254781052

254781052

dihydrolipoamide succinyltransferase

GeneID in NCBI database:8210075Locus tag:CLIBASIA_04770
Protein GI in NCBI database:254781052Protein Accession:YP_003065465.1
Gene range:+(1055786, 1057096)Protein Length:436aa
Gene description:dihydrolipoamide succinyltransferase
COG prediction:[C] Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes
KEGG prediction:sucB; dihydrolipoamide succinyltransferase (EC:2.3.1.61); K00658 2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
SEED prediction:Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61)
Pathway involved in KEGG:Citrate cycle (TCA cycle) [PATH:las00020]
Lysine degradation [PATH:las00310]
Subsystem involved in SEED:Lipoic acid metabolism;
TCA Cycle
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430------
MLTGIINNTGILEEKVRSMATKILVPSLGESVNEATVGTWLKEIGESVEIGEILVELETDKVTVEVPSPVSGKLHEMSVAKGDTVTYGGFLGYIVEIARDEDESIKQNSPNSTANGLPEITDQGFQMPHSPSASKLIAESGLSPSDIKGTGKRGQILKSDVMAAISRSESSVDQSTVDSHKKGVFSRIINSASNIFEKSSVSEELSEERVKMSRLRQTVAKRLKDAQNTAAILSTYNEVNMSRIISIRSRYKDIFEKKHGIKLGFMGFFTKAASHVLQEIKGVNAEIDGDHIVYKNYCHIGVAVGTDKGLVVPVIRHADKMNIVEIEREIARLGREARAGHLSMRDLQNGTFTISNGGVYGSLLSSPILNPPQSGILGMHKIQERPIVEDGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRLKELLEDPERFILDL
ccccccccccccccccccccEEEEcccccccccEEEEEEEEcccccEEccccEEEEEEccEEEEEEEcccccEEEEEEcccccccccccEEEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHHccccHHHcccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccEEccccHHHHHHHHHHHHcccccEEEEEEEEEHHHHHHHHHHHHHHHHHccccEEEHHHHHHHHHHHHHHHcccEEEEEEccEEEEcccccEEEEEEccccEEEEEEEccccccHHHHHHHHHHHHHHHHcccccHHHHcccEEEEEEccccccEEEEcccccccEEEEEEcccEEEEEEEccEEEEEEEEEEEEEEEccEEEHHHHHHHHHHHHHHHHcHHHHHHcc
cccHEHHHHHHHcccccccEEEEEcccccccHcccEEEEEEccccccccccccEEEEcccEEEEEEcccccccHHHHEcccccEEEEcEEEEEEcccccccccccHHccccccHHHHHHHccccccccccHHHHHHHHHccccHHHcccccccccEEHHHHHHHHHcccccccccccccccccccccHHccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEcccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccEEEEEccccEEEcccccEEEcEEEccEEEccEEccHHHccHHHHHHHHHHHHHHHHcccccHHHHccccEEEEEccccccccccccccccccEEEEEcccEEEEEEccccEEEEEEEEEEEEEEcccccHHHHHHHHHHHHHHHHcHHHHHccc
MLTGIINNTGILEEKVRSMATKILVpslgesvneATVGTWLKEIGESVEIGEILVELEtdkvtvevpspvsgklhemsvakgdtvtyGGFLGYIVEIArdedesikqnspnstanglpeitdqgfqmphspsaskliaesglspsdikgtgkrgqilKSDVMAAISrsessvdqstvdshkkgVFSRIINSASNIFEKSSVSEELSEERVKMSRLRQTVAKRLKDAQNTAAILSTYNEVNMSRIISIRSRYKDIFEKKHGIKLGFMGFFTKAASHVLQEIKGvnaeidgdhivykNYCHIGvavgtdkglvvpvirhadkMNIVEIEREIARLGREARaghlsmrdlqngtftisnggvygsllsspilnppqsgilgmhkiqerpivedgqivIRPMMYLALSYDHRIVDGKEAVTFLVRLKElledperfildl
mltgiinntgileEKVRSMATKILvpslgesvneaTVGTWLKEIGESVEIGEILVeletdkvtvevpspvsgklhemsvakgdtvtYGGFLGYIVEIARDEDESIKQNSPNSTANGLPEITDQGFQMPHSPSASKLIAESGLSPSDIKGTGKRGQILKSDVMAAISrsessvdqstvdshkkgvFSRIinsasnifekssvseelseerVKMSRLRQTVAkrlkdaqntaailstynevnmsrIISIRSRYKDIFEKKHGIKLGFMGFFTKAASHVLQEIKGVNAEIDGDHIVYKNYCHIGVAVGTDKGLVVPVIRHADKMNIVEIEREIARLGREARAGHLSMRDLQNGTFTISNGGVYGSLLSSPILNPPQSGILGMHKIQERPIVEDGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRLkelledperfildl
MLTGIINNTGILEEKVRSMATKILVPSLGESVNEATVGTWLKEIGESVEIGEILVELETDKVTVEVPSPVSGKLHEMSVAKGDTVTYGGFLGYIVEIARDEDESIKQNSPNSTANGLPEITDQGFQMPHSPSASKLIAESGLSPSDIKGTGKRGQILKSDVMAAISRSESSVDQSTVDSHKKGVFSRIINSASNIFekssvseelseeRVKMSRLRQTVAKRLKDAQNTAAILSTYNEVNMSRIISIRSRYKDIFEKKHGIKLGFMGFFTKAASHVLQEIKGVNAEIDGDHIVYKNYCHIGVAVGTDKGLVVPVIRHADKMNIVEIEREIARLGREARAGHLSMRDLQNGTFTISNGGVYGSLLSSPILNPPQSGILGMHKIQERPIVEDGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRLKELLEDPERFILDL
************EEKVRSMATKILVPSLGESVNEATVGTWLKEIGESVEIGEILVELETDKVTVEVPSPVSGKLHEMSVAKGDTVTYGGFLGY*************************************************************QILKSDV***************************************************SRLRQTVAKRLKDAQNTAAILSTYNEVNMSRIISIRSRYKDIFEKKHGIKLGFMGFFTKAASHVLQEIKGVNAEIDGDHIVYKNYCHIGVAVGTDKGLVVPVIRHADKMNIVEIEREIARLGREARAGHLSMRDLQNGTFTISNGGVYGSLLSSPILNPPQSGILGMHKIQERPIVEDGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRLKELLEDPERFILDL
MLTGIINNTGILEEKVRSMATKILVPSLGESVNEATVGTWLKEIGESVEIGEILVELETDKVTVEVPSPVSGKLHEMSVAKGDTVTYGGFLGYIVEIARDED**********TANGLPEITDQGFQMPHSPSASKLIAESGLSPSDIKGTGKRGQILKSDVMAA****************KKGVFSRIINSASNIFE*****************LRQTVAKRLKDAQNTAAILSTYNEVNMSRIISIRSRYKDIFEKKHGIKLGFMGFFTKAASHVLQEIKGVNAEIDGDHIVYKNYCHIGVAVGTDKGLVVPVIRHADKMNIVEIEREIARLGREARAGHLSMRDLQNGTFTISNGGVYGSLLSSPILNPPQSGILGMHKIQERPIVEDGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRLKELLEDPERFILDL
*LTGIINNTGILEEKVRSMATKILVPSLGESVNEATVGTWLKEIGESVEIGEILVELETDKVTVEVPSPVSGKLHEMSVAKGDTVTYGGFLGYIVEI********************************SPSASK****S*LSPSDIKGTGKRGQILKSDVMAAISRS***************************************ERVKMSRLRQTVAKRLKDAQNTAAILSTYNEVNMSRIISIRSRYKDIFEKKHGIKLGFMGFFTKAASHVLQEIKGVNAEIDGDHIVYKNYCHIGVAVGTDKGLVVPVIRHADKMNIVEIEREIARLGREARAGHLSMRDLQNGTFTISNGGVYGSLLSSPILNPPQSGILGMHKIQERPIVEDGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRLKELLEDPERFILDL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTGIINNTGILEEKVRSMATKILVPSLGESVNEATVGTWLKEIGESVEIGEILVELETDKVTVEVPSPVSGKLHEMSVAKGDTVTYGGFLGYIVEIARDEDESIKQNSPNSTANGLPEITDQGFQMPHSPSASKLIAESGLSPSDIKGTGKRGQILKSDVMAAISRSESSVDQSTVDSHKKGVFSRIINSASNIFEKSSVSEELSEERVKMSRLRQTVAKRLKDAQNTAAILSTYNEVNMSRIISIRSRYKDIFEKKHGIKLGFMGFFTKAASHVLQEIKGVNAEIDGDHIVYKNYCHIGVAVGTDKGLVVPVIRHADKMNIVEIEREIARLGREARAGHLSMRDLQNGTFTISNGGVYGSLLSSPILNPPQSGILGMHKIQERPIVEDGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRLKELLEDPERFILDL
MLTGIINNTGILEEKVRSMATKILVPSLGESVNEATVGTWLKEIGESVEIGEILVELETDKVTVEVPSPVSGKLHEMSVAKGDTVTYGGFLGYIVEIARDEDESIKQNSPNSTANGLPEITDQGFQMPHSPSASKLIAESGLSPSDIKGTGKRGQILKSDVMAAISRSESSVDQSTVDSHKKGVFSRIINSASNIFEKSSVSEELSEERVKMSRLRQTVAKRLKDAQNTAAILSTYNEVNMSRIISIRSRYKDIFEKKHGIKLGFMGFFTKAASHVLQEIKGVNAEIDGDHIVYKNYCHIGVAVGTDKGLVVPVIRHADKMNIVEIEREIARLGREARAGHLSMRDLQNGTFTISNGGVYGSLLSSPILNPPQSGILGMHKIQERPIVEDGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRLKELLEDPERFILDL
MLTGIINNTGILEEKVRSMATKILVPSLGESVNEATVGTWLKEIGESVEIGEILVELETDKVTVEVPSPVSGKLHEMSVAKGDTVTYGGFLGYIVEIARDEDESIKQNSPNSTANGLPEITDQGFQMPHSPSASKLIAESGLSPSDIKGTGKRGQILKSDVMAAISRSESSVDQSTVDSHKKGVFSRIINSASNIFEKSSVSEELSEERVKMSRLRQTVAKRLKDAQNTAAILSTYNEVNMSRIISIRSRYKDIFEKKHGIKLGFMGFFTKAASHVLQEIKGVNAEIDGDHIVYKNYCHIGVAVGTDKGLVVPVIRHADKMNIVEIEREIARLGREARAGHLSMRDLQNGTFTISNGGVYGSLLSSPILNPPQSGILGMHKIQERPIVEDGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRLKELLEDPERFILDL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target436 dihydrolipoamide succinyltransferase [Candidatus Liberi
254780674423 pyruvate dehydrogenase complex dihydrolipoamide ac 7e-40
254780673467 pyruvate dehydrogenase subunit beta [Candidatus Li 5e-05
>gi|254780674|ref|YP_003065087.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 423 Back     alignment
 Score =  156 bits (394), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 121/434 (27%), Positives = 207/434 (47%), Gaps = 30/434 (6%)

Query: 19  MATKILVPSLGESVNEATVGTWLKEIGESVEIGEILVELETDKVTVEVPSPVSGKLHEMS 78
           M   I +PSL  ++ E  +  W+K+ G+ +  G+IL E+ETDK  +E  S   G + E+ 
Sbjct: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61

Query: 79  VAKG-DTVTYGGFLGYIVEIARDEDESIKQNSPNSTANGLPEITDQGFQMP--------- 128
           V  G + +        I+ I  D  E I  + P S  N +    +     P         
Sbjct: 62  VPAGTENIAVNS---PILNILMDSTE-IPPSPPLSKENIVEVREEHSHSSPVVVREKHSK 117

Query: 129 ----HSPSASKLIAESGLSPSDIKGTGKRGQILKSDVMAAISRSESSVDQSTVDSHKKGV 184
                SP A +L  E G+  S + G+G  G+I+KSD+   IS   +  D ST+ S   G+
Sbjct: 118 NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSF--GL 175

Query: 185 FSRIINS-ASNIFEKSSVSEELSEERVKMSRLRQTVAKRLKDAQNTAAILSTYNEVNMSR 243
               I++   N+F K S       E +    +R+T+A RL+ ++ T        + N+  
Sbjct: 176 VDESIDANILNLFAKDSY------EVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDN 229

Query: 244 IISIR---SRYKDIFEKKHGIKLGFMGFFTKAASHVLQEIKGVNAEIDGDHIVYKNYCHI 300
           ++S+R   +R      ++   K+       KA +  + ++   N     + ++   +  I
Sbjct: 230 LLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDI 289

Query: 301 GVAVGTDKGLVVPVIRHADKMNIVEIEREIARLGREARAGHLSMRDLQNGTFTISNGGVY 360
            VAV    G+V P+IR AD+ +I++I  E+ +L + A+   L   + Q GT +ISN G+ 
Sbjct: 290 SVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGML 349

Query: 361 GSLLSSPILNPPQSGILGMHKIQERPIVEDGQIVIRPMMYLALSYDHRIVDGKEAVTFLV 420
           G      ++NPPQS IL +   +++ + ++ +I +  +M   LS DHR VDG  A   L 
Sbjct: 350 GINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLA 409

Query: 421 RLKELLEDPERFIL 434
           + KE +E+P   ++
Sbjct: 410 KFKEYIENPVWMLM 423

>gi|254780673|ref|YP_003065086.1| pyruvate dehydrogenase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 467 Back     alignment
 Score = 40.4 bits (93), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 35/64 (54%)

Query: 19 MATKILVPSLGESVNEATVGTWLKEIGESVEIGEILVELETDKVTVEVPSPVSGKLHEMS 78
          M   + +PSL  ++ E  +  W K  G+ ++ G+I+ E+ETDK  +EV S   G L ++ 
Sbjct: 1  MPILVTMPSLSPTMTEGNIAKWKKNEGDLIKQGDIIYEVETDKAVMEVESIDEGILGKIL 60

Query: 79 VAKG 82
             G
Sbjct: 61 CPNG 64

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target436 dihydrolipoamide succinyltransferase [Candidatus Liberi
315122390409 dihydrolipoamide succinyltransferase [Candidatus Liberi 1 1e-172
150398137415 dihydrolipoamide succinyltransferase [Sinorhizobium med 1 1e-142
15966805417 dihydrolipoamide acetyltransferase [Sinorhizobium melil 1 1e-141
254717984408 dihydrolipoamide succinyltransferase [Brucella sp. 83/1 1 1e-141
209551251421 dihydrolipoamide succinyltransferase [Rhizobium legumin 1 1e-140
327188910421 dihydrolipoamide S-succinyltransferase protein [Rhizobi 1 1e-140
190893733421 dihydrolipoamide S-succinyltransferase [Rhizobium etli 1 1e-140
86359468418 dihydrolipoamide acetyltransferase [Rhizobium etli CFN 1 1e-139
241206652420 dihydrolipoamide succinyltransferase [Rhizobium legumin 1 1e-139
110635727428 dihydrolipoamide acetyltransferase [Mesorhizobium sp. B 1 1e-139
>gi|315122390|ref|YP_004062879.1| dihydrolipoamide succinyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 409 Back     alignment and organism information
 Score =  608 bits (1569), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 313/422 (74%), Positives = 359/422 (85%), Gaps = 17/422 (4%)

Query: 19  MATKILVPSLGESVNEATVGTWLKEIGESVEIGEILVELETDKVTVEVPSPVSGKLHEMS 78
           MATKILVPSLGESV+EATVGTW K++G+ VEIGE LV+LETDKV++EVPSPVSG+L ++S
Sbjct: 1   MATKILVPSLGESVSEATVGTWSKKVGDFVEIGETLVDLETDKVSIEVPSPVSGELTDIS 60

Query: 79  VAKGDTVTYGGFLGYIVEIARDEDESIKQNSPNSTANGLPEITDQ-GFQMPHSPSASKLI 137
           VA G+ V  GGFLGY+ E++  +    K +   ++     +I ++ G+ MP SPSA+KLI
Sbjct: 61  VATGEIVIAGGFLGYVSEVSGQKSIKKKSSHSIAS-----DIVERVGYHMPQSPSAAKLI 115

Query: 138 AESGLSPSDIKGTGKRGQILKSDVMAAISRS---ESSVDQSTVDSHKKGVFSRIINSASN 194
           AESG+S SDI GTGKRGQILKSDV  AIS +         S+VD+      S I+   SN
Sbjct: 116 AESGMSLSDITGTGKRGQILKSDVETAISNTVSSSDKSRLSSVDT------SNILVKQSN 169

Query: 195 IFEKSSVSEELSEERVKMSRLRQTVAKRLKDAQNTAAILSTYNEVNMSRIISIRSRYKDI 254
               S+++ E SEERVKMSRLR TVAKRLKD+QNTAAILSTYNEVNMSRI+SIRS YK+I
Sbjct: 170 --NGSNIAGEESEERVKMSRLRHTVAKRLKDSQNTAAILSTYNEVNMSRILSIRSCYKEI 227

Query: 255 FEKKHGIKLGFMGFFTKAASHVLQEIKGVNAEIDGDHIVYKNYCHIGVAVGTDKGLVVPV 314
           FEKKHGIKLGFMGFFTKA S  LQEI+GVNAEIDGD+IVYKNYCHIGVAVGTDKGLVVPV
Sbjct: 228 FEKKHGIKLGFMGFFTKAVSQALQEIRGVNAEIDGDYIVYKNYCHIGVAVGTDKGLVVPV 287

Query: 315 IRHADKMNIVEIEREIARLGREARAGHLSMRDLQNGTFTISNGGVYGSLLSSPILNPPQS 374
           +RHA+KM++V+IEREIARLG+EARAG+LSMRDLQ+GTFTISNGGVYGSLLS+PILNPPQS
Sbjct: 288 VRHAEKMSLVDIEREIARLGQEARAGNLSMRDLQDGTFTISNGGVYGSLLSAPILNPPQS 347

Query: 375 GILGMHKIQERPIVEDGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRLKELLEDPERFIL 434
           GILGMHKIQERPIVEDGQIVIRPMMYLALSYDHRIVDGKEAVTFLVR+KELLEDPERFIL
Sbjct: 348 GILGMHKIQERPIVEDGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRIKELLEDPERFIL 407

Query: 435 DL 436
           DL
Sbjct: 408 DL 409


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150398137|ref|YP_001328604.1| dihydrolipoamide succinyltransferase [Sinorhizobium medicae WSM419] Length = 415 Back     alignment and organism information
>gi|15966805|ref|NP_387158.1| dihydrolipoamide acetyltransferase [Sinorhizobium meliloti 1021] Length = 417 Back     alignment and organism information
>gi|254717984|ref|ZP_05179795.1| dihydrolipoamide succinyltransferase [Brucella sp. 83/13] Length = 408 Back     alignment and organism information
>gi|209551251|ref|YP_002283168.1| dihydrolipoamide succinyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 421 Back     alignment and organism information
>gi|327188910|gb|EGE56102.1| dihydrolipoamide S-succinyltransferase protein [Rhizobium etli CNPAF512] Length = 421 Back     alignment and organism information
>gi|190893733|ref|YP_001980275.1| dihydrolipoamide S-succinyltransferase [Rhizobium etli CIAT 652] Length = 421 Back     alignment and organism information
>gi|86359468|ref|YP_471360.1| dihydrolipoamide acetyltransferase [Rhizobium etli CFN 42] Length = 418 Back     alignment and organism information
>gi|241206652|ref|YP_002977748.1| dihydrolipoamide succinyltransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 420 Back     alignment and organism information
>gi|110635727|ref|YP_675935.1| dihydrolipoamide acetyltransferase [Mesorhizobium sp. BNC1] Length = 428 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target436 dihydrolipoamide succinyltransferase [Candidatus Liberi
PRK05704407 PRK05704, PRK05704, dihydrolipoamide succinyltransferas 1e-180
TIGR01347403 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex d 1e-143
PTZ00144418 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferas 1e-115
COG0508404 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase co 1e-105
PRK11856411 PRK11856, PRK11856, branched-chain alpha-keto acid dehy 1e-102
PLN02226463 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 com 2e-90
PRK11855547 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; 2e-88
PRK11854633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltra 2e-71
TIGR02927590 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E 3e-67
TIGR01348546 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase compl 7e-56
TIGR01349435 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase compl 1e-51
KOG0557470 KOG0557, KOG0557, KOG0557, Dihydrolipoamide acetyltrans 5e-49
KOG0558474 KOG0558, KOG0558, KOG0558, Dihydrolipoamide transacylas 3e-48
PLN02528416 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase E2 c 8e-45
PLN02744539 PLN02744, PLN02744, dihydrolipoyllysine-residue acetylt 2e-42
KOG0559457 KOG0559, KOG0559, KOG0559, Dihydrolipoamide succinyltra 1e-110
pfam00198231 pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases acylt 1e-77
PRK11857306 PRK11857, PRK11857, dihydrolipoamide acetyltransferase; 3e-53
PRK14843347 PRK14843, PRK14843, dihydrolipoamide acetyltransferase; 4e-45
cd0684974 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolip 1e-20
PRK11855 547 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; 3e-16
TIGR02927 590 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E 2e-15
PRK14875371 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit di 3e-15
PRK11854 633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltra 2e-13
pfam0036473 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme 1e-12
PRK11854 633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltra 4e-12
cd0666373 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domai 2e-11
TIGR01348 546 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase compl 3e-09
PRK11892464 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta 2e-08
cd0685067 cd06850, biotinyl_domain, The biotinyl-domain or biotin 1e-05
TIGR027121201 TIGR02712, urea_carbox, urea carboxylase 6e-05
PRK09282592 PRK09282, PRK09282, pyruvate carboxylase subunit B; Val 7e-05
COG0511140 COG0511, AccB, Biotin carboxyl carrier protein [Lipid m 8e-05
TIGR01108582 TIGR01108, oadA, oxaloacetate decarboxylase alpha subun 0.001
PRK14040593 PRK14040, PRK14040, oxaloacetate decarboxylase; Provisi 0.001
cd0684896 cd06848, GCS_H, Glycine cleavage H-protein 0.002
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Revie 5e-13
pfam0281739 pfam02817, E3_binding, e3 binding domain 1e-06
>gnl|CDD|180214 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>gnl|CDD|162309 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>gnl|CDD|185477 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|30854 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|183339 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>gnl|CDD|183338 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|183337 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|131973 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|162310 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|162311 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|35777 KOG0557, KOG0557, KOG0557, Dihydrolipoamide acetyltransferase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|35778 KOG0558, KOG0558, KOG0558, Dihydrolipoamide transacylase (alpha-keto acid dehydrogenase E2 subunit) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|178143 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information
>gnl|CDD|178345 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>gnl|CDD|35779 KOG0559, KOG0559, KOG0559, Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|143956 pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases acyltransferase (catalytic domain) Back     alignment and domain information
>gnl|CDD|183340 PRK11857, PRK11857, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|184847 PRK14843, PRK14843, dihydrolipoamide acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>gnl|CDD|183338 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|131973 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|183337 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|144088 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme Back     alignment and domain information
>gnl|CDD|183337 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>gnl|CDD|162310 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|183363 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>gnl|CDD|162983 TIGR02712, urea_carbox, urea carboxylase Back     alignment and domain information
>gnl|CDD|181754 PRK09282, PRK09282, pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>gnl|CDD|30857 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|162205 TIGR01108, oadA, oxaloacetate decarboxylase alpha subunit Back     alignment and domain information
>gnl|CDD|184472 PRK14040, PRK14040, oxaloacetate decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|133457 cd06848, GCS_H, Glycine cleavage H-protein Back     alignment and domain information
>gnl|CDD|183391 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|111687 pfam02817, E3_binding, e3 binding domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 436 dihydrolipoamide succinyltransferase [Candidatus Liberi
PRK05704406 dihydrolipoamide succinyltransferase; Validated 100.0
PRK11855549 dihydrolipoamide acetyltransferase; Reviewed 100.0
TIGR01349584 PDHac_trf_mito pyruvate dehydrogenase complex dihydroli 100.0
PRK11854630 aceF dihydrolipoamide acetyltransferase; Validated 100.0
TIGR01347435 sucB 2-oxoglutarate dehydrogenase, E2 component, dihydr 100.0
PTZ00144430 dihydrolipoamide succinyltransferase; Provisional 100.0
TIGR01348655 PDHac_trf_long pyruvate dehydrogenase complex dihydroli 100.0
TIGR02927607 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, 100.0
COG0508404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dih 100.0
PRK11856324 branched-chain alpha-keto acid dehydrogenase subunit E2 100.0
KOG0557470 consensus 100.0
KOG0558474 consensus 100.0
KOG0559457 consensus 100.0
PRK11857316 dihydrolipoamide acetyltransferase; Reviewed 100.0
pfam00198231 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase ( 100.0
PRK12270 1234 kgd alpha-ketoglutarate decarboxylase; Reviewed 100.0
PRK13757219 chloramphenicol acetyltransferase; Provisional 99.28
pfam00302206 CAT Chloramphenicol acetyltransferase. 99.03
COG4845219 Chloramphenicol O-acetyltransferase [Defense mechanisms 98.44
TIGR02927 607 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, 99.93
PRK11854 630 aceF dihydrolipoamide acetyltransferase; Validated 99.93
PRK11855549 dihydrolipoamide acetyltransferase; Reviewed 99.92
PRK11892464 pyruvate dehydrogenase subunit beta; Provisional 99.92
TIGR01348 655 PDHac_trf_long pyruvate dehydrogenase complex dihydroli 99.85
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are pre 99.85
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltr 99.84
pfam0036473 Biotin_lipoyl Biotin-requiring enzyme. This family cove 99.8
TIGR01349584 PDHac_trf_mito pyruvate dehydrogenase complex dihydroli 99.75
cd0685067 biotinyl_domain The biotinyl-domain or biotin carboxyl 99.43
PRK05641148 putative acetyl-CoA carboxylase biotin carboxyl carrier 99.23
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabolism] 99.21
PRK06549132 acetyl-CoA carboxylase biotin carboxyl carrier protein 99.18
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier protein 99.13
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl carrier 99.13
PRK09282580 pyruvate carboxylase subunit B; Validated 99.03
PRK0705180 hypothetical protein; Validated 98.91
PRK06302155 acetyl-CoA carboxylase biotin carboxyl carrier protein 98.84
TIGR01108616 oadA oxaloacetate decarboxylase alpha subunit; InterPro 98.79
TIGR027121226 urea_carbox urea carboxylase; InterPro: IPR014084 Membe 98.74
TIGR012351169 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 98.39
KOG0368 2196 consensus 98.2
PRK11578347 macrolide transporter subunit MacA; Provisional 97.95
PRK10476348 multidrug resistance protein MdtN; Provisional 97.71
TIGR03077110 not_gcvH glycine cleavage protein H homolog, Chlamydial 97.47
PRK00624113 glycine cleavage system protein H; Provisional 97.4
cd0684896 GCS_H Glycine cleavage H-protein. Glycine cleavage H-pr 97.36
COG0509131 GcvH Glycine cleavage system H protein (lipoate-binding 97.24
PRK13380132 glycine cleavage system protein H; Provisional 97.18
PRK01202127 glycine cleavage system protein H; Provisional 97.18
pfam01597122 GCV_H Glycine cleavage H-protein. This is a family of g 97.16
TIGR00531159 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier pr 96.85
PRK05352448 Na(+)-translocating NADH-quinone reductase subunit A; P 96.46
TIGR00527132 gcvH glycine cleavage system H protein; InterPro: IPR00 96.27
pfam05896257 NQRA Na(+)-translocating NADH-quinone reductase subunit 96.05
TIGR03309256 matur_yqeB selenium-dependent molybdenum hydroxylase sy 95.38
PRK1278484 hypothetical protein; Provisional 95.28
PRK0674884 hypothetical protein; Validated 95.25
COG4656529 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit 93.86
COG1726447 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, s 93.67
KOG3373172 consensus 93.11
PRK05035 725 electron transport complex protein RnfC; Provisional 92.78
TIGR01945444 rnfC electron transport complex, RnfABCDGE type, C subu 92.1
TIGR01936466 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocatin 91.61
PRK129991147 pyruvate carboxylase; Reviewed 91.56
COG4770645 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid 98.55
COG1038 1149 PycA Pyruvate carboxylase [Energy production and conver 98.29
PRK03598331 hypothetical protein; Provisional 97.8
PRK11556415 multidrug efflux system subunit MdtA; Provisional 97.72
PRK10559310 p-hydroxybenzoic acid efflux subunit AaeA; Provisional 97.67
PRK09859385 multidrug efflux system protein MdtE; Provisional 97.46
PRK09783407 copper/silver efflux system membrane fusion protein Cus 96.86
pfam00529304 HlyD HlyD family secretion protein. 95.66
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabolism] 95.62
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier protein 95.51
TIGR01843434 type_I_hlyD type I secretion membrane fusion protein, H 95.38
cd0685067 biotinyl_domain The biotinyl-domain or biotin carboxyl 95.37
PRK11892464 pyruvate dehydrogenase subunit beta; Provisional 94.89
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl carrier 94.63
PRK06549132 acetyl-CoA carboxylase biotin carboxyl carrier protein 93.91
PRK05641148 putative acetyl-CoA carboxylase biotin carboxyl carrier 93.87
TIGR01108616 oadA oxaloacetate decarboxylase alpha subunit; InterPro 93.53
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are pre 93.06
TIGR00998379 8a0101 efflux pump membrane protein; InterPro: IPR00569 92.31
COG0508404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dih 91.87
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltr 91.28
pfam0036473 Biotin_lipoyl Biotin-requiring enzyme. This family cove 90.94
PRK06302155 acetyl-CoA carboxylase biotin carboxyl carrier protein 90.94
pfam0281739 E3_binding e3 binding domain. This family represents a 98.53
cd06252316 M14_ASTE_ASPA_like_2 A functionally uncharacterized sub 97.24
KOG0238670 consensus 97.46
PRK09578385 periplasmic multidrug efflux lipoprotein precursor; Rev 97.31
PTZ00144430 dihydrolipoamide succinyltransferase; Provisional 95.35
PRK0705180 hypothetical protein; Validated 95.27
PRK05704406 dihydrolipoamide succinyltransferase; Validated 94.79
KOG0559457 consensus 94.44
PRK03598331 hypothetical protein; Provisional 94.37
pfam00529304 HlyD HlyD family secretion protein. 94.18
PRK11556415 multidrug efflux system subunit MdtA; Provisional 93.1
PRK11856324 branched-chain alpha-keto acid dehydrogenase subunit E2 92.84
PRK10476348 multidrug resistance protein MdtN; Provisional 92.76
PRK11578347 macrolide transporter subunit MacA; Provisional 92.62
PRK09578385 periplasmic multidrug efflux lipoprotein precursor; Rev 91.09
PRK09859385 multidrug efflux system protein MdtE; Provisional 90.64
TIGR01843434 type_I_hlyD type I secretion membrane fusion protein, H 90.61
pfam07247479 AATase Alcohol acetyltransferase. This family contains 93.74
TIGR02645499 ARCH_P_rylase putative thymidine phosphorylase; InterPr 93.33
PRK06078434 pyrimidine-nucleoside phosphorylase; Reviewed 91.04
TIGR00078276 nadC nicotinate-nucleotide pyrophosphorylase; InterPro: 90.2
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006257 This group of sequences represent one of several closely related clades of the dihydrolipoamide acetyltransferase subunit of the pyruvate dehydrogenase complex Back     alignment and domain information
>PRK11854 aceF dihydrolipoamide acetyltransferase; Validated Back     alignment and domain information
>TIGR01347 sucB 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase; InterPro: IPR006255 These sequences describe the TCA cycle 2-oxoglutarate system E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006256 This group of sequences are a subset of pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase specifically close by both phylogenetic and percent identity (UPGMA) trees Back     alignment and domain information
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase; InterPro: IPR014276 This entry represents the mainly actinobacterial clade of the E2 component of the 2-oxoglutarate dehydrogenase complex involved in the TCA cycle Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>KOG0557 consensus Back     alignment and domain information
>KOG0558 consensus Back     alignment and domain information
>KOG0559 consensus Back     alignment and domain information
>PRK11857 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>pfam00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain) Back     alignment and domain information
>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>PRK13757 chloramphenicol acetyltransferase; Provisional Back     alignment and domain information
>pfam00302 CAT Chloramphenicol acetyltransferase Back     alignment and domain information
>COG4845 Chloramphenicol O-acetyltransferase [Defense mechanisms] Back     alignment and domain information
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase; InterPro: IPR014276 This entry represents the mainly actinobacterial clade of the E2 component of the 2-oxoglutarate dehydrogenase complex involved in the TCA cycle Back     alignment and domain information
>PRK11854 aceF dihydrolipoamide acetyltransferase; Validated Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006256 This group of sequences are a subset of pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase specifically close by both phylogenetic and percent identity (UPGMA) trees Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>pfam00364 Biotin_lipoyl Biotin-requiring enzyme Back     alignment and domain information
>TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006257 This group of sequences represent one of several closely related clades of the dihydrolipoamide acetyltransferase subunit of the pyruvate dehydrogenase complex Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit; InterPro: IPR005776 This family describes the bacterial oxaloacetate decarboxylase alpha subunit and its equivalents in archaea Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase; InterPro: IPR014084 Members of this family are ATP-dependent urea carboxylases, including characterised members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 In the postabsorptive state, blood glucose concentration is kept constant by a combination of glycogenolysis and gluconeogenesis Back     alignment and domain information
>KOG0368 consensus Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>TIGR03077 not_gcvH glycine cleavage protein H homolog, Chlamydial Back     alignment and domain information
>PRK00624 glycine cleavage system protein H; Provisional Back     alignment and domain information
>cd06848 GCS_H Glycine cleavage H-protein Back     alignment and domain information
>COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13380 glycine cleavage system protein H; Provisional Back     alignment and domain information
>PRK01202 glycine cleavage system protein H; Provisional Back     alignment and domain information
>pfam01597 GCV_H Glycine cleavage H-protein Back     alignment and domain information
>TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein; InterPro: IPR001249 The proteins in this family are a component of the acetyl coenzyme A carboxylase complex (6 Back     alignment and domain information
>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional Back     alignment and domain information
>TIGR00527 gcvH glycine cleavage system H protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes Back     alignment and domain information
>pfam05896 NQRA Na(+)-translocating NADH-quinone reductase subunit A (NQRA) Back     alignment and domain information
>TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family Back     alignment and domain information
>PRK12784 hypothetical protein; Provisional Back     alignment and domain information
>PRK06748 hypothetical protein; Validated Back     alignment and domain information
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] Back     alignment and domain information
>KOG3373 consensus Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit; InterPro: IPR010208 The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation Back     alignment and domain information
>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit; InterPro: IPR008703 This family consists of several bacterial Na^+-translocating NADH-quinone reductase subunit A (NQRA) proteins Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>PRK03598 hypothetical protein; Provisional Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Back     alignment and domain information
>pfam00529 HlyD HlyD family secretion protein Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family; InterPro: IPR010129 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit; InterPro: IPR005776 This family describes the bacterial oxaloacetate decarboxylase alpha subunit and its equivalents in archaea Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein; InterPro: IPR005694 emrA and emrB confer resistance to carbonylcyanide m-chlorophenylhydrazone, nalidixic acid, and a number of other toxic compounds Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>pfam00364 Biotin_lipoyl Biotin-requiring enzyme Back     alignment and domain information
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>pfam02817 E3_binding e3 binding domain Back     alignment and domain information
>cd06252 M14_ASTE_ASPA_like_2 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>KOG0238 consensus Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>KOG0559 consensus Back     alignment and domain information
>PRK03598 hypothetical protein; Provisional Back     alignment and domain information
>pfam00529 HlyD HlyD family secretion protein Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family; InterPro: IPR010129 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>pfam07247 AATase Alcohol acetyltransferase Back     alignment and domain information
>TIGR02645 ARCH_P_rylase putative thymidine phosphorylase; InterPro: IPR013466 Proteins in this entry are closely related to characterised examples of thymidine phosphorylase (2 Back     alignment and domain information
>PRK06078 pyrimidine-nucleoside phosphorylase; Reviewed Back     alignment and domain information
>TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase; InterPro: IPR004393 Nicotinate-nucleotide pyrophosphorylase (2 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target436 dihydrolipoamide succinyltransferase [Candidatus Liberi
3duf_I428 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 6e-76
1c4t_A233 Catalytic Domain From Trimeric Dihydrolipoamide Suc 3e-50
1b5s_A242 Dihydrolipoyl Transacetylase (E.C.2.3.1.12) Catalyt 2e-42
3b8k_A239 Structure Of The Truncated Human Dihydrolipoyl Acet 3e-40
1dpc_A243 Crystallographic And Enzymatic Investigations On Th 6e-38
1eaa_A243 Atomic Structure Of The Cubic Core Of The Pyruvate 3e-37
1dpd_A243 Crystallographic And Enzymatic Investigations On Th 2e-36
2ihw_A262 Crystal Structure Of A Cubic Core Of The Dihydrolip 7e-36
1dpb_A243 Crystallographic And Enzymatic Investigations On Th 9e-35
3mae_A256 Crystal Structure Of Probable Dihydrolipamide Acety 1e-34
3l60_A250 Crystal Structure Of Branched-Chain Alpha-Keto Acid 2e-37
1lab_A80 Three-Dimensional Structure Of The Lipoyl Domain Fr 7e-26
1zy8_L229 The Crystal Structure Of Dihydrolipoamide Dehydroge 2e-24
2dnc_A98 Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain 5e-24
1pmr_A80 Lipoyl Domain From The Dihydrolipoyl Succinyltransf 4e-22
1ghj_A79 Solution Structure Of The Lipoyl Domain Of The 2- O 7e-22
1y8n_B128 Crystal Structure Of The Pdk3-L2 Complex Length = 1 4e-19
1k8o_A93 Solution Structure Of The Lipoic Acid-Bearing Domai 5e-19
2dne_A108 Solution Structure Of Rsgi Ruh-058, A Lipoyl Domain 8e-19
1fyc_A106 Inner Lipoyl Domain From Human Pyruvate Dehydrogena 1e-18
1qjo_A80 Innermost Lipoyl Domain Of The Pyruvate Dehydrogena 2e-18
3crk_C87 Crystal Structure Of The Pdhk2-L2 Complex. Length = 1e-16
2k7v_A85 Deletions In A Surface Loop Divert The Folding Of A 2e-16
1iyu_A79 Lipoyl Domain Of Pyruvate Dehydrogenase Complex, Nm 2e-14
1dcz_A77 Biotin Carboxyl Carrier Domain Of Transcarboxylase 1e-09
1o78_A84 Biotin Carboxyl Carrier Domain Of Transcarboxylase 1e-09
2d5d_A74 Structure Of Biotin Carboxyl Carrier Protein (74val 5e-09
1gjx_A81 Solution Structure Of The Lipoyl Domain Of The Chim 6e-09
3hbl_A1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 1e-06
3hb9_A1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 1e-06
3bg5_A1173 Crystal Structure Of Staphylococcus Aureus Pyruvate 1e-06
3ho8_A1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 1e-06
2jku_A94 Crystal Structure Of The N-Terminal Region Of The B 3e-06
1z6h_A72 Solution Structure Of Bacillus Subtilis Blap Biotin 3e-06
2qf7_A1165 Crystal Structure Of A Complete Multifunctional Pyr 1e-05
gi|219689228|pdb|3DUF|I Chain I, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 428 Back     alignment and structure
 Score =  289 bits (739), Expect = 6e-76,   Method: Composition-based stats.
 Identities = 123/428 (28%), Positives = 215/428 (50%), Gaps = 12/428 (2%)

Query: 19  MATKILVPSLGESVNEATVGTWLKEIGESVEIGEILVELETDKVTVEVPSPVSGKLHEMS 78
           MA +  +P +GE ++E  +  W  + G+ V   ++L E++ DK  VE+PSPV GK+ E+ 
Sbjct: 1   MAFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEIL 60

Query: 79  VAKGDTVTYGGFLGYIVEIARDEDES---------IKQNSPNSTANGLPEITDQGFQMPH 129
           V +G   T G  L  +     +              ++ +   +     +          
Sbjct: 61  VPEGTVATVGQTLITLDAPGYENMTFKGQEQEEAKKEEKTETVSKEEKVDAVAPNAPAAE 120

Query: 130 SPSASKLIAESGLSPSDIKGTGKRGQILKSDVMAAISRSESSVDQSTVDSHKKGVFSRII 189
           + +       +  S             L           +  +D       K    +   
Sbjct: 121 AEAGPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAFLAGGAKPAPAAAEE 180

Query: 190 NSASNIFEKSSVSEELSEERVKMSRLRQTVAKRLKDAQNTAAILSTYNEVNMSRIISIRS 249
            +A    + ++   E  E R KMS +R+ +AK +  +++TA  ++  +E +++++++ R 
Sbjct: 181 KAAPAAAKPATTEGEFPETREKMSGIRRAIAKAMVHSKHTAPHVTLMDEADVTKLVAHRK 240

Query: 250 RYKDIFEKKHGIKLGFMGFFTKAASHVLQEIKGVNAEIDGDH--IVYKNYCHIGVAVGTD 307
           ++K I  +K GIKL F+ +  KA    L+E   +N  ID +   I+ K+Y +IG+A  TD
Sbjct: 241 KFKAIAAEK-GIKLTFLPYVVKALVSALREYPVLNTSIDDETEEIIQKHYYNIGIAADTD 299

Query: 308 KGLVVPVIRHADKMNIVEIEREIARLGREARAGHLSMRDLQNGTFTISNGGVYGSLLSSP 367
           +GL+VPVI+HAD+  I  + +EI  L  +AR G L+  +++  + TI+N G  G    +P
Sbjct: 300 RGLLVPVIKHADRKPIFALAQEINELAEKARDGKLTPGEMKGASCTITNIGSAGGQWFTP 359

Query: 368 ILNPPQSGILGMHKIQERPIVEDGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRLKELLE 427
           ++N P+  ILG+ +I E+PIV DG+IV  PM+ L+LS+DHR++DG  A   L  +K LL 
Sbjct: 360 VINHPEVAILGIGRIAEKPIVRDGEIVAAPMLALSLSFDHRMIDGATAQKALNHIKRLLS 419

Query: 428 DPERFILD 435
           DPE  +++
Sbjct: 420 DPELLLME 427


>gi|7245717|pdb|1C4T|A Chain A, Catalytic Domain From Trimeric Dihydrolipoamide Succinyltransferase Length = 233 Back     alignment and structure
>gi|4558102|pdb|1B5S|A Chain A, Dihydrolipoyl Transacetylase (E.C.2.3.1.12) Catalytic Domain (Residues 184-425) From Bacillus Stearothermophilus Length = 242 Back     alignment and structure
>gi|166007311|pdb|3B8K|A Chain A, Structure Of The Truncated Human Dihydrolipoyl Acetyltransferase (E2) Length = 239 Back     alignment and structure
>gi|157830859|pdb|1DPC|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 Back     alignment and structure
>gi|157830909|pdb|1EAA|A Chain A, Atomic Structure Of The Cubic Core Of The Pyruvate Dehydrogenase Multienzyme Complex Length = 243 Back     alignment and structure
>gi|157830860|pdb|1DPD|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 Back     alignment and structure
>gi|122920622|pdb|2IHW|A Chain A, Crystal Structure Of A Cubic Core Of The Dihydrolipoamide Acyltransferase (E2b) Component In The Branched-Chain Alpha-Ketoacid Dehydrogenase Complex (Bckdc), Apo Form Length = 262 Back     alignment and structure
>gi|157830858|pdb|1DPB|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 Back     alignment and structure
>gi|293652058|pdb|3MAE|A Chain A, Crystal Structure Of Probable Dihydrolipamide Acetyltransferase From Listeria Monocytogenes 4b F2365 Length = 256 Back     alignment and structure
>gi|283135430|pdb|3L60|A Chain A, Crystal Structure Of Branched-Chain Alpha-Keto Acid Dehydrogenase Subunit E2 From Mycobacterium Tuberculosis Length = 250 Back     alignment and structure
>gi|157831755|pdb|1LAB|A Chain A, Three-Dimensional Structure Of The Lipoyl Domain From Bacillus Stearothermophilus Pyruvate Dehydrogenase Multienzyme Complex Length = 80 Back     alignment and structure
>gi|159164247|pdb|2DNC|A Chain A, Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain From Human 2-Oxoacid Dehydrogenase Length = 98 Back     alignment and structure
>gi|157833530|pdb|1PMR|A Chain A, Lipoyl Domain From The Dihydrolipoyl Succinyltransferase Component Of The 2-Oxoglutarate Dehydrogenase Multienzyme Complex Of Escherichia Coli, Nmr, 25 Structures Length = 80 Back     alignment and structure
>gi|159162352|pdb|1GHJ|A Chain A, Solution Structure Of The Lipoyl Domain Of The 2- Oxoglutarate Dehydrogenase Complex From Azotobacter Vineland Ii, Nmr, Minimized Average Structure Length = 79 Back     alignment and structure
>gi|67463894|pdb|1Y8N|B Chain B, Crystal Structure Of The Pdk3-L2 Complex Length = 128 Back     alignment and structure
>gi|17942550|pdb|1K8O|A Chain A, Solution Structure Of The Lipoic Acid-Bearing Domain Of The E2 Component Of Human, Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 93 Back     alignment and structure
>gi|159164248|pdb|2DNE|A Chain A, Solution Structure Of Rsgi Ruh-058, A Lipoyl Domain Of Human 2-Oxoacid Dehydrogenase Length = 108 Back     alignment and structure
>gi|159162337|pdb|1FYC|A Chain A, Inner Lipoyl Domain From Human Pyruvate Dehydrogenase (Pdh) Complex, Nmr, 1 Structure Length = 106 Back     alignment and structure
>gi|157879777|pdb|1QJO|A Chain A, Innermost Lipoyl Domain Of The Pyruvate Dehydrogenase From Escherichia Coli Length = 80 Back     alignment and structure
>gi|186973095|pdb|3CRK|C Chain C, Crystal Structure Of The Pdhk2-L2 Complex. Length = 87 Back     alignment and structure
>gi|258588181|pdb|2K7V|A Chain A, Deletions In A Surface Loop Divert The Folding Of A Protein Domain Into A Metastable Dimeric Form Length = 85 Back     alignment and structure
>gi|253722911|pdb|1IYU|A Chain A, Lipoyl Domain Of Pyruvate Dehydrogenase Complex, Nmr, Minimized Average Structure Length = 79 Back     alignment and structure
>gi|159162200|pdb|1DCZ|A Chain A, Biotin Carboxyl Carrier Domain Of Transcarboxylase (Tc 1.3s) Length = 77 Back     alignment and structure
>gi|159162771|pdb|1O78|A Chain A, Biotin Carboxyl Carrier Domain Of Transcarboxylase (1.3s) [10-48] Deletion Mutant Length = 84 Back     alignment and structure
>gi|99032022|pdb|2D5D|A Chain A, Structure Of Biotin Carboxyl Carrier Protein (74val Start) From Pyrococcus Horikoshi Ot3 Ligand Free Form Ii Length = 74 Back     alignment and structure
>gi|157877760|pdb|1GJX|A Chain A, Solution Structure Of The Lipoyl Domain Of The Chimeric Dihydrolipoyl Dehydrogenase P64k From Neisseria Meningitidis Length = 81 Back     alignment and structure
>gi|242556622|pdb|3HBL|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase T908a Mutant Length = 1150 Back     alignment and structure
>gi|242556615|pdb|3HB9|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase A610t Mutant Length = 1150 Back     alignment and structure
>gi|168988872|pdb|3BG5|A Chain A, Crystal Structure Of Staphylococcus Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
gi|242556707|pdb|3HO8|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase In Complex With Coenzyme A Length = 1150 Back     alignment and structure
>gi|198443038|pdb|2JKU|A Chain A, Crystal Structure Of The N-Terminal Region Of The Biotin Acceptor Domain Of Human Propionyl-Coa Carboxylase Length = 94 Back     alignment and structure
>gi|93278527|pdb|1Z6H|A Chain A, Solution Structure Of Bacillus Subtilis Blap Biotinylated- Form Length = 72 Back     alignment and structure
>gi|158430175|pdb|2QF7|A Chain A, Crystal Structure Of A Complete Multifunctional Pyruvate Carboxylase From Rhizobium Etli Length = 1165 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target436 dihydrolipoamide succinyltransferase [Candidatus Liberi
3dva_I428 Dihydrolipoyllysine-residue acetyltransferase component 1e-109
1scz_A233 E2, dihydrolipoamide succinyltransferase; COA-dependent 9e-72
3mae_A256 2-oxoisovalerate dehydrogenase E2 component, dihydrolip 6e-68
3l60_A250 Branched-chain alpha-keto acid dehydrogenase; structura 7e-63
1q23_A219 Chloramphenicol acetyltransferase; CAT I, trimer, fusid 2e-49
3b8k_A239 PDCE2;, dihydrolipoyllysine-residue acetyltransferase; 2e-48
1dpb_A243 Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltr 1e-46
2ii3_A262 Lipoamide acyltransferase component of branched- chain 6e-46
3cla_A213 Type III chloramphenicol acetyltransferase; transferase 1e-48
2i9d_A217 Chloramphenicol acetyltransferase; structural genomics, 2e-41
1zy8_K229 Pyruvate dehydrogenase protein X component, mitochondri 2e-24
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase component 4e-17
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehyd 7e-17
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehydroge 5e-16
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase component 1e-15
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic acid 3e-15
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase component 9e-15
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase compon 9e-15
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, pyru 2e-13
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, 2e-12
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, 2e-11
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component of py 3e-11
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase component 3e-08
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, trans 5e-08
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta sheet, 9e-08
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; biotin, do 3e-07
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondrial; l 5e-06
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2e-04
1bal_A51 Dihydrolipoamide succinyltransferase; glycolysis; NMR { 3e-07
1w4i_A62 Pyruvate dehydrogenase E2; transferase, peripheral-subu 7e-07
2coo_A70 Lipoamide acyltransferase component of branched- chain 7e-07
2eq8_C40 Pyruvate dehydrogenase complex, dihydrolipoamide acetyl 7e-07
1zwv_A58 Lipoamide acyltransferase component of branched- chain 8e-07
1w85_I49 Dihydrolipoyllysine-residue acetyltransferase component 1e-06
2eq9_C41 Pyruvate dehydrogenase complex, dihydrolipoamide acetyl 3e-06
2eq7_C40 2-oxoglutarate dehydrogenase E2 component; protein-prot 4e-06
2f60_K64 Pyruvate dehydrogenase protein X component; protein-bin 1e-05
2qf7_A1165 Pyruvate carboxylase protein; multi-domain, multi-funct 3e-04
3bg3_A718 Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-bi 0.003
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, f 0.004
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 Back     alignment and structure
 Score =  391 bits (1006), Expect = e-109
 Identities = 133/439 (30%), Positives = 224/439 (51%), Gaps = 34/439 (7%)

Query: 19  MATKILVPSLGESVNEATVGTWLKEIGESVEIGEILVELETDKVTVEVPSPVSGKLHEMS 78
           MA +  +P +GE ++E  +  W  + G+ V   ++L E++ DK  VE+PSPV GK+ E+ 
Sbjct: 1   MAFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEIL 60

Query: 79  VAKGDTVTYGGFLGYIVEIARDEDESIKQNSPNSTANGLPEITDQGFQMPH--------- 129
           V +G   T G  L  +     +      Q    +      E   +  ++           
Sbjct: 61  VPEGTVATVGQTLITLDAPGYENMTFKGQEQEEAKKEEKTETVSKEEKVDAVAPNAPAAE 120

Query: 130 -----------SPSASKLIAESGLSPSDIKGTGKRGQILKSDVMAAISRSESSVDQSTVD 178
                       PS  K   E G+    ++GTGK G++LK D+ A ++        +  +
Sbjct: 121 AEAGPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAFLAGGAKPAPAAAEE 180

Query: 179 SHKKGVFSRIINSASNIFEKSSVSEELSEERVKMSRLRQTVAKRLKDAQNTAAILSTYNE 238
                                    E  E R KMS +R+ +AK +  +++TA  ++  +E
Sbjct: 181 KAAPAAAKPATTEG-----------EFPETREKMSGIRRAIAKAMVHSKHTAPHVTLMDE 229

Query: 239 VNMSRIISIRSRYKDIFEKKHGIKLGFMGFFTKAASHVLQEIKGVNAEID--GDHIVYKN 296
            +++++++ R ++K I  +K  IKL F+ +  KA    L+E   +N  ID   + I+ K+
Sbjct: 230 ADVTKLVAHRKKFKAIAAEKG-IKLTFLPYVVKALVSALREYPVLNTSIDDETEEIIQKH 288

Query: 297 YCHIGVAVGTDKGLVVPVIRHADKMNIVEIEREIARLGREARAGHLSMRDLQNGTFTISN 356
           Y +IG+A  TD+GL+VPVI+HAD+  I  + +EI  L  +AR G L+  +++  + TI+N
Sbjct: 289 YYNIGIAADTDRGLLVPVIKHADRKPIFALAQEINELAEKARDGKLTPGEMKGASCTITN 348

Query: 357 GGVYGSLLSSPILNPPQSGILGMHKIQERPIVEDGQIVIRPMMYLALSYDHRIVDGKEAV 416
            G  G    +P++N P+  ILG+ +I E+PIV DG+IV  PM+ L+LS+DHR++DG  A 
Sbjct: 349 IGSAGGQWFTPVINHPEVAILGIGRIAEKPIVRDGEIVAAPMLALSLSFDHRMIDGATAQ 408

Query: 417 TFLVRLKELLEDPERFILD 435
             L  +K LL DPE  +++
Sbjct: 409 KALNHIKRLLSDPELLLME 427


>1scz_A E2, dihydrolipoamide succinyltransferase; COA-dependent acyltransferase, CAT-like, alpha and beta (2 layers); 2.20A {Escherichia coli K12} SCOP: c.43.1.1 PDB: 1e2o_A 1c4t_A Length = 233 Back     alignment and structure
>3mae_A 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase; 2-oxoacid dehydrogenases acyltransferase; 2.50A {Listeria monocytogenes} Length = 256 Back     alignment and structure
>3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} Length = 250 Back     alignment and structure
>1q23_A Chloramphenicol acetyltransferase; CAT I, trimer, fusidic acid; HET: FUA; 2.18A {Escherichia coli} SCOP: c.43.1.1 PDB: 1noc_B 1pd5_A* Length = 219 Back     alignment and structure
>3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} Length = 239 Back     alignment and structure
>1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A Length = 243 Back     alignment and structure
>2ii3_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* Length = 262 Back     alignment and structure
>3cla_A Type III chloramphenicol acetyltransferase; transferase (acyltransferase); HET: CLM; 1.75A {Escherichia coli} SCOP: c.43.1.1 PDB: 1cla_A* 2cla_A 4cla_A* 1cia_A 1qca_A* Length = 213 Back     alignment and structure
>2i9d_A Chloramphenicol acetyltransferase; structural genomics, PSI- 2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} Length = 217 Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: LPA ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Length = 128 Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Length = 93 Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; pyruvate dehydrogenase kinase isozyme 2, glucose metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Length = 87 Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Length = 79 Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Length = 81 Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Length = 79 Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Length = 85 Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Length = 77 Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, domain, BCCP, X-RAY diffraction, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii OT3} PDB: 2ejf_C* 2ejg_C* 2evb_A Length = 74 Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, polymorphism, disease mutation, nucleotide-binding; HET: PG4; 1.5A {Homo sapiens} Length = 94 Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 3hb9_A* Length = 1150 Back     alignment and structure
>1bal_A Dihydrolipoamide succinyltransferase; glycolysis; NMR {Escherichia coli} SCOP: a.9.1.1 PDB: 1bbl_A 1w4h_A 2wav_A 2btg_A 2bth_A 2cyu_A Length = 51 Back     alignment and structure
>1w4i_A Pyruvate dehydrogenase E2; transferase, peripheral-subunit binding domain, ultrafast folding, homologues,; NMR {Pyrobaculum aerophilum} PDB: 1w4j_A 1w4k_A Length = 62 Back     alignment and structure
>2coo_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; E3_binding domain; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2eq8_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 1.94A {Thermus thermophilus HB8} Length = 40 Back     alignment and structure
>1zwv_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; subunit binding domain; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>1w85_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: a.9.1.1 PDB: 1w88_I* 1w4g_A 1w4e_A 1w4f_A 2pdd_A 2pde_A 1ebd_C* Length = 49 Back     alignment and structure
>2eq9_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltranferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 2.09A {Thermus thermophilus HB8} Length = 41 Back     alignment and structure
>2eq7_C 2-oxoglutarate dehydrogenase E2 component; protein-protein complex, oxidoreductase, structural genomics, NPPSFA; HET: FAD NAD; 1.80A {Thermus thermophilus HB8} Length = 40 Back     alignment and structure
>2f60_K Pyruvate dehydrogenase protein X component; protein-binding protein, E3BD, protein binding; 1.55A {Homo sapiens} PDB: 2f5z_K Length = 64 Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA SAP; 2.00A {Rhizobium etli cfn 42} Length = 1165 Back     alignment and structure
>3bg3_A Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-binding, biotin, disease mutation, gluconeogenesis, ligase, lipid synthesis, manganese; HET: KCX BTI; 2.80A {Homo sapiens} PDB: 3bg9_A Length = 718 Back     alignment and structure
>1bdo_A Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, fatty acid biosynthesis, hammerhead structure, selenomethionine, ligase; HET: BTN; 1.80A {Escherichia coli} SCOP: b.84.1.1 PDB: 2bdo_A* 1a6x_A 3bdo_A Length = 80 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target436 dihydrolipoamide succinyltransferase [Candidatus Liberi
3dva_I428 Dihydrolipoyllysine-residue acetyltransferase component 100.0
1scz_A233 E2, dihydrolipoamide succinyltransferase; COA-dependent 100.0
1dpb_A243 Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltr 100.0
3mae_A256 2-oxoisovalerate dehydrogenase E2 component, dihydrolip 100.0
2ii3_A262 Lipoamide acyltransferase component of branched- chain 100.0
3b8k_A239 PDCE2;, dihydrolipoyllysine-residue acetyltransferase; 100.0
3l60_A250 Branched-chain alpha-keto acid dehydrogenase; structura 100.0
3cla_A213 Type III chloramphenicol acetyltransferase; transferase 100.0
1q23_A219 Chloramphenicol acetyltransferase; CAT I, trimer, fusid 100.0
2i9d_A217 Chloramphenicol acetyltransferase; structural genomics, 100.0
1zy8_K229 Pyruvate dehydrogenase protein X component, mitochondri 100.0
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase component 99.93
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase component 99.92
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase component 99.9
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic acid 99.89
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase compon 99.87
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehydroge 99.85
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehyd 99.84
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, pyru 99.8
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, 99.77
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component of py 99.72
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase component 99.66
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; biotin-r 99.62
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, trans 99.56
1z6h_A72 Biotin/lipoyl attachment protein; solution structure, b 99.53
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; biotin, do 99.52
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, 99.47
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta sheet, 99.45
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondrial; l 99.4
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, f 99.13
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 98.2
1hpc_A131 H protein of the glycine cleavage system; transit pepti 97.43
1onl_A128 Glycine cleavage system H protein; hybrid barrel-sandwi 97.41
1zko_A136 Glycine cleavage system H protein; TM0212, structural g 97.36
3mxu_A143 Glycine cleavage system H protein; seattle structural g 97.36
3hgb_A155 Glycine cleavage system H protein; ssgcid, niaid, decod 97.34
3klr_A125 Glycine cleavage system H protein; antiparallel beta sh 97.33
3a7l_A128 H-protein, glycine cleavage system H protein; lipoic ac 97.31
3h9i_A407 Cation efflux system protein CUSB; three-helix bundle, 97.07
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein compl 99.18
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 99.15
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi-funct 99.03
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehydroge 96.51
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta sheet, 95.68
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component of py 95.55
2f1m_A277 Acriflavine resistance protein A; helical hairpin, lipo 95.18
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, 95.17
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; biotin-r 95.08