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 component; 100.0
PRK122701234 kgd alpha-ketoglutarate decarboxylase; Reviewed 100.0
KOG0451913 consensus 100.0
cd02016265 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) family, E 100.0
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alp 96.21
pfam00676303 E1_dh Dehydrogenase E1 component. This family uses thia 99.97
TIGR03182315 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alph 99.89
cd02000293 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) famil 99.89
CHL00149343 odpA pyruvate dehydrogenase E1 component alpha subunit; 99.89
TIGR03181341 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alph 99.88
COG1071358 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex, deh 99.77
KOG0225394 consensus 99.6
pfam02779174 Transket_pyr Transketolase, pyrimidine binding domain. 99.7
smart00861168 Transket_pyr Transketolase, pyrimidine binding domain. 99.39
cd07036167 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding doma 98.86
cd07033156 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domain of 97.22
PRK12315581 1-deoxy-D-xylulose-5-phosphate synthase; Provisional 99.24
PRK05444576 1-deoxy-D-xylulose-5-phosphate synthase; Provisional 98.6
PRK05899661 transketolase; Reviewed 94.03
PRK11892464 pyruvate dehydrogenase subunit beta; Provisional 99.24
CHL00144326 odpB pyruvate dehydrogenase E1 component beta subunit; 99.22
PRK09212327 pyruvate dehydrogenase subunit beta; Validated 99.14
PTZ00182355 3-methyl-2-oxobutanate dehydrogenase; Provisional 99.23
COG0022324 AcoB Pyruvate/2-oxoglutarate dehydrogenase complex, deh 98.72
KOG0525362 consensus 97.26
KOG1182432 consensus 97.71
PRK12571642 1-deoxy-D-xylulose-5-phosphate synthase; Provisional 97.58
cd02012255 TPP_TK Thiamine pyrophosphate (TPP) family, Transketola 97.54
cd02007195 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS subfam 97.09
pfam02775150 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal 95.89
cd03371188 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC 91.8
PRK06276586 acetolactate synthase catalytic subunit; Reviewed 91.4
cd02001157 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) family, Co 90.23
cd02006202 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfam 96.86
cd00568168 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, 96.73
cd02002178 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subf 96.59
cd02013196 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-l 96.46
PRK11269591 glyoxylate carboligase; Provisional 96.46
cd02005183 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_I 96.43
cd02004172 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, 95.98
cd02015186 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydr 95.52
cd02003205 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subf 95.29
cd02014178 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate o 95.05
cd02010177 TPP_ALS Thiamine pyrophosphate (TPP) family, Acetolacta 95.05
COG0028550 IlvB Thiamine pyrophosphate-requiring enzymes [acetolac 93.7
cd02008178 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR- 93.07
PRK08659377 2-oxoglutarate ferredoxin oxidoreductase subunit alpha; 96.74
PRK09627375 oorA 2-oxoglutarate-acceptor oxidoreductase subunit Oor 94.5
COG0674365 PorA Pyruvate:ferredoxin oxidoreductase and related 2-o 94.23
PRK08366394 vorA 2-ketoisovalerate ferredoxin oxidoreductase subuni 91.25
PRK07119350 2-ketoisovalerate ferredoxin reductase; Validated 95.55
PRK06112581 acetolactate synthase catalytic subunit; Validated 95.4
TIGR03393539 indolpyr_decarb indolepyruvate decarboxylase, Erwinia f 92.57
TIGR03394535 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxy 90.65
PRK08273597 pyruvate decarboxylase; Provisional 95.37
KOG0523632 consensus 94.76
PRK07525589 sulfoacetaldehyde acetyltransferase; Validated 93.9
TIGR03457579 sulphoacet_xsc sulfoacetaldehyde acetyltransferase. Mem 93.4
PRK09259572 putative oxalyl-CoA decarboxylase; Validated 91.44
PRK07064544 hypothetical protein; Provisional 91.42
PRK09124574 pyruvate dehydrogenase; Provisional 90.59
PRK08979572 acetolactate synthase 3 catalytic subunit; Validated 90.56
PRK08617552 acetolactate synthase; Reviewed 90.38
PRK09107594 acetolactate synthase 3 catalytic subunit; Validated 90.34
PRK06154556 hypothetical protein; Provisional 93.9
PRK08199553 acetolactate synthase 2 catalytic subunit; Validated 92.82
PRK07449548 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic ac 91.25
PRK08327568 acetolactate synthase catalytic subunit; Validated 90.44
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha and bet 93.3
PRK05858543 hypothetical protein; Provisional 92.35
PRK06882574 acetolactate synthase 3 catalytic subunit; Validated 92.05
PRK06456572 acetolactate synthase catalytic subunit; Reviewed 90.25
cd00956211 Transaldolase_FSA Transaldolase-like fructose-6-phospha 91.08
TIGR00553368 pabB para-aminobenzoate synthase, component I; InterPro 90.37
>PRK09404 kgd alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>KOG0450 consensus Back     alignment and domain information
>COG0567 SucA 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR00239 2oxo_dh_E1 2-oxoglutarate dehydrogenase, E1 component; InterPro: IPR011603 2-oxoglutarate dehydrogenase is a key enzyme in the TCA cycle, converting 2-oxoglutarate, coenzyme A and NAD(+) to succinyl-CoA, NADH and carbon dioxide Back     alignment and domain information
>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>KOG0451 consensus Back     alignment and domain information
>cd02016 TPP_E1_OGDC_like Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC) Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>pfam00676 E1_dh Dehydrogenase E1 component Back     alignment and domain information
>TIGR03182 PDH_E1_alph_y pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>cd02000 TPP_E1_PDC_ADC_BCADC Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC) Back     alignment and domain information
>CHL00149 odpA pyruvate dehydrogenase E1 component alpha subunit; Reviewed Back     alignment and domain information
>TIGR03181 PDH_E1_alph_x pyruvate dehydrogenase E1 component, alpha subunit Back     alignment and domain information
>COG1071 AcoA Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion] Back     alignment and domain information
>KOG0225 consensus Back     alignment and domain information
>pfam02779 Transket_pyr Transketolase, pyrimidine binding domain Back     alignment and domain information
>smart00861 Transket_pyr Transketolase, pyrimidine binding domain Back     alignment and domain information
>cd07036 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding domain of the beta subunits of the E1 components of human pyruvate dehydrogenase complex (E1- PDHc) and related proteins Back     alignment and domain information
>cd07033 TPP_PYR_DXS_TK_like Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins Back     alignment and domain information
>PRK12315 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK05444 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>PRK05899 transketolase; Reviewed Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>CHL00144 odpB pyruvate dehydrogenase E1 component beta subunit; Validated Back     alignment and domain information
>PRK09212 pyruvate dehydrogenase subunit beta; Validated Back     alignment and domain information
>PTZ00182 3-methyl-2-oxobutanate dehydrogenase; Provisional Back     alignment and domain information
>COG0022 AcoB Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion] Back     alignment and domain information
>KOG0525 consensus Back     alignment and domain information
>KOG1182 consensus Back     alignment and domain information
>PRK12571 1-deoxy-D-xylulose-5-phosphate synthase; Provisional Back     alignment and domain information
>cd02012 TPP_TK Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates Back     alignment and domain information
>cd02007 TPP_DXS Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis Back     alignment and domain information
>pfam02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain Back     alignment and domain information
>cd03371 TPP_PpyrDC Thiamine pyrophosphate (TPP) family, PpyrDC subfamily, TPP-binding module; composed of proteins similar to phosphonopyruvate decarboxylase (PpyrDC) proteins Back     alignment and domain information
>PRK06276 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>cd02001 TPP_ComE_PpyrDC Thiamine pyrophosphate (TPP) family, ComE and PpyrDC subfamily, TPP-binding module; composed of proteins similar to sulfopyruvate decarboxylase beta subunit (ComE) and phosphonopyruvate decarboxylase (Ppyr decarboxylase) Back     alignment and domain information
>cd02006 TPP_Gcl Thiamine pyrophosphate (TPP) family, Gcl subfamily, TPP-binding module; composed of proteins similar to Escherichia coli glyoxylate carboligase (Gcl) Back     alignment and domain information
>cd00568 TPP_enzymes Thiamine pyrophosphate (TPP) enzyme family, TPP-binding module; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor Back     alignment and domain information
>cd02002 TPP_BFDC Thiamine pyrophosphate (TPP) family, BFDC subfamily, TPP-binding module; composed of proteins similar to Pseudomonas putida benzoylformate decarboxylase (BFDC) Back     alignment and domain information
>cd02013 TPP_Xsc_like Thiamine pyrophosphate (TPP) family, Xsc-like subfamily, TPP-binding module; composed of proteins similar to Alcaligenes defragrans sulfoacetaldehyde acetyltransferase (Xsc) Back     alignment and domain information
>PRK11269 glyoxylate carboligase; Provisional Back     alignment and domain information
>cd02005 TPP_PDC_IPDC Thiamine pyrophosphate (TPP) family, PDC_IPDC subfamily, TPP-binding module; composed of proteins similar to pyruvate decarboxylase (PDC) and indolepyruvate decarboxylase (IPDC) Back     alignment and domain information
>cd02004 TPP_BZL_OCoD_HPCL Thiamine pyrophosphate (TPP) family, BZL_OCoD_HPCL subfamily, TPP-binding module; composed of proteins similar to benzaldehyde lyase (BZL), oxalyl-CoA decarboxylase (OCoD) and 2-hydroxyphytanoyl-CoA lyase (2-HPCL) Back     alignment and domain information
>cd02015 TPP_AHAS Thiamine pyrophosphate (TPP) family, Acetohydroxyacid synthase (AHAS) subfamily, TPP-binding module; composed of proteins similar to the large catalytic subunit of AHAS Back     alignment and domain information
>cd02003 TPP_IolD Thiamine pyrophosphate (TPP) family, IolD subfamily, TPP-binding module; composed of proteins similar to Rhizobium leguminosarum bv Back     alignment and domain information
>cd02014 TPP_POX Thiamine pyrophosphate (TPP) family, Pyruvate oxidase (POX) subfamily, TPP-binding module; composed of proteins similar to Lactobacillus plantarum POX, which plays a key role in controlling acetate production under aerobic conditions Back     alignment and domain information
>cd02010 TPP_ALS Thiamine pyrophosphate (TPP) family, Acetolactate synthase (ALS) subfamily, TPP-binding module; composed of proteins similar to Klebsiella pneumoniae ALS, a catabolic enzyme required for butanediol fermentation Back     alignment and domain information
>COG0028 IlvB Thiamine pyrophosphate-requiring enzymes [acetolactate synthase, pyruvate dehydrogenase (cytochrome), glyoxylate carboligase, phosphonopyruvate decarboxylase] [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>cd02008 TPP_IOR_alpha Thiamine pyrophosphate (TPP) family, IOR-alpha subfamily, TPP-binding module; composed of proteins similar to indolepyruvate ferredoxin oxidoreductase (IOR) alpha subunit Back     alignment and domain information
>PRK08659 2-oxoglutarate ferredoxin oxidoreductase subunit alpha; Validated Back     alignment and domain information
>PRK09627 oorA 2-oxoglutarate-acceptor oxidoreductase subunit OorA; Reviewed Back     alignment and domain information
>COG0674 PorA Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, alpha subunit [Energy production and conversion] Back     alignment and domain information
>PRK08366 vorA 2-ketoisovalerate ferredoxin oxidoreductase subunit alpha; Reviewed Back     alignment and domain information
>PRK07119 2-ketoisovalerate ferredoxin reductase; Validated Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>TIGR03393 indolpyr_decarb indolepyruvate decarboxylase, Erwinia family Back     alignment and domain information
>TIGR03394 indol_phenyl_DC indolepyruvate/phenylpyruvate decarboxylase, Azospirillum family Back     alignment and domain information
>PRK08273 pyruvate decarboxylase; Provisional Back     alignment and domain information
>KOG0523 consensus Back     alignment and domain information
>PRK07525 sulfoacetaldehyde acetyltransferase; Validated Back     alignment and domain information
>TIGR03457 sulphoacet_xsc sulfoacetaldehyde acetyltransferase Back     alignment and domain information
>PRK09259 putative oxalyl-CoA decarboxylase; Validated Back     alignment and domain information
>PRK07064 hypothetical protein; Provisional Back     alignment and domain information
>PRK09124 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>PRK08979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK08617 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK09107 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information
>PRK08199 acetolactate synthase 2 catalytic subunit; Validated Back     alignment and domain information
>PRK07449 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase; Validated Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>PRK05858 hypothetical protein; Provisional Back     alignment and domain information
>PRK06882 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06456 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases Back     alignment and domain information
>TIGR00553 pabB para-aminobenzoate synthase, component I; InterPro: IPR005802 Para-aminobenzoate synthase component I (pabB) is closely related to anthranilate synthase component I (trpE) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target957 alpha-ketoglutarate decarboxylase [Candidatus Liberibac
2jgd_B933 E. Coli 2-Oxoglutarate Dehydrogenase (E1o) Length = 0.0
2jgd_A933 E. Coli 2-Oxoglutarate Dehydrogenase (E1o) Length = 0.0
3exi_A382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 2e-08
3exe_A382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 2e-08
3exf_A382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 2e-08
2ozl_A365 Human Pyruvate Dehydrogenase S264e Variant Length = 3e-08
3exh_C382 Crystal Structure Of The Pyruvate Dehydrogenase (E1 4e-08
1ni4_A365 Human Pyruvate Dehydrogenase Length = 365 2e-06
>gi|134104926|pdb|2JGD|B Chain B, E. Coli 2-Oxoglutarate Dehydrogenase (E1o) Length = 933 Back     alignment and structure
 Score = 1188 bits (3074), Expect = 0.0,   Method: Composition-based stats.
 Identities = 408/966 (42%), Positives = 563/966 (58%), Gaps = 46/966 (4%)

Query: 1   MLQDLNKMFSLSSFLDGTNCCYIEDLYKSYQEDPSSVCKDWYPLFSFLDENSEEYDNLED 60
           M     K +  SS+L G N  +IE LY+ +  DP SV  +W   F  L     + D    
Sbjct: 1   MQNSALKAWLDSSYLSGANQSWIEQLYEDFLTDPDSVDANWRSTFQQLPGTGVKPDQFHS 60

Query: 61  GIASFLKEESVASAVFSQKKSAVESSCSLGETQSVKDFFQVMKMIDAYRSYGHFKANIDP 120
               + +  +         K A   S ++ +  +     +V+++I+AYR  GH  AN+DP
Sbjct: 61  QTREYFRRLA---------KDASRYSSTISDPDTNVKQVKVLQLINAYRFRGHQHANLDP 111

Query: 121 LGYNSHQKDLSELSPAHYGFVKADYDRKICMKGVL-GLESATIPEIVDVLSHLYCSNIGV 179
           LG     K +++L P+ +   +AD+     +     G E+  + E+++ L   YC  IG 
Sbjct: 112 LGLWQQDK-VADLDPSFHDLTEADFQETFNVGSFASGKETMKLGELLEALKQTYCGPIGA 170

Query: 180 EFMHIVDSIERDWVRNTIEDYDFSSNFSKEEQRDILDKLVRAEGFEKFIDIKYKGAKRFG 239
           E+MHI  + E+ W++  IE       F+ EE++  L +L  AEG E+++  K+ GAKRF 
Sbjct: 171 EYMHITSTEEKRWIQQRIESGRA--TFNSEEKKRFLSELTAAEGLERYLGAKFPGAKRFS 228

Query: 240 ADGSEVIIPAIEEIIRQGVQQGVDEMILGMAHRGRLNVLSQIMNKLPRSIFYEFKGKGPS 299
            +G + +IP ++E+IR     G  E++LGMAHRGRLNVL  ++ K P+ +F EF GK   
Sbjct: 229 LEGGDALIPMLKEMIRHAGNSGTREVVLGMAHRGRLNVLVNVLGKKPQDLFDEFAGKHKE 288

Query: 300 EKEYSGDVKYHLGLCCNRQICGKDVKLLLQSNPSHLEFVDPVVIGSVRARQDLKAGIVGE 359
               +GDVKYH+G   + Q  G  V L L  NPSHLE V PVVIGSVRAR D        
Sbjct: 289 H-LGTGDVKYHMGFSSDFQTDGGLVHLALAFNPSHLEIVSPVVIGSVRARLDRL------ 341

Query: 360 KSISLVERSRVLPLIIHGDAAFAGQGIVSETFGLSGLSGYTVAGNIHLIINNQIGFTT-N 418
                   ++VLP+ IHGDAA  GQG+V ET  +S   GY V G + ++INNQ+GFTT N
Sbjct: 342 ---DEPSSNKVLPITIHGDAAVTGQGVVQETLNMSKARGYEVGGTVRIVINNQVGFTTSN 398

Query: 419 PSSARSCTYASDISKSIGIPIFHVNGDDPEAVIRVVRMAVSFRMKFHKSVVIDIVCYRRF 478
           P  ARS  Y +DI K +  PIFHVN DDPEAV  V R+A+ FR  F + V ID+VCYRR 
Sbjct: 399 PLDARSTPYCTDIGKMVQAPIFHVNADDPEAVAFVTRLALDFRNTFKRDVFIDLVCYRRH 458

Query: 479 GHNEGDEPSFTQPMMYKTIRSHKSVLQLYADSLMKNQVISKQELQSLANNWHKYLEAEYK 538
           GHNE DEPS TQP+MY+ I+ H +  ++YAD L + +V + ++   + N +   L+A   
Sbjct: 459 GHNEADEPSATQPLMYQKIKKHPTPRKIYADKLEQEKVATLEDATEMVNLYRDALDAGDC 518

Query: 539 ESESYCP-------EKLGLLHNGENERKNSVSKEILKKIGSSIIRLPKSFNTHKIVERLM 591
               + P           L H  + E  N V  + L+++   I  +P++      V ++ 
Sbjct: 519 VVAEWRPMNMHSFTWSPYLNHEWDEEYPNKVEMKRLQELAKRISTVPEAVEMQSRVAKIY 578

Query: 592 ANRQKMIETGKGIDWSMAESLAFGSLCYEGYKVRLSGQDCERGTFSHRHAILCDQETGKR 651
           A+RQ M    K  DW  AE+LA+ +L  EG  VRLSG+D  RGTF HRHA++ +Q  G  
Sbjct: 579 ADRQAMAAGEKLFDWGGAENLAYATLVDEGIPVRLSGEDSGRGTFFHRHAVIHNQSNGST 638

Query: 652 YFPLGNISKDQGHCEVVNSFLSEQAVLGFEYGYSLNNLNALTIWEAQFGDFANGAQVILD 711
           Y PL +I   QG   V +S LSE+AVL FEYGY+      LTIWEAQFGDFANGAQV++D
Sbjct: 639 YTPLQHIHNGQGAFRVWDSVLSEEAVLAFEYGYATAEPRTLTIWEAQFGDFANGAQVVID 698

Query: 712 QFITAGEQKWLCTSNLVCLLPHGYEGQGPEHSSARLERFLQMCAENNMYVANCTSPANYF 771
           QFI++GEQKW     LV LLPHGYEGQGPEHSSARLER+LQ+CAE NM V   ++PA  +
Sbjct: 699 QFISSGEQKWGRMCGLVMLLPHGYEGQGPEHSSARLERYLQLCAEQNMQVCVPSTPAQVY 758

Query: 772 HILRRQIYDRSSRPLIMMAPKSLLRHKRVVSSLSDMTCGSVFQAVLSDDAEYHGKTSVKL 831
           H+LRRQ      RPL++M+PKSLLRH   VSSL ++  G+ F   + +         +  
Sbjct: 759 HMLRRQALRGMRRPLVVMSPKSLLRHPLAVSSLEELANGT-FLPAIGE---------IDE 808

Query: 832 KEDSHIRRVILCTGKVYYDLLDNRDMRNIADIYLLRIEQLYPFPEDYLIKVLSRFVQA-E 890
            +   ++RV++C+GKVYYDLL+ R   N  D+ ++RIEQLYPFP   + +VL +F    +
Sbjct: 809 LDPKGVKRVVMCSGKVYYDLLEQRRKNNQHDVAIVRIEQLYPFPHKAMQEVLQQFAHVKD 868

Query: 891 IVWCQEEPQNMGAWTFIEPYLEKVLHSIGADYSRVRYVGRLPSASTAVGHMSRHLEQLSS 950
            VWCQEEP N GAW   + +  +V+       + +RY GR  SAS AVG+MS H +Q   
Sbjct: 869 FVWCQEEPLNQGAWYCSQHHFREVI----PFGASLRYAGRPASASPAVGYMSVHQKQQQD 924

Query: 951 FIEDAL 956
            + DAL
Sbjct: 925 LVNDAL 930


>gi|134104925|pdb|2JGD|A Chain A, E. Coli 2-Oxoglutarate Dehydrogenase (E1o) Length = 933 Back     alignment and structure
>gi|215261382|pdb|3EXI|A Chain A, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex With The Subunit-Binding Domain (Sbd) Of E2p, But Sbd Cannot Be Modeled Into The Electron Density Length = 382 Back     alignment and structure
>gi|215261326|pdb|3EXE|A Chain A, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 382 Back     alignment and structure
>gi|215261334|pdb|3EXF|A Chain A, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 382 Back     alignment and structure
>gi|149242791|pdb|2OZL|A Chain A, Human Pyruvate Dehydrogenase S264e Variant Length = 365 Back     alignment and structure
>gi|215261376|pdb|3EXH|C Chain C, Crystal Structure Of The Pyruvate Dehydrogenase (E1p) Component Of Human Pyruvate Dehydrogenase Complex Length = 382 Back     alignment and structure
>gi|33357459|pdb|1NI4|A Chain A, Human Pyruvate Dehydrogenase Length = 365 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target957 alpha-ketoglutarate decarboxylase [Candidatus Liberibac
2jgd_A933 2-oxoglutarate dehydrogenase E1 component; flavoprotein 0.0
1umd_A367 E1-alpha, 2-OXO acid dehydrogenase alpha subunit; alpha 1e-14
1qs0_A407 2-oxoisovalerate dehydrogenase alpha-subunit; heterotet 1e-12
1ik6_A369 Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, oxidor 2e-13
2bfd_A400 2-oxoisovalerate dehydrogenase alpha subunit; oxidoredu 2e-06
>2jgd_A 2-oxoglutarate dehydrogenase E1 component; flavoprotein, oxidoreductase, thiamine diphosphate, thiamine pyrophosphate, adenosine monophosphate; HET: AMP; 2.6A {Escherichia coli} PDB: 2jgd_B* Length = 933 Back     alignment and structure
 Score =  983 bits (2542), Expect = 0.0
 Identities = 410/966 (42%), Positives = 566/966 (58%), Gaps = 46/966 (4%)

Query: 1   MLQDLNKMFSLSSFLDGTNCCYIEDLYKSYQEDPSSVCKDWYPLFSFLDENSEEYDNLED 60
           M     K +  SS+L G N  +IE LY+ +  DP SV  +W   F  L     + D    
Sbjct: 1   MQNSALKAWLDSSYLSGANQSWIEQLYEDFLTDPDSVDANWRSTFQQLPGTGVKPDQFHS 60

Query: 61  GIASFLKEESVASAVFSQKKSAVESSCSLGETQSVKDFFQVMKMIDAYRSYGHFKANIDP 120
               + +  +         K A   S ++ +  +     +V+++I+AYR  GH  AN+DP
Sbjct: 61  QTREYFRRLA---------KDASRYSSTISDPDTNVKQVKVLQLINAYRFRGHQHANLDP 111

Query: 121 LGYNSHQKDLSELSPAHYGFVKADYDRKICMKGVL-GLESATIPEIVDVLSHLYCSNIGV 179
           LG    Q  +++L P+ +   +AD+     +     G E+  + E+++ L   YC  IG 
Sbjct: 112 LGL-WQQDKVADLDPSFHDLTEADFQETFNVGSFASGKETMKLGELLEALKQTYCGPIGA 170

Query: 180 EFMHIVDSIERDWVRNTIEDYDFSSNFSKEEQRDILDKLVRAEGFEKFIDIKYKGAKRFG 239
           E+MHI  + E+ W++  IE     + F+ EE++  L +L  AEG E+++  K+ GAKRF 
Sbjct: 171 EYMHITSTEEKRWIQQRIES--GRATFNSEEKKRFLSELTAAEGLERYLGAKFPGAKRFS 228

Query: 240 ADGSEVIIPAIEEIIRQGVQQGVDEMILGMAHRGRLNVLSQIMNKLPRSIFYEFKGKGPS 299
            +G + +IP ++E+IR     G  E++LGMAHRGRLNVL  ++ K P+ +F EF GK   
Sbjct: 229 LEGGDALIPMLKEMIRHAGNSGTREVVLGMAHRGRLNVLVNVLGKKPQDLFDEFAGK-HK 287

Query: 300 EKEYSGDVKYHLGLCCNRQICGKDVKLLLQSNPSHLEFVDPVVIGSVRARQDLKAGIVGE 359
           E   +GDVKYH+G   + Q  G  V L L  NPSHLE V PVVIGSVRAR D     + E
Sbjct: 288 EHLGTGDVKYHMGFSSDFQTDGGLVHLALAFNPSHLEIVSPVVIGSVRARLD----RLDE 343

Query: 360 KSISLVERSRVLPLIIHGDAAFAGQGIVSETFGLSGLSGYTVAGNIHLIINNQIGFTT-N 418
                   ++VLP+ IHGDAA  GQG+V ET  +S   GY V G + ++INNQ+GFTT N
Sbjct: 344 P-----SSNKVLPITIHGDAAVTGQGVVQETLNMSKARGYEVGGTVRIVINNQVGFTTSN 398

Query: 419 PSSARSCTYASDISKSIGIPIFHVNGDDPEAVIRVVRMAVSFRMKFHKSVVIDIVCYRRF 478
           P  ARS  Y +DI K +  PIFHVN DDPEAV  V R+A+ FR  F + V ID+VCYRR 
Sbjct: 399 PLDARSTPYCTDIGKMVQAPIFHVNADDPEAVAFVTRLALDFRNTFKRDVFIDLVCYRRH 458

Query: 479 GHNEGDEPSFTQPMMYKTIRSHKSVLQLYADSLMKNQVISKQELQSLANNWHKYLEAEYK 538
           GHNE DEPS TQP+MY+ I+ H +  ++YAD L + +V + ++   + N +   L+A   
Sbjct: 459 GHNEADEPSATQPLMYQKIKKHPTPRKIYADKLEQEKVATLEDATEMVNLYRDALDAGDC 518

Query: 539 ESESYCPEKLGLL-------HNGENERKNSVSKEILKKIGSSIIRLPKSFNTHKIVERLM 591
               + P  +          H  + E  N V  + L+++   I  +P++      V ++ 
Sbjct: 519 VVAEWRPMNMHSFTWSPYLNHEWDEEYPNKVEMKRLQELAKRISTVPEAVEMQSRVAKIY 578

Query: 592 ANRQKMIETGKGIDWSMAESLAFGSLCYEGYKVRLSGQDCERGTFSHRHAILCDQETGKR 651
            +RQ M    K  DW  AE+LA+ +L  EG  VRLSG+D  RGTF HRHA++ +Q  G  
Sbjct: 579 GDRQAMAAGEKLFDWGGAENLAYATLVDEGIPVRLSGEDSGRGTFFHRHAVIHNQSNGST 638

Query: 652 YFPLGNISKDQGHCEVVNSFLSEQAVLGFEYGYSLNNLNALTIWEAQFGDFANGAQVILD 711
           Y PL +I   QG   V +S LSE+AVL FEYGY+      LTIWEAQFGDFANGAQV++D
Sbjct: 639 YTPLQHIHNGQGAFRVWDSVLSEEAVLAFEYGYATAEPRTLTIWEAQFGDFANGAQVVID 698

Query: 712 QFITAGEQKWLCTSNLVCLLPHGYEGQGPEHSSARLERFLQMCAENNMYVANCTSPANYF 771
           QFI++GEQKW     LV LLPHGYEGQGPEHSSARLER+LQ+CAE NM V   ++PA  +
Sbjct: 699 QFISSGEQKWGRMCGLVMLLPHGYEGQGPEHSSARLERYLQLCAEQNMQVCVPSTPAQVY 758

Query: 772 HILRRQIYDRSSRPLIMMAPKSLLRHKRVVSSLSDMTCGSVFQAVLSDDAEYHGKTSVKL 831
           H+LRRQ      RPL++M+PKSLLRH   VSSL ++  G+ F   + +  E         
Sbjct: 759 HMLRRQALRGMRRPLVVMSPKSLLRHPLAVSSLEELANGT-FLPAIGEIDE--------- 808

Query: 832 KEDSHIRRVILCTGKVYYDLLDNRDMRNIADIYLLRIEQLYPFPEDYLIKVLSRFVQA-E 890
            +   ++RV++C+GKVYYDLL+ R   N  D+ ++RIEQLYPFP   + +VL +F    +
Sbjct: 809 LDPKGVKRVVMCSGKVYYDLLEQRRKNNQHDVAIVRIEQLYPFPHKAMQEVLQQFAHVKD 868

Query: 891 IVWCQEEPQNMGAWTFIEPYLEKVLHSIGADYSRVRYVGRLPSASTAVGHMSRHLEQLSS 950
            VWCQEEP N GAW   + +  +V+       + +RY GR  SAS AVGHMS H +Q   
Sbjct: 869 FVWCQEEPLNQGAWYCSQHHFREVI----PFGASLRYAGRPASASPAVGHMSVHQKQQQD 924

Query: 951 FIEDAL 956
            + DAL
Sbjct: 925 LVNDAL 930


>1umd_A E1-alpha, 2-OXO acid dehydrogenase alpha subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.11 PDB: 1um9_A* 1umc_A* 1umb_A* Length = 367 Back     alignment and structure
>1qs0_A 2-oxoisovalerate dehydrogenase alpha-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.11 PDB: 2bp7_A Length = 407 Back     alignment and structure
>1ik6_A Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, oxidoreductase; 2.00A {Pyrobaculum aerophilum} SCOP: c.36.1.7 c.48.1.2 Length = 369 Back     alignment and structure
>2bfd_A 2-oxoisovalerate dehydrogenase alpha subunit; oxidoreductase, ketoacid dehydrogenase, branched-chain, multi- enzyme complex, acylation; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.11 PDB: 1v16_A* 2bfc_A* 1v1r_A* 1olu_A* 2bfb_A* 1v1m_A* 2bew_A* 1dtw_A* 1olx_A* 1ols_A* 1wci_A* 1x80_A* 2beu_A* 1u5b_A* 2bev_A* 1v11_A* 1x7x_A* 1x7y_A* 1x7w_A* 1x7z_A* ... Length = 400 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target957 alpha-ketoglutarate decarboxylase [Candidatus Liberibac
2jgd_A933 2-oxoglutarate dehydrogenase E1 component; flavoprotein 100.0
1umd_A367 E1-alpha, 2-OXO acid dehydrogenase alpha subunit; alpha 100.0
1qs0_A407 2-oxoisovalerate dehydrogenase alpha-subunit; heterotet 99.93
1w85_A368 Pyruvate dehydrogenase E1 component, alpha subunit; deh 99.92
2ozl_A365 PDHE1-A type I, pyruvate dehydrogenase E1 component alp 99.97
2bfd_A400 2-oxoisovalerate dehydrogenase alpha subunit; oxidoredu 99.96
1ik6_A369 Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, oxidor 99.38
2bfd_B342 2-oxoisovalerate dehydrogenase beta subunit; oxidoreduc 98.9
2o1s_A621 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, 98.84
1umd_B324 E1-beta, 2-OXO acid dehydrogenase beta subunit; alpha(2 98.69
1w85_B324 Pyruvate dehydrogenase E1 component, beta subunit; dehy 98.64
2ozl_B341 PDHE1-B, pyruvate dehydrogenase E1 component subunit be 98.57
1qs0_B338 2-oxoisovalerate dehydrogenase beta-subunit; heterotetr 98.56
2o1x_A629 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, isopr 98.56
2e6k_A651 Transketolase; structural genomics, NPPSFA, national pr 98.74
1gpu_A680 Transketolase; transferase(ketone residues); HET: THD; 98.68
3m49_A690 Transketolase; alpha-beta-alpha sandwich, csgid, transf 98.28
2r8o_A669 Transketolase 1, TK 1; reaction intermediate, calcium, 98.09
3l84_A632 Transketolase; TKT, structural genomics, center for str 98.66
3kom_A663 Transketolase; rossmann fold, csgid, transferase, struc 95.53
1itz_A675 Transketolase; calvin cycle, cofactor, thiamine pyropho 98.21
1r9j_A673 Transketolase; domains, EACH of the alpha/beta type, th 97.05
1v5e_A590 Pyruvate oxidase; oxidoreductase, flavoprotein; HET: FA 95.88
1yd7_A395 2-keto acid:ferredoxin oxidoreductase subunit alpha; st 95.67
3ju3_A118 Probable 2-oxoacid ferredoxin oxidoreductase, alpha cha 93.16
3hww_A556 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-car 95.32
2pan_A616 Glyoxylate carboligase; thiamin-diphosphate (THDP), thi 95.19
2c42_A1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron- 94.73
2nxw_A565 Phenyl-3-pyruvate decarboxylase; thiamine pyrophosphate 90.45
2ez9_A603 Pyruvate oxidase; TPP enzyme, reaction intermediate ana 94.47
3eya_A549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, 92.63
>2jgd_A 2-oxoglutarate dehydrogenase E1 component; flavoprotein, oxidoreductase, thiamine diphosphate, thiamine pyrophosphate, adenosine monophosphate; HET: AMP; 2.6A {Escherichia coli} PDB: 2jgd_B* Back     alignment and structure
Probab=100.00  E-value=0  Score=3150.22  Aligned_cols=921  Identities=44%  Similarity=0.755  Sum_probs=866.6

Q ss_pred             CCCHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             96238899983476367896899999999873805079899999873676433333343444322222222111233344
Q gi|254781051|r    1 MLQDLNKMFSLSSFLDGTNCCYIEDLYKSYQEDPSSVCKDWYPLFSFLDENSEEYDNLEDGIASFLKEESVASAVFSQKK   80 (957)
Q Consensus         1 M~~~~~~~f~~sSFL~g~Na~YIEeLYekYL~DP~SVd~sWr~fF~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (957)
                      |++++|+.|++||||+|+|++|||+||++|++||+|||++|+.||++++.+............         ........
T Consensus         1 M~~s~~k~~l~sSFL~G~Na~YIEeLYe~Yl~DP~SVd~sWr~yF~~l~~~~~~~~~~~s~~~---------~~~~~~~~   71 (933)
T 2jgd_A            1 MQNSALKAWLDSSYLSGANQSWIEQLYEDFLTDPDSVDANWRSTFQQLPGTGVKPDQFHSQTR---------EYFRRLAK   71 (933)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             CCCHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHCCCCCCCCCCCCCCHH---------HHHHHHHC
T ss_conf             983488999864566788999999999999649876689999999738666788543344226---------66655302


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCHHHCCCCCCCCCCCCCCCCCCHHHCCCCHHHCCCEEECCCCC-CCCC
Q ss_conf             555666555633678999999999999988170454016777777667877678766699978817157256657-8777
Q gi|254781051|r   81 SAVESSCSLGETQSVKDFFQVMKMIDAYRSYGHFKANIDPLGYNSHQKDLSELSPAHYGFVKADYDRKICMKGVL-GLES  159 (957)
Q Consensus        81 ~~~~~~~~~~~~~~~~kq~rV~~LI~AYR~~GHl~A~lDPLgl~~~~~~~peL~~~~yGLse~DLd~~f~~~~~~-g~~~  159 (957)
                      .+........+...+.++++|.+||+|||.+||+.|+||||++.. ++.+|+|+|++|||+++|||++|.++++. |.+.
T Consensus        72 ~~~~~~~~~~~~~~~~kq~~v~~LI~AYR~~GHl~A~LDPL~l~~-~~~~~eL~~~~~GLse~DLd~~f~~~~~~~g~~~  150 (933)
T 2jgd_A           72 DASRYSSTISDPDTNVKQVKVLQLINAYRFRGHQHANLDPLGLWQ-QDKVADLDPSFHDLTEADFQETFNVGSFASGKET  150 (933)
T ss_dssp             ------------CHHHHHHHHHHHHHHHHHHGGGGSCCCSSSCCC-CC---CCSSGGGGCCC-CTTSEEECTTCC---CE
T ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEECCCCCCCC-CCCCCCCCHHHCCCCHHHHCCEEECCCCCCCCCC
T ss_conf             455556666764667889999999999998561001689999988-8889877974469897994880305766678787


Q ss_pred             CCHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEC
Q ss_conf             78999999999840643027772489989999999984145778887988999999999999989999986403362222
Q gi|254781051|r  160 ATIPEIVDVLSHLYCSNIGVEFMHIVDSIERDWVRNTIEDYDFSSNFSKEEQRDILDKLVRAEGFEKFIDIKYKGAKRFG  239 (957)
Q Consensus       160 ~tL~eIi~~L~~tYCgsIGvEymHI~d~eer~Wlq~riE~~~~~~~~s~eeK~~iL~~L~~Ae~FE~FL~~Kf~g~KRFs  239 (957)
                      +||+|||++|++||||+||+|||||.|++||+|||+|||+.  .+.|++++|++||++|++||+||+|||+||||+||||
T Consensus       151 ~tL~eIi~~L~~~YCgsIG~EymHI~d~eer~Wl~~riE~~--~~~~s~eeK~~iL~~L~~ae~FE~FL~~Kf~g~KRFs  228 (933)
T 2jgd_A          151 MKLGELLEALKQTYCGPIGAEYMHITSTEEKRWIQQRIESG--RATFNSEEKKRFLSELTAAEGLERYLGAKFPGAKRFS  228 (933)
T ss_dssp             EEHHHHHHHHHHHHHSSEEEECSSCCCHHHHHHHHHHHCC---CCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCC--CCC
T ss_pred             CCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHHHHC--CCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             73999999999875464404432579999999999998722--7789979999999999999999999987547760673


Q ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCEEEEEEE
Q ss_conf             56465899999999999873791079980676552689998853798999998558874322345551001502688983
Q gi|254781051|r  240 ADGSEVIIPAIEEIIRQGVQQGVDEMILGMAHRGRLNVLSQIMNKLPRSIFYEFKGKGPSEKEYSGDVKYHLGLCCNRQI  319 (957)
Q Consensus       240 LEG~EslIP~L~~ii~~a~~~Gv~eiviGMaHRGRLNVL~Nvl~Kp~~~iF~EF~g~~~~~~~~sGDVKYHLG~s~~~~~  319 (957)
                      |||||||||+|++||+.|++.||++||||||||||||||+|||+||++.||+||+|+.. ...++||||||||+|+++++
T Consensus       229 lEG~EslIp~l~~li~~~~~~gv~~iviGMaHRGRLNvL~nvl~Kp~~~iF~EF~g~~~-~~~~sGDVKYHlG~s~~~~~  307 (933)
T 2jgd_A          229 LEGGDALIPMLKEMIRHAGNSGTREVVLGMAHRGRLNVLVNVLGKKPQDLFDEFAGKHK-EHLGTGDVKYHMGFSSDFQT  307 (933)
T ss_dssp             CTTCTTHHHHHHHHHHHHHTTTCCEEEEECCSTTHHHHHHHTTCCCHHHHHHHHHTCC---CCSCCCCGGGCCEEEEEEE
T ss_pred             CCCCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHCCCHHHHHHHHCCCCC-CCCCCCCCCCCCCEEEEECC
T ss_conf             47701299999999999975598359983134440578998755899999997527763-12456772225740100015


Q ss_pred             CCCEEEEEECCCCCCCHHCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCHHHHHHHHHCCCCC
Q ss_conf             59618999717877310004455323677776416665445556544540478886257533346725887645106774
Q gi|254781051|r  320 CGKDVKLLLQSNPSHLEFVDPVVIGSVRARQDLKAGIVGEKSISLVERSRVLPLIIHGDAAFAGQGIVSETFGLSGLSGY  399 (957)
Q Consensus       320 ~g~~v~lsL~~NPSHLEaVnPVv~G~~RAkQd~~~d~~~~~~~~~~~~~~vlpiliHGDAAfaGQGVV~Etl~ls~l~gY  399 (957)
                      +|++|||+|++||||||+|||||+|+||||||+++|.         ++++|||||||||||||||||||||||||+|+||
T Consensus       308 ~g~~v~lsL~~NPSHLE~VnPVv~G~~RA~Q~~~~~~---------~~~kvlpIliHGDAAf~GQGVV~Etl~ls~l~gY  378 (933)
T 2jgd_A          308 DGGLVHLALAFNPSHLEIVSPVVIGSVRARLDRLDEP---------SSNKVLPITIHGDAAVTGQGVVQETLNMSKARGY  378 (933)
T ss_dssp             TTEEEEEEECCCCSSTTCHHHHHHHHHHHHHTTSSSC---------CGGGEEEEEEEEHHHHHHCTHHHHHHHHTTSTTT
T ss_pred             CCCEEEEEECCCCCCCEECCCEEECEEEEEEEECCCC---------CCCEEEEEEEECCHHHCCCCHHHHHHHCCCCCCC
T ss_conf             9976999961697410100653411035777202688---------8762566786252664247625876405457886


Q ss_pred             CCCCEEEEEECCCEECCC-CCHHCCCCCCCCHHHHHHCCCEEEECCCCHHHHHHHHHHHHHHHHHHCCCEEEEEEECCCC
Q ss_conf             436579998416020124-7010246778400112203405874267889999999999999997389739986421125
Q gi|254781051|r  400 TVAGNIHLIINNQIGFTT-NPSSARSCTYASDISKSIGIPIFHVNGDDPEAVIRVVRMAVSFRMKFHKSVVIDIVCYRRF  478 (957)
Q Consensus       400 ~tGGTiHiVvNNQIGFTT-~p~d~RSs~Y~TDiAK~i~aPI~HVN~DdpEav~~~~~lA~~yR~~F~kDVvIDlv~YRr~  478 (957)
                      +||||||||||||||||| +|+|+|||+||||||||++||||||||||||||++|++||++||++|+|||||||||||||
T Consensus       379 ~tGGTiHiivNNQIGFTT~~p~d~RSs~YctDiAK~~~aPI~HVN~DdpEav~~a~~lA~~yR~~F~kDVvIDlvcYRR~  458 (933)
T 2jgd_A          379 EVGGTVRIVINNQVGFTTSNPLDARSTPYCTDIGKMVQAPIFHVNADDPEAVAFVTRLALDFRNTFKRDVFIDLVCYRRH  458 (933)
T ss_dssp             CCSCCEEEEEECC---------------CGGGGGGTTTCCEEEEETTCHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCC
T ss_pred             CCCCEEEEEECCCCCEECCCCCCCCCCCCCHHHHHHHCCCEEEECCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCC
T ss_conf             55864899854877513798321335776205888727977896489989999999999999999688727855653146


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC-------C
Q ss_conf             656435422355788888671899899999998644898989999999999999775666541258765666-------6
Q gi|254781051|r  479 GHNEGDEPSFTQPMMYKTIRSHKSVLQLYADSLMKNQVISKQELQSLANNWHKYLEAEYKESESYCPEKLGL-------L  551 (957)
Q Consensus       479 GHNE~DeP~fTQP~mY~~I~~hp~v~~~Y~~~Li~~g~it~~e~~~~~~~~~~~l~~~~~~~k~~~~~~~~~-------~  551 (957)
                      ||||+|||+||||+||++|++|||++++|+++|+++|+||+++++++.++|++.|+++++.++++.+....+       .
T Consensus       459 GHNE~DeP~fTQP~mY~~I~~hp~v~~~Y~~~Li~eg~it~~e~~~~~~~~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~  538 (933)
T 2jgd_A          459 GHNEADEPSATQPLMYQKIKKHPTPRKIYADKLEQEKVATLEDATEMVNLYRDALDAGDCVVAEWRPMNMHSFTWSPYLN  538 (933)
T ss_dssp             -----------CCTTHHHHHTSCCHHHHHHHHHHTTTSSCHHHHHHHHHHHHHHHHHTSCCCTTEECCCGGGCTTGGGSS
T ss_pred             CCCCCCCCCCCCHHHHHHHHCCCCHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             88977787888976766654599889999998741687678999999999999999878887655522455444455678


Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHCCCEEEEECCCC
Q ss_conf             56862666778999999998874368998620567788899899873343564211478988898863583157850100
Q gi|254781051|r  552 HNGENERKNSVSKEILKKIGSSIIRLPKSFNTHKIVERLMANRQKMIETGKGIDWSMAESLAFGSLCYEGYKVRLSGQDC  631 (957)
Q Consensus       552 ~~~~~~~~T~v~~~~L~~i~~~l~~~Pe~f~~h~~v~k~~~~R~~~~~~~~~iDW~~AE~LA~~SLl~eG~~VRlsGQD~  631 (957)
                      ..+...++|||+.+.|++|+++++++|++|++||+|+|++++|++|++++.+|||||||+|||||||.||++||||||||
T Consensus       539 ~~~~~~~~Tgv~~~~L~~l~~~l~~~P~~f~~h~kv~ki~~~R~~~~~~~~~iDWa~AE~LAfgSLL~eG~~VRLSGQD~  618 (933)
T 2jgd_A          539 HEWDEEYPNKVEMKRLQELAKRISTVPEAVEMQSRVAKIYGDRQAMAAGEKLFDWGGAENLAYATLVDEGIPVRLSGEDS  618 (933)
T ss_dssp             CCTTCCCCCCCCHHHHHHHHHHTTCCCTTSCCCHHHHHHHHHHHHHHTTSSCBCHHHHHHHHHHHHHTTTCCEEEEETTT
T ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCEECCCCC
T ss_conf             65555678877899999999998418844341056778999999985068876277899999999997697610025645


Q ss_pred             CCCCCCCCEEEEEECCCCCEEEEHHHCCCCCCEEEEEECCCCCCCHHHHHHCCCCCCCCCCEEECCCCCCCCCCCHHHHH
Q ss_conf             22333230279997788844556344278984599982431111013432022113865311100002442454102256
Q gi|254781051|r  632 ERGTFSHRHAILCDQETGKRYFPLGNISKDQGHCEVVNSFLSEQAVLGFEYGYSLNNLNALTIWEAQFGDFANGAQVILD  711 (957)
Q Consensus       632 ~RGTFshRHavl~dq~t~~~y~pL~~l~~~q~~f~v~nS~LSE~avlgFEyGys~~~p~~L~iWEAQFGDF~NgAQviiD  711 (957)
                      +||||||||||||||+|+++|+||+||+++|++|+||||+|||+||||||||||+++|++|||||||||||+||||||||
T Consensus       619 ~RGTFShRHavl~Dq~t~~~y~PL~~l~~~q~~f~v~nS~LSE~avlgFEyGys~~~p~~LviWEAQFGDF~NgAQviiD  698 (933)
T 2jgd_A          619 GRGTFFHRHAVIHNQSNGSTYTPLQHIHNGQGAFRVWDSVLSEEAVLAFEYGYATAEPRTLTIWEAQFGDFANGAQVVID  698 (933)
T ss_dssp             TTCTTSCCCCSEECSSSSCEECGGGCSCTTCCCEEEECCCSCHHHHHHHHHHHHHHCTTSEEEEEC-CGGGGGGGHHHHH
T ss_pred             CCCCCCCCCEEEEECCCCCEEEEHHCCCCCCCCEEEECCCCHHHHHHHHHHCCCCCCCCHHHHHHHHHCCCCCCCHHHHH
T ss_conf             66543323136760577734753101666788738874622166665655221336873130234453244454234355


Q ss_pred             HHHHHHHHHHCCCCCCEEECCCCCCCCCCCCCCCCHHHHHHHCCCCCEEEEECCCHHHHHHHHHHHHCCCCCCCEEEECC
Q ss_conf             55420257623336813543688888887656440578875214378269724889999999999743534886898566
Q gi|254781051|r  712 QFITAGEQKWLCTSNLVCLLPHGYEGQGPEHSSARLERFLQMCAENNMYVANCTSPANYFHILRRQIYDRSSRPLIMMAP  791 (957)
Q Consensus       712 qfiss~e~KW~~~sglvllLPHGyeGqGPEHSSaRlERfLQl~a~~N~~V~~~ttpAq~FH~LRRQ~~r~~rkPLiv~tP  791 (957)
                      |||||||+||+|+|||||||||||||||||||||||||||||||++|||||||||||||||+|||||+|+||||||||||
T Consensus       699 qfi~sge~KW~~~sglvllLPHGyeGqGPEHSSaR~ERfLQl~a~~N~~V~~~ttpAq~FH~LRRQ~~r~~rkPLiv~tP  778 (933)
T 2jgd_A          699 QFISSGEQKWGRMCGLVMLLPHGYEGQGPEHSSARLERYLQLCAEQNMQVCVPSTPAQVYHMLRRQALRGMRRPLVVMSP  778 (933)
T ss_dssp             HTTTTHHHHHCCCCCCEEEEECCCSSSCTTSSCCCHHHHHHTCCTTCCEEECCCSHHHHHHHHHHHHHSSCCCCEEEEEC
T ss_pred             HHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCEEECCCCHHHHHHHHHHHHCCCCCCCEEEECC
T ss_conf             56421777756457758973788888897655402889999754268589746975999999999851457888699685


Q ss_pred             CHHHCCCCCCCCHHHHCCCCCEEECCCCCCCCCCCCCCCCCCHHHCCEEEEECCHHHHHHHHHHHHCCCCCEEEEEEECC
Q ss_conf             02210801268878937998603515776433444544457954576899868857899999999769986899984014
Q gi|254781051|r  792 KSLLRHKRVVSSLSDMTCGSVFQAVLSDDAEYHGKTSVKLKEDSHIRRVILCTGKVYYDLLDNRDMRNIADIYLLRIEQL  871 (957)
Q Consensus       792 KsLLR~~~a~S~l~d~~~g~~F~~vi~d~~~~~~~~~~~~~~~~~v~rvi~csGKvyydL~~~r~~~~~~~vaivRiEqL  871 (957)
                      |||||||.|+|+|+||++|| |++||+|+.         ..+|++|||||||||||||||+++|++++.+||||||||||
T Consensus       779 KsLLR~~~a~S~l~e~~~g~-F~~vi~d~~---------~~~~~~v~rvi~csGKvyydL~~~r~~~~~~~vaivRiEQL  848 (933)
T 2jgd_A          779 KSLLRHPLAVSSLEELANGT-FLPAIGEID---------ELDPKGVKRVVMCSGKVYYDLLEQRRKNNQHDVAIVRIEQL  848 (933)
T ss_dssp             SGGGGCTTCCBCHHHHHHCC-CCSEECCCS---------CCCGGGCCEEEEECTTHHHHHHHHHHHTTCCSEEEEEECEE
T ss_pred             HHHHCCCCCCCCHHHHCCCC-CEEECCCCC---------CCCHHCCCEEEEECCHHHHHHHHHHHHCCCCCEEEEEEEEC
T ss_conf             67655865579989917996-156368756---------57851198899907799999999999779998799985004


Q ss_pred             CCCHHHHHHHHHHHCCCC-EEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHH
Q ss_conf             868289999998537998-3998067853178457899769999875056776018975366467233867899999999
Q gi|254781051|r  872 YPFPEDYLIKVLSRFVQA-EIVWCQEEPQNMGAWTFIEPYLEKVLHSIGADYSRVRYVGRLPSASTAVGHMSRHLEQLSS  950 (957)
Q Consensus       872 yPfP~~~l~~~l~~y~~~-e~vW~QEEp~N~GaW~~v~~rl~~~l~~~~~~~~~~~y~gR~~~aspA~G~~~~H~~e~~~  950 (957)
                      ||||+++|+++|++|||+ |||||||||+|||||+||+|||++++.    ...+++|||||++||||||+.++|++||++
T Consensus       849 yPfP~~~l~~~l~~y~n~~~~vW~QEEp~N~GaW~~v~~rl~~~~~----~~~~l~yvgR~~~aspA~G~~~~H~~eq~~  924 (933)
T 2jgd_A          849 YPFPHKAMQEVLQQFAHVKDFVWCQEEPLNQGAWYCSQHHFREVIP----FGASLRYAGRPASASPAVGHMSVHQKQQQD  924 (933)
T ss_dssp             ESCCHHHHHHHHGGGTTCCEEEEEEEEETTSTTHHHHHHHHHTTSC----TTCEEEEEEECCCSSSSCSCHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHC----CCCCEEEECCCCCCCCCCCCHHHHHHHHHH
T ss_conf             8998899999998589998589962465646768779999999853----699537858888788877798999999999


Q ss_pred             HHHHHHC
Q ss_conf             9998719
Q gi|254781051|r  951 FIEDALK  957 (957)
Q Consensus       951 li~~a~~  957 (957)
                      ||++||.
T Consensus       925 i~~~a~~  931 (933)
T 2jgd_A          925 LVNDALN  931 (933)
T ss_dssp             HHHHHHC
T ss_pred             HHHHHHC
T ss_conf             9999858



>1umd_A E1-alpha, 2-OXO acid dehydrogenase alpha subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.11 PDB: 1um9_A* 1umc_A* 1umb_A* Back     alignment and structure
>1qs0_A 2-oxoisovalerate dehydrogenase alpha-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.11 PDB: 2bp7_A Back     alignment and structure
>1w85_A Pyruvate dehydrogenase E1 component, alpha subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.11 PDB: 3duf_A* 3dv0_A* 3dva_A* 1w88_A* Back     alignment and structure
>2ozl_A PDHE1-A type I, pyruvate dehydrogenase E1 component alpha subunit, somatic form; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.11 PDB: 1ni4_A* 3exe_A* 3exi_A 3exh_A* 3exg_A 3exf_A* Back     alignment and structure
>2bfd_A 2-oxoisovalerate dehydrogenase alpha subunit; oxidoreductase, ketoacid dehydrogenase, branched-chain, multi- enzyme complex, acylation; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.11 PDB: 1v16_A* 2bfc_A* 1v1r_A* 1olu_A* 2bfb_A* 1v1m_A* 2bew_A* 1dtw_A* 1olx_A* 1ols_A* 1wci_A* 1x80_A* 2beu_A* 1u5b_A* 2bev_A* 1v11_A* 1x7x_A* 1x7y_A* 1x7w_A* 1x7z_A* ... Back     alignment and structure
>1ik6_A Pyruvate dehydrogenase; E1BETA, tetramer, GXXXG, oxidoreductase; 2.00A {Pyrobaculum aerophilum} SCOP: c.36.1.7 c.48.1.2 Back     alignment and structure
>2bfd_B 2-oxoisovalerate dehydrogenase beta subunit; oxidoreductase, ketoacid dehydrogenase, branched-chain, multi- enzyme complex, acylation; HET: TDP; 1.39A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1dtw_B* 1olu_B* 1ols_B* 1v11_B* 1v16_B* 1v1m_B* 1u5b_B* 1wci_B* 1v1r_B* 1x7x_B* 1x7w_B* 1x7z_B* 1x80_B* 2beu_B* 2bev_B* 2bew_B* 2bfb_B* 2bfc_B* 1x7y_B* 2bfe_B* ... Back     alignment and structure
>2o1s_A 1-deoxy-D-xylulose-5-phosphate synthase; DXS, thiamine, isoprenoid, transferase; HET: TDP; 2.40A {Escherichia coli} Back     alignment and structure
>1umd_B E1-beta, 2-OXO acid dehydrogenase beta subunit; alpha(2)beta(2) tetramer, structural genomics; HET: TDP; 1.90A {Thermus thermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1um9_B* 1umc_B* 1umb_B* Back     alignment and structure
>1w85_B Pyruvate dehydrogenase E1 component, beta subunit; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: c.36.1.7 c.48.1.2 PDB: 1w88_B* 3dva_B* 3dv0_B* 3duf_B* Back     alignment and structure
>2ozl_B PDHE1-B, pyruvate dehydrogenase E1 component subunit beta; pyruvate_dehydrogenase_complex, human, multienzyme_complex_component; HET: TPP; 1.90A {Homo sapiens} SCOP: c.36.1.7 c.48.1.2 PDB: 1ni4_B* 3exe_B* 3exf_B* 3exg_B 3exh_B* 3exi_B Back     alignment and structure
>1qs0_B 2-oxoisovalerate dehydrogenase beta-subunit; heterotetramer, THDP cofactor, oxidoreductase; HET: TDP; 2.40A {Pseudomonas putida} SCOP: c.36.1.7 c.48.1.2 PDB: 2bp7_B Back     alignment and structure
>2o1x_A 1-deoxy-D-xylulose-5-phosphate synthase; thiamin, isoprenoid, DXS, transferase; HET: TDP; 2.90A {Deinococcus radiodurans} Back     alignment and structure
>2e6k_A Transketolase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.09A {Thermus thermophilus HB8} Back     alignment and structure
>3m49_A Transketolase; alpha-beta-alpha sandwich, csgid, transferase, structural genomics, center for structural genomics of infectious diseases; HET: MSE TDP PG5 TRS BTB; 2.00A {Bacillus anthracis} PDB: 3hyl_A* Back     alignment and structure
>2r8o_A Transketolase 1, TK 1; reaction intermediate, calcium, metal-binding, thiamine pyrophosphate, transferase; HET: T5X; 1.47A {Escherichia coli K12} SCOP: c.36.1.6 c.36.1.10 c.48.1.1 PDB: 2r5n_A* 2r8p_A* 1qgd_A* Back     alignment and structure