254781053

254781053

dihydrolipoamide dehydrogenase

GeneID in NCBI database:8210076Locus tag:CLIBASIA_04775
Protein GI in NCBI database:254781053Protein Accession:YP_003065466.1
Gene range:+(1057278, 1058678)Protein Length:466aa
Gene description:dihydrolipoamide dehydrogenase
COG prediction:[C] Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes
KEGG prediction:lpdA; dihydrolipoamide dehydrogenase (EC:1.8.1.4); K00382 dihydrolipoamide dehydrogenase [EC:1.8.1.4]
SEED prediction:Dihydrolipoamide dehydrogenase of 2-oxoglutarate dehydrogenase (EC 1.8.1.4)
Pathway involved in KEGG:Glycolysis / Gluconeogenesis [PATH:las00010]
Citrate cycle (TCA cycle) [PATH:las00020]
Pyruvate metabolism [PATH:las00620]
Glycine, serine and threonine metabolism [PATH:las00260]
Valine, leucine and isoleucine degradation [PATH:las00280]
Subsystem involved in SEED:TCA Cycle
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460------
MVYDVAVVGGGPAGYACAIKAAQLKNKVAIIEKEKTYGGTCLNIGCIPSKALLHASEMYSHIAKEAGDLGINIASCHLDLKKMMSYKKSIVESNTQGINFLLKKNKIITYHGSARIVSNNKILVKGSSSEETIEAKNIVIATGSEASGLPGMSIDFDEQVIVSSTGALSFSSVPKNLLVIGAGVIGLELGSVWTRLGSCVKIIEHSGTILNGMDKEIAAHCLKIMSKQGMNFQLNSKVSSVKKVKGKAQVVYRSTDDEPINIEADAVLVAAGRRPYTKGLGLEEIGINIDHRGCIEIGGQFQTSISTIYAIGDVVRGPMLAHKAEDEGIAVAEIISGQKGHVNYGIIPSVVYTHPEVASIGKTEEQLKCEKKSYKVGKFPFSANGRARSMNSIDGFVKILANEKSDRVEGVHIIGGSAGEMIHEAAVLMEFGGSSEDLARICHAHPTMSEAVREAALSCFDQPIHM
ccccEEEEcccHHHHHHHHHHHHccccEEEEEccccccEEEEccccccccccccHHHHHHHHHHHccccEEEccccEEEHHHHHHHHHHHHHHHHccEEEEcccccEEEEcccEEEEEccEEEEEEcccccccccccEEEEcccccccccccccccccEEEEEEHHHHcccccccEEEEEcccHHHHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHHHHHHHcccEEEEccEEEEEEEcccEEEEEEEEccccEEEEEccEEEEEcccccccccccHHHcccEEcccccEEEccccccccccEEEccccccccccHHHHHHHHHHHHHHHcccccccccccEEEEEEEcccccEEEccHHHHHHccccEEEEEEEEccccccccccccccEEEEEEEccccEEEEEEEEcccHHHHHHHHHHHHHccccHHHHHccccccccHHHHHHHHHHHHHcccccc
ccEEEEEEcccccHHHHHHHHHHccccEEEEcccccccHHHHHccHHHHHHHHHHHHHHHHHHcccccccEEEcccEEcHHHHHHHHHHHHHHHccHHHHHHHcccEEEEEEEEEEEcccEEEEEcccccEEEEEEEEEEEcccccccccccccccccccEEcHHHHccccccccEEEEEcccHHHHHHHHHHHHHccEEEEEcccccccccccHHHHHHHHHHHHHHccEEEcccEEEEEEEccccEEEEEEcccccEEEEEEcEEEEcccEEEccccccHHHHcccEcccccEccccccEcccccEEEccccccccccHHHHHHHHHHHHHHHHcccccccHHHccEEEccccEEEEEEccHHHHHHHcccEEEEEEEccccHHHHHccccccEEEEEEEccccEEEEEEEEEccHHHHHHHHHHHHHcccEHHHHHccccccccccHHHHHHHHHHHcccccc
MVYDVAVVGGGPAGYACAIKAAQLKNKVAIIEKEktyggtclnigcipskaLLHASEMYSHIAKEAGDLGINIASCHLDLKKMMSYKKSIVESNTQGINFLLKKNKiityhgsarivsnnkilvkgssseetIEAKNIVIAtgseasglpgmsidfdeQVIVSStgalsfssvpkNLLVIGAGVIGLELGSVWTRLGSCVKIIEHSGTILNGMDKEIAAHCLKIMSKqgmnfqlnSKVSSVKKVKGKAQVVYrstddepiniEADAVLVAagrrpytkglgleeiginidhrgcieiggqfqtsiSTIYAigdvvrgpmlahkaedEGIAVAEIISgqkghvnygiipsvvythpevasigkteEQLKCEKksykvgkfpfsangrarsmnSIDGFVKILANeksdrvegvhiiggsaGEMIHEAAVLMefggssedlARICHAHPTMSEAVREAALscfdqpihm
MVYDVAVVGGGPAGYACAIKAAQLKNKVAIIEKEKTYGGTCLNIGCIPSKALLHASEMYSHIAKEAGDLGINIASCHLDLKKMMSYKKSIVESNTQGINFLLKKNKIITyhgsarivsnnkilvkgssseetIEAKNIVIATGSEASGLPGMSIDFDEQVIVSSTGALSFSSVPKNLLVIGAGVIGLELGSVWTRLGSCVKIIEHSGTILNGMDKEIAAHCLKIMSKQGMNFQLNSkvssvkkvkgKAQVvyrstddepiniEADAVLVAAGRRPYTKGLGLEEIGINIDHRGCIEIGGQFQTSISTIYAIGDVVRGPMLAHKAEDEGIAVAEIISGQKGHVNYGIIPSVVYTHPEVASIGKteeqlkcekksykvgkfpfsangrarsmnSIDGFVKILANEKSDRVEGVHIIGGSAGEMIHEAAVLMEFGGSSEDLARICHAHPTMSEAVREAALScfdqpihm
MvydvavvgggpagyacaIKAAQLKNKVAIIEKEKTYGGTCLNIGCIPSKALLHASEMYSHIAKEAGDLGINIASCHLDLKKMMSYKKSIVESNTQGINFLLKKNKIITYHGSARIVSNNKILVKGSSSEETIEAKNIVIATGSEASGLPGMSIDFDEQVIVSSTGALSFSSVPKNLLVIGAGVIGLELGSVWTRLGSCVKIIEHSGTILNGMDKEIAAHCLKIMSKQGMNFQLNskvssvkkvkgkaqvvYRSTDDEPINIEADAVLVAAGRRPYTKGLGLEEIGINIDHRGCIEIGGQFQTSISTIYAIGDVVRGPMLAHKAEDEGIAVAEIISGQKGHVNYGIIPSVVYTHPEVASIGKTEEQLKCEKKSYKVGKFPFSANGRARSMNSIDGFVKILANEKSDRVEGVHIIGGSAGEMIHEAAVLMEFGGSSEDLARICHAHPTMSEAVREAALSCFDQPIHM
MVYDVAVVGGGPAGYACAIKAAQLKNKVAIIEKEKTYGGTCLNIGCIPSKALLHASEMYSHIAKEAGDLGINIASCHLDLKKMMSYKKSIVESNTQGINFLLKKNKIITYHGSARIVSNNKILVKGSSSEETIEAKNIVIATGSEASGLPGMSIDFDEQVIVSSTGALSFSSVPKNLLVIGAGVIGLELGSVWTRLGSCVKIIEHSGTILNGMDKEIAAHCLKIMSKQGMNFQLNSKVSSVKKVKGKAQVVYRSTDDEPINIEADAVLVAAGRRPYTKGLGLEEIGINIDHRGCIEIGGQFQTSISTIYAIGDVVRGPMLAHKAEDEGIAVAEIISGQKGHVNYGIIPSVVYTHPEVASIGKTEEQLKCEKKSYKVGKFPFSANGRARSMNSIDGFVKILANEKSDRVEGVHIIGGSAGEMIHEAAVLMEFGGSSEDLARICHAHPTMSEAVREAALSCFDQPIHM
MVYDVAVVGGGPAGYACAIKAAQLKNKVAIIEKEKTYGGTCLNIGCIPSKALLHASEMYSHIAKEAGDLGINIASCHLDLKKMMSYKKSIVESNTQGINFLLKKNKIITYHGSARIVSNNKILVKGSSSEETIEAKNIVIATGSEASGLPGMSIDFDEQVIVSSTGALSFSSVPKNLLVIGAGVIGLELGSVWTRLGSCVKIIEHSGTILNGMDKEIAAHCLKIMSKQGMNFQLNSK**********AQVVYRSTDDEPINIEADAVLVAAGRRPYTKGLGLEEIGINIDHRGCIEIGGQFQTSISTIYAIGDVVRGPMLAHKAEDEGIAVAEIISGQKGHVNYGIIPSVVYTHPEVASIGKTEEQLKCEKKSYKVGKFPFSANGRARSMNSIDGFVKILANEKSDRVEGVHIIGGSAGEMIHEAAVLMEFGGSSEDLARICHAHPTMSEAVREAALSCFDQPIHM
MVYDVAVVGGGPAGYACAIKAAQLKNKVAIIEKEKTYGGTCLNIGCIPSKALLHASEMYSHIAKEAGDLGINIASCHLDLKKMMSYKKSIVESNTQGINFLLKKNKIITYHGSARIVSNNKILVKGSSSEETIEAKNIVIATGSEASGLPGMSIDFDEQVIVSSTGALSFSSVPKNLLVIGAGVIGLELGSVWTRLGSCVKIIEHSGTILNGMDKEIAAHCLKIMSKQGMNFQLNSKVSSVKKVKGKAQVVYRSTDDEPINIEADAVLVAAGRRPYTKGLGLEEIGINIDHRGCIEIGGQFQTSISTIYAIGDVVRGPMLAHKAEDEGIAVAEIISGQKGHVNYGIIPSVVYTHPEVASIGKTEEQLKCEKKSYKVGKFPFSANGRARSMNSIDGFVKILANEKSDRVEGVHIIGGSAGEMIHEAAVLMEFGGSSEDLARICHAHPTMSEAVREAALSCFDQ****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVYDVAVVGGGPAGYACAIKAAQLKNKVAIIEKEKTYGGTCLNIGCIPSKALLHASEMYSHIAKEAGDLGINIASCHLDLKKMMSYKKSIVESNTQGINFLLKKNKIITYHGSARIVSNNKILVKGSSSEETIEAKNIVIATGSEASGLPGMSIDFDEQVIVSSTGALSFSSVPKNLLVIGAGVIGLELGSVWTRLGSCVKIIEHSGTILNGMDKEIAAHCLKIMSKQGMNFQLNSKVSSVKKVKGKAQVVYRSTDDEPINIEADAVLVAAGRRPYTKGLGLEEIGINIDHRGCIEIGGQFQTSISTIYAIGDVVRGPMLAHKAEDEGIAVAEIISGQKGHVNYGIIPSVVYTHPEVASIGKTEEQLKCEKKSYKVGKFPFSANGRARSMNSIDGFVKILANEKSDRVEGVHIIGGSAGEMIHEAAVLMEFGGSSEDLARICHAHPTMSEAVREAALSCFDQPIHM
MVYDVAVVGGGPAGYACAIKAAQLKNKVAIIEKEKTYGGTCLNIGCIPSKALLHASEMYSHIAKEAGDLGINIASCHLDLKKMMSYKKSIVESNTQGINFLLKKNKIITYHGSARIVSNNKILVKGSSSEETIEAKNIVIATGSEASGLPGMSIDFDEQVIVSSTGALSFSSVPKNLLVIGAGVIGLELGSVWTRLGSCVKIIEHSGTILNGMDKEIAAHCLKIMSKQGMNFQLNSKVSSVKKVKGKAQVVYRSTDDEPINIEADAVLVAAGRRPYTKGLGLEEIGINIDHRGCIEIGGQFQTSISTIYAIGDVVRGPMLAHKAEDEGIAVAEIISGQKGHVNYGIIPSVVYTHPEVASIGKTEEQLKCEKKSYKVGKFPFSANGRARSMNSIDGFVKILANEKSDRVEGVHIIGGSAGEMIHEAAVLMEFGGSSEDLARICHAHPTMSEAVREAALSCFDQPIHM
MVYDVAVVGGGPAGYACAIKAAQLKNKVAIIEKEKTYGGTCLNIGCIPSKALLHASEMYSHIAKEAGDLGINIASCHLDLKKMMSYKKSIVESNTQGINFLLKKNKIITYHGSARIVSNNKILVKGSSSEETIEAKNIVIATGSEASGLPGMSIDFDEQVIVSSTGALSFSSVPKNLLVIGAGVIGLELGSVWTRLGSCVKIIEHSGTILNGMDKEIAAHCLKIMSKQGMNFQLNSKVSSVKKVKGKAQVVYRSTDDEPINIEADAVLVAAGRRPYTKGLGLEEIGINIDHRGCIEIGGQFQTSISTIYAIGDVVRGPMLAHKAEDEGIAVAEIISGQKGHVNYGIIPSVVYTHPEVASIGKTEEQLKCEKKSYKVGKFPFSANGRARSMNSIDGFVKILANEKSDRVEGVHIIGGSAGEMIHEAAVLMEFGGSSEDLARICHAHPTMSEAVREAALSCFDQPIHM

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target466 dihydrolipoamide dehydrogenase [Candidatus Liberibacter
254780675481 dihydrolipoamide dehydrogenase [Candidatus Liberib 6e-77
254781055461 glutathione reductase [Candidatus Liberibacter asi 5e-48
>gi|254780675|ref|YP_003065088.1| dihydrolipoamide dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 481 Back     alignment
 Score =  279 bits (714), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 174/482 (36%), Positives = 270/482 (56%), Gaps = 23/482 (4%)

Query: 2   VYDVAVVGGGPAGYACAIKAAQLKNKVAIIEKEKTYGGTCLNIGCIPSKALLHASEMYSH 61
           +YD+ ++G GPAGY  AI+AAQL  KVAI+E     GG CLN GCIP+K+LL ++E+  H
Sbjct: 4   LYDIILIGSGPAGYVAAIRAAQLGFKVAIVEY-AGLGGICLNWGCIPTKSLLRSAEILDH 62

Query: 62  IAKEAGDLGINIA-SCHLDLKKMMSYKKSIVESNTQGINFLLKKNKIITYHGSARIVSNN 120
           I + A   G+N+A     +++ ++   + I     +G+ FL+ KNK+    G A + + +
Sbjct: 63  I-QNAQHYGLNVAGKVEFNIEDIVKRSRDISHRLNRGVEFLMHKNKVDIIWGKATLKNPS 121

Query: 121 KILVKGSSS---------------EETIEAKNIVIATGSEASGLPGMSIDFDEQVIVSST 165
           +I V   S                E T +AK+I+IATG+    + G  I+ D  +I +  
Sbjct: 122 EITVSKPSQPAVQPQHPIPKKVLGEGTYKAKHIIIATGARPRHIEG--IEPDSHLIWTYF 179

Query: 166 GALSFSSVPKNLLVIGAGVIGLELGSVWTRLGSCVKIIEHSGTILNGMDKEIAAHCLKIM 225
            AL  S  PK+L+V+G+G IG+E  S +  L   V +IE    IL   D EI+    + +
Sbjct: 180 DALKPSKTPKSLIVMGSGAIGVEFSSFYKSLDVDVSLIEVKDRILPVEDSEISQFVQRSL 239

Query: 226 SKQGMNFQLNSKVSSVKKVKGKAQVVYRSTDDEPINIEADAVLVAAGRRPYTKGLGLEEI 285
            K+G+     SK+SSVK+      V     D    +++A+ +L++AG +   + +GLE+I
Sbjct: 240 QKRGIKILTESKISSVKQKGDMVSVQVERKDGSVSSMQAEKLLLSAGVQGNIENIGLEKI 299

Query: 286 GINIDHRGCIEIGGQFQTSISTIYAIGDVVRGPMLAHKAEDEGIAVAEIISGQKG--HVN 343
           G+   + GCI + G  +T++  IYAIGDV   PMLAHKAE EGI   E I+G+     ++
Sbjct: 300 GVKTSN-GCIIVDGYGRTNVPGIYAIGDVAGAPMLAHKAEHEGIICIEKIAGKSKVYPLD 358

Query: 344 YGIIPSVVYTHPEVASIGKTEEQLKCEKKSYKVGKFPFSANGRARSMNSIDGFVKILANE 403
              IP   Y +P+VASIG TEE+ + +    +VGK  FSANG+A ++    G +K + N 
Sbjct: 359 KSKIPGCTYCNPQVASIGLTEEKARSQGLDIRVGKHSFSANGKAITLGEDSGMIKTIFNN 418

Query: 404 KSDRVEGVHIIGGSAGEMIHEAAVLMEFGGSSEDLARICHAHPTMSEAVREAALSCFDQP 463
           K+  V GVH++G    E+I   ++ M    + E+L      HPT+SE ++E+ L  + + 
Sbjct: 419 KTGEVLGVHMVGPEVTELIQGFSIAMSLETTEEELMHTVFPHPTISETMKESILDAYGRA 478

Query: 464 IH 465
           IH
Sbjct: 479 IH 480

>gi|254781055|ref|YP_003065468.1| glutathione reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 461 Back     alignment
 Score =  183 bits (465), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 137/467 (29%), Positives = 230/467 (49%), Gaps = 45/467 (9%)

Query: 3   YDVAVVGGGPAGYACAIKAAQLKNKVAIIEKEKTYGGTCLNIGCIPSKALLHASEMYSHI 62
           YD+ V+G G +G   A  AAQL  KVAI E+ +  GGTC+  GCIP K + +AS+ YS  
Sbjct: 5   YDLVVIGAGSSGVRSARLAAQLGKKVAICEEYRV-GGTCVIRGCIPKKLMFYASQ-YSEY 62

Query: 63  AKEAGDLGINIASCHLDLKKMMSYKK---SIVES------NTQGINFLLKKNKIITYHGS 113
            +++   G ++     D + +++ +    S +ES       + G+     K  + + H S
Sbjct: 63  FEDSQGFGWSVDHKSFDWQSLITAQNKELSRLESFYHNRLESAGVEIFASKGILSSPH-S 121

Query: 114 ARIVSNNKILVKGSSSEETIEAKNIVIATGSEASGLPGMSIDFD-EQVIVSSTGALSFSS 172
             I + N+          TI ++ IV++TG    G P   +DF    + ++S    S  S
Sbjct: 122 VYIANLNR----------TITSRYIVVSTG----GSPN-RMDFKGSDLCITSDEIFSLKS 166

Query: 173 VPKNLLVIGAGVIGLELGSVWTRLGSCVKIIEHSGTILNGMDKEIAAHCLKIMSKQGMNF 232
           +P++ L+IG G I +E   +   LGS   ++    +IL+  D +I      +M  +GM  
Sbjct: 167 LPQSTLIIGGGYIAVEFAGILNSLGSKTTLVTRGNSILSKFDSDIRQGLTDVMISRGMQV 226

Query: 233 QLNSKVSSVKKVKGKAQVVYRSTDDEPINIEADAVLVAAGRRPYTKGLGLEEIGINIDHR 292
             N  + SV    G+ + + +S       ++ D V++A GR P T G+GLE++G+ +D  
Sbjct: 227 FHNDTIESVVSESGQLKSILKSGK----IVKTDQVILAVGRTPRTTGIGLEKVGVKMDEN 282

Query: 293 GCIEIGGQFQTSISTIYAIGDVV----RGPMLAHKAEDEGIAVAEIISGQKGHVNYGIIP 348
           G I      +T++ +I+++GD+       P+  H A      V  +        +Y ++P
Sbjct: 283 GFIITDCYSRTNVQSIFSLGDISGHIQLTPVAIHAA---ACFVETVFKDNPTIPDYDLVP 339

Query: 349 SVVYTHPEVASIGKTEE---QLKCEKKSYKVGKFPFSANGRARSMNSIDGFVKILANEKS 405
           + V++ PE+AS+G TEE   Q  C  + YK   FP       R  ++I   +KI+ +  +
Sbjct: 340 TAVFSKPEIASVGLTEEEAVQKFCRLEIYKTKFFPMKCFLSKRFEHTI---MKIIVHADN 396

Query: 406 DRVEGVHIIGGSAGEMIHEAAVLMEFGGSSEDLARICHAHPTMSEAV 452
            +V GVHI+G  A E+I    V ++ G   +D  R    HPT SE +
Sbjct: 397 HKVLGVHILGHEASEIIQVLGVCLKAGCVKKDFDRCMAVHPTSSEEL 443

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target466 dihydrolipoamide dehydrogenase [Candidatus Liberibacter
315122391467 dihydrolipoamide dehydrogenase [Candidatus Liberibacter 1 0.0
325294001468 dihydrolipoamide dehydrogenase [Agrobacterium sp. H13-3 1 1e-169
222150034468 dihydrolipoamide dehydrogenase [Agrobacterium vitis S4] 1 1e-168
15889887468 dihydrolipoamide dehydrogenase [Agrobacterium tumefacie 1 1e-167
163761402468 dihydrolipoamide dehydrogenase [Hoeflea phototrophica D 1 1e-165
150398133468 dihydrolipoamide dehydrogenase [Sinorhizobium medicae W 1 1e-165
307301629468 dihydrolipoamide dehydrogenase [Sinorhizobium meliloti 1 1e-163
86359463468 dihydrolipoamide dehydrogenase [Rhizobium etli CFN 42] 1 1e-163
15966801468 dihydrolipoamide dehydrogenase [Sinorhizobium meliloti 1 1e-163
239833046467 dihydrolipoamide dehydrogenase [Ochrobactrum intermediu 1 1e-163
>gi|315122391|ref|YP_004062880.1| dihydrolipoamide dehydrogenase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 467 Back     alignment and organism information
 Score =  762 bits (1968), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/467 (79%), Positives = 417/467 (89%), Gaps = 1/467 (0%)

Query: 1   MVYDVAVVGGGPAGYACAIKAAQLKNKVAIIEKEKTYGGTCLNIGCIPSKALLHASEMYS 60
           MVYD+ V+G GPAGY+CAIKAAQLKNKVAI+EKEKTYGGTCLNIGCIPSKALL+ SE+Y+
Sbjct: 1   MVYDLVVIGAGPAGYSCAIKAAQLKNKVAIVEKEKTYGGTCLNIGCIPSKALLYTSEVYN 60

Query: 61  HIAKEAGDLGINIASCHLDLKKMMSYKKSIVESNTQGINFLLKKNKIITYHGSARIVSNN 120
           HI+K  G LGI ++S  LDL+KMMSYK+S+V+SN QGI+FLLKKNKI  Y G A+++S N
Sbjct: 61  HISKGIGHLGIGVSSLQLDLEKMMSYKRSVVQSNVQGIDFLLKKNKITAYQGLAKVISAN 120

Query: 121 KILVKGSSSEETIEAKNIVIATGSEASGLPGMSIDFDEQVIVSSTGALSFSSVPKNLLVI 180
           KI +K  SSEE IEAKNIVIATGSE SG+PGMSIDFDEQ+IVSSTGALS SSVPKNLL+I
Sbjct: 121 KISIKNGSSEEIIEAKNIVIATGSETSGIPGMSIDFDEQIIVSSTGALSLSSVPKNLLII 180

Query: 181 GAGVIGLELGSVWTRLGSCVKIIEHSGTILNGMDKEIAAHCLKIMSKQGMNFQLNSKVSS 240
           GAGVIGLELGSVW RLGS VK+IE+S  ILNGMDKEIA   LKI+SKQGM+FQL+SKV S
Sbjct: 181 GAGVIGLELGSVWMRLGSRVKVIEYSNAILNGMDKEIAGQFLKIISKQGMDFQLSSKVLS 240

Query: 241 VKKVKGKAQVVYRS-TDDEPINIEADAVLVAAGRRPYTKGLGLEEIGINIDHRGCIEIGG 299
           V  +  KAQV+ +S  DD+ I++E+D VL+AAGR+PYT+GLGLEEIGI ID RGC+EIG 
Sbjct: 241 VTNINQKAQVICQSIVDDKSIDLESDVVLIAAGRKPYTEGLGLEEIGIGIDQRGCVEIGK 300

Query: 300 QFQTSISTIYAIGDVVRGPMLAHKAEDEGIAVAEIISGQKGHVNYGIIPSVVYTHPEVAS 359
            FQTS+  IYAIGDVVRGPMLAHK+EDEGIAVAEIISGQKGHVNY IIPSVVYTHPE+AS
Sbjct: 301 DFQTSVPGIYAIGDVVRGPMLAHKSEDEGIAVAEIISGQKGHVNYAIIPSVVYTHPEIAS 360

Query: 360 IGKTEEQLKCEKKSYKVGKFPFSANGRARSMNSIDGFVKILANEKSDRVEGVHIIGGSAG 419
           +GKTEEQLK E  SYKVGKFPFSANGRARSMNSIDGFVKILA++KSDRVEGVHIIG  AG
Sbjct: 361 VGKTEEQLKSEGHSYKVGKFPFSANGRARSMNSIDGFVKILADQKSDRVEGVHIIGVGAG 420

Query: 420 EMIHEAAVLMEFGGSSEDLARICHAHPTMSEAVREAALSCFDQPIHM 466
           EMIHEAAVLMEFGGSSEDLARICHAHPTMSEAVREAAL+CFD+PIH+
Sbjct: 421 EMIHEAAVLMEFGGSSEDLARICHAHPTMSEAVREAALACFDRPIHL 467


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325294001|ref|YP_004279865.1| dihydrolipoamide dehydrogenase [Agrobacterium sp. H13-3] Length = 468 Back     alignment and organism information
>gi|222150034|ref|YP_002550991.1| dihydrolipoamide dehydrogenase [Agrobacterium vitis S4] Length = 468 Back     alignment and organism information
>gi|15889887|ref|NP_355568.1| dihydrolipoamide dehydrogenase [Agrobacterium tumefaciens str. C58] Length = 468 Back     alignment and organism information
>gi|163761402|ref|ZP_02168476.1| dihydrolipoamide dehydrogenase [Hoeflea phototrophica DFL-43] Length = 468 Back     alignment and organism information
>gi|150398133|ref|YP_001328600.1| dihydrolipoamide dehydrogenase [Sinorhizobium medicae WSM419] Length = 468 Back     alignment and organism information
>gi|307301629|ref|ZP_07581388.1| dihydrolipoamide dehydrogenase [Sinorhizobium meliloti BL225C] Length = 468 Back     alignment and organism information
>gi|86359463|ref|YP_471355.1| dihydrolipoamide dehydrogenase [Rhizobium etli CFN 42] Length = 468 Back     alignment and organism information
>gi|15966801|ref|NP_387154.1| dihydrolipoamide dehydrogenase [Sinorhizobium meliloti 1021] Length = 468 Back     alignment and organism information
>gi|239833046|ref|ZP_04681375.1| dihydrolipoamide dehydrogenase [Ochrobactrum intermedium LMG 3301] Length = 467 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target466 dihydrolipoamide dehydrogenase [Candidatus Liberibacter
PRK06327475 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Val 1e-167
TIGR01350461 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase 1e-159
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Val 1e-157
PRK06416462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Rev 1e-145
PRK06115466 PRK06115, PRK06115, dihydrolipoamide dehydrogenase; Rev 1e-144
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase com 1e-141
PRK06467471 PRK06467, PRK06467, dihydrolipoamide dehydrogenase; Rev 1e-139
PRK05976472 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Val 1e-128
PRK06912458 PRK06912, acoL, dihydrolipoamide dehydrogenase; Validat 1e-100
PRK07818466 PRK07818, PRK07818, dihydrolipoamide dehydrogenase; Rev 1e-92
PRK06370463 PRK06370, PRK06370, mercuric reductase; Validated 1e-88
TIGR02053463 TIGR02053, MerA, mercuric reductase 8e-84
PRK05249461 PRK05249, PRK05249, soluble pyridine nucleotide transhy 7e-82
PRK06116450 PRK06116, PRK06116, glutathione reductase; Validated 4e-67
PRK07251438 PRK07251, PRK07251, pyridine nucleotide-disulfide oxido 2e-64
PTZ00153659 PTZ00153, PTZ00153, lipoamide dehydrogenase; Provisiona 1e-59
KOG0405478 KOG0405, KOG0405, KOG0405, Pyridine nucleotide-disulphi 6e-58
TIGR01424446 TIGR01424, gluta_reduc_2, glutathione-disulfide reducta 1e-57
TIGR01421450 TIGR01421, gluta_reduc_1, glutathione-disulfide reducta 1e-53
PRK08010441 PRK08010, PRK08010, pyridine nucleotide-disulfide oxido 1e-52
PRK14694468 PRK14694, PRK14694, putative mercuric reductase; Provis 3e-52
PRK13748561 PRK13748, PRK13748, putative mercuric reductase; Provis 1e-50
PRK14727479 PRK14727, PRK14727, putative mercuric reductase; Provis 1e-49
KOG4716503 KOG4716, KOG4716, KOG4716, Thioredoxin reductase [Postt 9e-49
PRK07846451 PRK07846, PRK07846, mycothione reductase; Reviewed 2e-48
TIGR01438484 TIGR01438, TGR, thioredoxin and glutathione reductase s 1e-46
PLN02507499 PLN02507, PLN02507, glutathione reductase 2e-44
PRK07845466 PRK07845, PRK07845, flavoprotein disulfide reductase; R 2e-44
PTZ00058561 PTZ00058, PTZ00058, glutathione reductase; Provisional 2e-42
TIGR03452452 TIGR03452, mycothione_red, mycothione reductase 7e-42
PTZ00052499 PTZ00052, PTZ00052, thioredoxin reductase; Provisional 2e-41
TIGR01423486 TIGR01423, trypano_reduc, trypanothione-disulfide reduc 1e-40
PLN02546558 PLN02546, PLN02546, glutathione reductase 1e-38
KOG1335506 KOG1335, KOG1335, KOG1335, Dihydrolipoamide dehydrogena 1e-143
pfam07992277 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide 4e-54
COG0492305 COG0492, TrxB, Thioredoxin reductase [Posttranslational 2e-18
COG0446415 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehyd 4e-14
COG1252405 COG1252, Ndh, NADH dehydrogenase, FAD-containing subuni 4e-12
TIGR01292300 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase 1e-10
TIGR03143 555 TIGR03143, AhpF_homolog, putative alkyl hydroperoxide r 8e-08
TIGR01318467 TIGR01318, gltD_gamma_fam, glutamate synthase small sub 8e-08
TIGR01316449 TIGR01316, gltA, glutamate synthase (NADPH), homotetram 7e-07
COG3634520 COG3634, AhpF, Alkyl hydroperoxide reductase, large sub 2e-04
TIGR03140515 TIGR03140, AhpF, alkyl hydroperoxide reductase, F subun 2e-04
PRK12809639 PRK12809, PRK12809, putative oxidoreductase Fe-S bindin 6e-04
KOG0404322 KOG0404, KOG0404, KOG0404, Thioredoxin reductase [Postt 0.003
pfam02852110 pfam02852, Pyr_redox_dim, Pyridine nucleotide-disulphid 2e-37
TIGR03385427 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase 2e-18
PRK09564444 PRK09564, PRK09564, coenzyme A disulfide reductase; Rev 2e-14
PRK04965377 PRK04965, PRK04965, NADH:flavorubredoxin oxidoreductase 4e-15
PRK09754396 PRK09754, PRK09754, phenylpropionate dioxygenase ferred 9e-07
PRK14989 847 PRK14989, PRK14989, nitrite reductase subunit NirD; Pro 8e-04
PRK13984604 PRK13984, PRK13984, putative oxidoreductase; Provisiona 0.001
TIGR03169364 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide 0.002
PRK13512438 PRK13512, PRK13512, coenzyme A disulfide reductase; Pro 2e-13
COG1251 793 COG1251, NirB, NAD(P)H-nitrite reductase [Energy produc 5e-11
pfam0007082 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide ox 3e-13
KOG1336478 KOG1336, KOG1336, KOG1336, Monodehydroascorbate/ferredo 4e-12
TIGR02374 785 TIGR02374, nitri_red_nirB, nitrite reductase [NAD(P)H], 1e-08
PTZ00318424 PTZ00318, PTZ00318, NADH dehydrogenase-like protein; Pr 0.003
PRK098531019 PRK09853, PRK09853, putative selenate reductase subunit 3e-08
PRK12810471 PRK12810, gltD, glutamate synthase subunit beta; Review 4e-08
PRK12770352 PRK12770, PRK12770, putative glutamate synthase subunit 4e-07
COG0493457 COG0493, GltD, NADPH-dependent glutamate synthase beta 2e-06
TIGR033151012 TIGR03315, Se_ygfK, putative selenate reductase, YgfK s 8e-05
PRK11749457 PRK11749, PRK11749, dihydropyrimidine dehydrogenase sub 1e-04
PRK12769654 PRK12769, PRK12769, putative oxidoreductase Fe-S bindin 7e-04
PRK12778752 PRK12778, PRK12778, putative bifunctional 2-polyprenylp 0.002
TIGR01317485 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH/NADP 0.003
pfam01134391 pfam01134, GIDA, Glucose inhibited division protein A 6e-08
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy p 6e-07
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase 9e-06
TIGR00275400 TIGR00275, TIGR00275, flavoprotein, HI0933 family 9e-05
COG2072443 COG2072, TrkA, Predicted flavoprotein involved in K+ tr 1e-06
KOG1399448 KOG1399, KOG1399, KOG1399, Flavin-containing monooxygen 0.001
pfam00890401 pfam00890, FAD_binding_2, FAD binding domain 2e-06
pfam03486405 pfam03486, HI0933_like, HI0933-like protein 2e-06
COG2081408 COG2081, COG2081, Predicted flavoproteins [General func 4e-06
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and related pr 7e-06
PRK05329422 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehy 2e-05
PRK06134 581 PRK06134, PRK06134, putative FAD-binding dehydrogenase; 5e-05
KOG2415621 KOG2415, KOG2415, KOG2415, Electron transfer flavoprote 7e-05
PRK12842 574 PRK12842, PRK12842, putative succinate dehydrogenase; R 1e-04
TIGR03378419 TIGR03378, glycerol3P_GlpB, glycerol-3-phosphate dehydr 2e-04
PRK04176257 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase 2e-04
PRK07843557 PRK07843, PRK07843, 3-ketosteroid-delta-1-dehydrogenase 4e-04
COG1053562 COG1053, SdhA, Succinate dehydrogenase/fumarate reducta 6e-04
PRK09126392 PRK09126, PRK09126, hypothetical protein; Provisional 6e-04
COG3075421 COG3075, GlpB, Anaerobic glycerol-3-phosphate dehydroge 7e-04
TIGR01988385 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxyl 8e-04
PRK12839572 PRK12839, PRK12839, hypothetical protein; Provisional 0.001
TIGR00031377 TIGR00031, UDP-GALP_mutase, UDP-galactopyranose mutase 0.001
COG1635262 COG1635, THI4, Flavoprotein involved in thiazole biosyn 0.002
PRK12771564 PRK12771, PRK12771, putative glutamate synthase (NADPH) 0.002
PRK08849384 PRK08849, PRK08849, 2-octaprenyl-3-methyl-6-methoxy-1,4 0.002
PRK12843578 PRK12843, PRK12843, putative FAD-binding dehydrogenase; 0.002
TIGR02023388 TIGR02023, BchP-ChlP, geranylgeranyl reductase 0.003
PRK15317517 PRK15317, PRK15317, alkyl hydroperoxide reductase subun 0.003
PRK08020391 PRK08020, ubiF, 2-octaprenyl-3-methyl-6-methoxy-1,4-ben 0.003
TIGR01790388 TIGR01790, carotene-cycl, lycopene cyclase family prote 0.003
PRK11749457 PRK11749, PRK11749, dihydropyrimidine dehydrogenase sub 0.004
TIGR02032295 TIGR02032, GG-red-SF, geranylgeranyl reductase family 0.004
KOG0029501 KOG0029, KOG0029, KOG0029, Amine oxidase [Secondary met 6e-04
TIGR033151012 TIGR03315, Se_ygfK, putative selenate reductase, YgfK s 8e-04
>gnl|CDD|180529 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|162312 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase Back     alignment and domain information
>gnl|CDD|180516 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180558 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180409 PRK06115, PRK06115, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|31441 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|180579 PRK06467, PRK06467, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180333 PRK05976, PRK05976, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180743 PRK06912, acoL, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181132 PRK07818, PRK07818, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180546 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|162675 TIGR02053, MerA, mercuric reductase Back     alignment and domain information
>gnl|CDD|179973 PRK05249, PRK05249, soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180410 PRK06116, PRK06116, glutathione reductase; Validated Back     alignment and domain information
>gnl|CDD|180907 PRK07251, PRK07251, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|173442 PTZ00153, PTZ00153, lipoamide dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|35626 KOG0405, KOG0405, KOG0405, Pyridine nucleotide-disulphide oxidoreductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|162352 TIGR01424, gluta_reduc_2, glutathione-disulfide reductase, plant Back     alignment and domain information
>gnl|CDD|130488 TIGR01421, gluta_reduc_1, glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>gnl|CDD|181196 PRK08010, PRK08010, pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|173157 PRK14694, PRK14694, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|184298 PRK13748, PRK13748, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|173190 PRK14727, PRK14727, putative mercuric reductase; Provisional Back     alignment and domain information
>gnl|CDD|39914 KOG4716, KOG4716, KOG4716, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|181142 PRK07846, PRK07846, mycothione reductase; Reviewed Back     alignment and domain information
>gnl|CDD|162359 TIGR01438, TGR, thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>gnl|CDD|178123 PLN02507, PLN02507, glutathione reductase Back     alignment and domain information
>gnl|CDD|181141 PRK07845, PRK07845, flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|185420 PTZ00058, PTZ00058, glutathione reductase; Provisional Back     alignment and domain information
>gnl|CDD|132493 TIGR03452, mycothione_red, mycothione reductase Back     alignment and domain information
>gnl|CDD|185416 PTZ00052, PTZ00052, thioredoxin reductase; Provisional Back     alignment and domain information
>gnl|CDD|130490 TIGR01423, trypano_reduc, trypanothione-disulfide reductase Back     alignment and domain information
>gnl|CDD|178161 PLN02546, PLN02546, glutathione reductase Back     alignment and domain information
>gnl|CDD|36549 KOG1335, KOG1335, KOG1335, Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|149204 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|30838 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|30795 COG0446, HcaD, Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|31444 COG1252, Ndh, NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162288 TIGR01292, TRX_reduct, thioredoxin-disulfide reductase Back     alignment and domain information
>gnl|CDD|132187 TIGR03143, AhpF_homolog, putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>gnl|CDD|130385 TIGR01318, gltD_gamma_fam, glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>gnl|CDD|130383 TIGR01316, gltA, glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>gnl|CDD|33432 COG3634, AhpF, Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|163151 TIGR03140, AhpF, alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>gnl|CDD|183762 PRK12809, PRK12809, putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>gnl|CDD|35625 KOG0404, KOG0404, KOG0404, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|145812 pfam02852, Pyr_redox_dim, Pyridine nucleotide-disulphide oxidoreductase, dimerization domain Back     alignment and domain information
>gnl|CDD|163244 TIGR03385, CoA_CoA_reduc, CoA-disulfide reductase Back     alignment and domain information
>gnl|CDD|181958 PRK09564, PRK09564, coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>gnl|CDD|179902 PRK04965, PRK04965, NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|170080 PRK09754, PRK09754, phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>gnl|CDD|184951 PRK14989, PRK14989, nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>gnl|CDD|172486 PRK13984, PRK13984, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|163170 TIGR03169, Nterm_to_SelD, pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>gnl|CDD|184103 PRK13512, PRK13512, coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>gnl|CDD|31443 COG1251, NirB, NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|143852 pfam00070, Pyr_redox, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|36550 KOG1336, KOG1336, KOG1336, Monodehydroascorbate/ferredoxin reductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|162827 TIGR02374, nitri_red_nirB, nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>gnl|CDD|185553 PTZ00318, PTZ00318, NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|182113 PRK09853, PRK09853, putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>gnl|CDD|183763 PRK12810, gltD, glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>gnl|CDD|183734 PRK12770, PRK12770, putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|30839 COG0493, GltD, NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|132358 TIGR03315, Se_ygfK, putative selenate reductase, YgfK subunit Back     alignment and domain information
>gnl|CDD|183296 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|183733 PRK12769, PRK12769, putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>gnl|CDD|183739 PRK12778, PRK12778, putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|162300 TIGR01317, GOGAT_sm_gam, glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>gnl|CDD|144651 pfam01134, GIDA, Glucose inhibited division protein A Back     alignment and domain information
>gnl|CDD|30989 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|30999 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|161797 TIGR00275, TIGR00275, flavoprotein, HI0933 family Back     alignment and domain information
>gnl|CDD|32255 COG2072, TrkA, Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|36613 KOG1399, KOG1399, KOG1399, Flavin-containing monooxygenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|144475 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|146239 pfam03486, HI0933_like, HI0933-like protein Back     alignment and domain information
>gnl|CDD|32264 COG2081, COG2081, Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|31426 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|180019 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>gnl|CDD|180419 PRK06134, PRK06134, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|37626 KOG2415, KOG2415, KOG2415, Electron transfer flavoprotein ubiquinone oxidoreductase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|183785 PRK12842, PRK12842, putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|132421 TIGR03378, glycerol3P_GlpB, glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>gnl|CDD|179767 PRK04176, PRK04176, ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|181140 PRK07843, PRK07843, 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|31253 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|181663 PRK09126, PRK09126, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|32889 COG3075, GlpB, Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|162642 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>gnl|CDD|171762 PRK12839, PRK12839, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|161671 TIGR00031, UDP-GALP_mutase, UDP-galactopyranose mutase Back     alignment and domain information
>gnl|CDD|31822 COG1635, THI4, Flavoprotein involved in thiazole biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|183735 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>gnl|CDD|181564 PRK08849, PRK08849, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|183786 PRK12843, PRK12843, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|162664 TIGR02023, BchP-ChlP, geranylgeranyl reductase Back     alignment and domain information
>gnl|CDD|185217 PRK15317, PRK15317, alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|181199 PRK08020, ubiF, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>gnl|CDD|130850 TIGR01790, carotene-cycl, lycopene cyclase family protein Back     alignment and domain information
>gnl|CDD|183296 PRK11749, PRK11749, dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|162668 TIGR02032, GG-red-SF, geranylgeranyl reductase family Back     alignment and domain information
>gnl|CDD|35252 KOG0029, KOG0029, KOG0029, Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>gnl|CDD|132358 TIGR03315, Se_ygfK, putative selenate reductase, YgfK subunit Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 466 dihydrolipoamide dehydrogenase [Candidatus Liberibacter
TIGR01350481 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: 100.0
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 100.0
PRK13748561 putative mercuric reductase; Provisional 100.0
PRK06467472 dihydrolipoamide dehydrogenase; Reviewed 100.0
TIGR02053494 MerA mercuric reductase; InterPro: IPR011796 This entry 100.0
PRK06327475 dihydrolipoamide dehydrogenase; Validated 100.0
PRK07818467 dihydrolipoamide dehydrogenase; Reviewed 100.0
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihy 100.0
PRK05976464 dihydrolipoamide dehydrogenase; Validated 100.0
PRK05249465 soluble pyridine nucleotide transhydrogenase; Provision 100.0
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 100.0
PRK06292460 dihydrolipoamide dehydrogenase; Validated 100.0
PRK07845467 flavoprotein disulfide reductase; Reviewed 100.0
PRK06370459 mercuric reductase; Validated 100.0
PTZ00153673 lipoamide dehydrogenase; Provisional 100.0
PRK07846453 mycothione/glutathione reductase; Reviewed 100.0
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Provision 100.0
PRK06116450 glutathione reductase; Validated 100.0
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a gluta 100.0
PTZ00052541 thioredoxin reductase; Provisional 100.0
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Provision 100.0
KOG1335506 consensus 100.0
TIGR01424478 gluta_reduc_2 glutathione-disulfide reductase; InterPro 100.0
TIGR01421475 gluta_reduc_1 glutathione-disulfide reductase; InterPro 100.0
TIGR01438513 TGR thioredoxin and glutathione reductase; InterPro: IP 100.0
KOG0405478 consensus 100.0
KOG4716503 consensus 100.0
PRK09564443 coenzyme A disulfide reductase; Reviewed 100.0
PRK13512438 coenzyme A disulfide reductase; Provisional 100.0
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 100.0
TIGR01423486 trypano_reduc trypanothione-disulfide reductase; InterP 100.0
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases 99.96
PRK04965378 nitric oxide reductase; Provisional 100.0
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 100.0
TIGR02374 813 nitri_red_nirB nitrite reductase [NAD(P)H], large subun 100.0
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production and c 99.97
KOG1336478 consensus 99.96
KOG1346659 consensus 99.87
TIGR02733499 desat_CrtD C-3',4' desaturase CrtD; InterPro: IPR014104 98.22
TIGR01292321 TRX_reduct thioredoxin-disulfide reductase; InterPro: I 100.0
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductase F s 100.0
PRK12770350 putative glutamate synthase subunit beta; Provisional 100.0
pfam07992277 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreducta 100.0
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. This enz 100.0
PRK10262321 thioredoxin reductase; Provisional 100.0
COG0492305 TrxB Thioredoxin reductase [Posttranslational modificat 100.0
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [Energy 100.0
PRK11749460 putative oxidoreductase; Provisional 100.0
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreduct 100.0
TIGR01316462 gltA glutamate synthase (NADPH), homotetrameric; InterP 99.98
PRK12831464 putative oxidoreductase; Provisional 99.98
PRK098531032 putative selenate reductase subunit YgfK; Provisional 99.98
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 99.97
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 99.97
PRK12814652 putative NADPH-dependent glutamate synthase small subun 99.97
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 99.97
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 99.97
PRK12778760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 99.97
TIGR01317517 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small sub 99.97
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 99.96
PRK13984604 putative oxidoreductase; Provisional 99.96
PRK12779 944 putative bifunctional glutamate synthase subunit beta/2 99.95
PRK12775 993 putative trifunctional 2-polyprenylphenol hydroxylase/g 99.95
TIGR01318480 gltD_gamma_fam glutamate synthase, small subunit; Inter 99.94
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit [Post 99.93
KOG2495491 consensus 99.91
KOG0404322 consensus 99.89
COG0493457 GltD NADPH-dependent glutamate synthase beta chain and 99.86
KOG03992142 consensus 99.86
TIGR01372 1026 soxA sarcosine oxidase, alpha subunit family; InterPro: 99.73
pfam00743532 FMO-like Flavin-binding monooxygenase-like. This family 99.73
KOG2755334 consensus 99.72
COG1148622 HdrA Heterodisulfide reductase, subunit A and related p 99.64
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary metabo 99.47
KOG1399448 consensus 99.45
KOG3851446 consensus 99.33
PTZ00188506 adrenodoxin reductase; Provisional 99.2
KOG1800468 consensus 99.18
KOG2665453 consensus 96.59
PTZ00318514 NADH dehydrogenase; Provisional 99.96
pfam02852110 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreduc 99.95
COG2072443 TrkA Predicted flavoprotein involved in K+ transport [I 99.62
COG4529474 Uncharacterized protein conserved in bacteria [Function 99.11
PRK09897535 hypothetical protein; Provisional 98.26
TIGR01350481 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: 97.9
PRK05329425 anaerobic glycerol-3-phosphate dehydrogenase subunit B; 99.47
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, ana 99.36
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amin 98.76
pfam04820457 Trp_halogenase Tryptophan halogenase. Tryptophan haloge 96.68
TIGR01810540 betA choline dehydrogenase; InterPro: IPR011533 Choline 94.16
TIGR01320487 mal_quin_oxido malate:quinone-oxidoreductase; InterPro: 93.51
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.44
PRK08071510 L-aspartate oxidase; Provisional 99.37
PRK08275554 putative oxidoreductase; Provisional 99.36
PRK07804533 L-aspartate oxidase; Provisional 99.36
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.35
PRK08401464 L-aspartate oxidase; Provisional 99.33
PRK06263539 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.33
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.32
PRK09077535 L-aspartate oxidase; Provisional 99.31
PRK07395556 L-aspartate oxidase; Provisional 99.31
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.3
PRK06175433 L-aspartate oxidase; Provisional 99.3
PRK06069 582 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.3
PRK07803 631 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.28
PRK12844552 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.28
PTZ00139 622 succinate dehydrogenase (flavoprotein) subunit; Provisi 99.28
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.27
PRK07512507 L-aspartate oxidase; Provisional 99.27
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 99.26
PRK08626 657 fumarate reductase flavoprotein subunit; Provisional 99.25
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.24
PRK06134 579 putative FAD-binding dehydrogenase; Reviewed 99.22
PRK13800 894 putative oxidoreductase/HEAT repeat-containing protein; 99.21
PRK12842567 putative succinate dehydrogenase; Reviewed 99.2
PRK12843576 putative FAD-binding dehydrogenase; Reviewed 99.19
PRK11259377 solA N-methyltryptophan oxidase; Provisional 99.16
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; Revi 99.15
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy production 99.1
PRK06854 610 adenylylsulfate reductase; Validated 99.1
PRK06481506 fumarate reductase flavoprotein subunit; Validated 99.1
PRK07843560 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.08
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.03
TIGR01813487 flavo_cyto_c flavocytochrome c; InterPro: IPR010960 Thi 98.99
PRK07121491 hypothetical protein; Validated 98.98
PRK12845566 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.98
PRK12837515 3-ketosteroid-delta-1-dehydrogenase; Provisional 98.95
TIGR00551546 nadB L-aspartate oxidase; InterPro: IPR005288 L-asparta 98.86
pfam00890401 FAD_binding_2 FAD binding domain. This family includes 98.85
PRK11445348 putative oxidoreductase; Provisional 98.84
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 98.81
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR03364. T 98.8
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreductase. T 98.79
PRK06183554 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validat 98.76
PRK08274456 tricarballylate dehydrogenase; Validated 98.76
PRK12839 574 hypothetical protein; Provisional 98.72
PRK10157428 putative oxidoreductase FixC; Provisional 98.71
PRK08774402 consensus 98.69
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 98.67
PRK07608389 hypothetical protein; Provisional 98.65
PRK07494386 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 98.64
PRK06185409 hypothetical protein; Provisional 98.63
PRK06126545 hypothetical protein; Provisional 98.6
PRK08163396 salicylate hydroxylase; Provisional 98.57
PRK08132549 hypothetical protein; Provisional 98.56
TIGR02032343 GG-red-SF geranylgeranyl reductase family; InterPro: IP 98.56
TIGR00031390 UDP-GALP_mutase UDP-galactopyranose mutase; InterPro: I 98.52
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.52
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 98.51
PRK07208474 hypothetical protein; Provisional 98.51
PRK08013400 hypothetical protein; Provisional 98.47
pfam01946229 Thi4 Thi4 family. This family includes a putative thiam 98.47
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 98.37
TIGR03467430 HpnE squalene-associated FAD-dependent desaturase. The 98.37
KOG0029501 consensus 98.37
TIGR02023408 BchP-ChlP geranylgeranyl reductase; InterPro: IPR010253 98.31
TIGR00292283 TIGR00292 thiazole biosynthesis enzyme; InterPro: IPR00 98.3
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validated 98.28
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRP 98.26
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy product 98.26
PRK07573 638 sdhA succinate dehydrogenase flavoprotein subunit; Revi 98.22
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 98.22
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biogenesi 98.22
TIGR02485467 CobZ_N-term precorrin 3B synthase CobZ; InterPro: IPR01 98.2
PRK11101545 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; P 98.2
PRK12266503 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.17
PRK13369503 glycerol-3-phosphate dehydrogenase; Provisional 98.15
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, flavop 98.15
TIGR02734526 crtI_fam phytoene desaturase; InterPro: IPR014105 Phyto 98.14
PRK11883452 protoporphyrinogen oxidase; Reviewed 98.12
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [Amino 98.12
KOG2415621 consensus 98.09
PRK04965378 nitric oxide reductase; Provisional 98.09
PRK08294 634 phenol 2-monooxygenase; Provisional 98.07
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.06
COG3349485 Uncharacterized conserved protein [Function unknown] 98.05
PRK06475400 salicylate hydroxylase; Provisional 98.05
PRK05335434 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 98.03
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; Revi 98.02
PRK06370459 mercuric reductase; Validated 98.01
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 98.01
PRK12416466 protoporphyrinogen oxidase; Provisional 97.98
PRK06847375 hypothetical protein; Provisional 97.97
PRK06753373 hypothetical protein; Provisional 97.97
PRK13512438 coenzyme A disulfide reductase; Provisional 97.95
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihy 97.95
KOG2311 679 consensus 97.95
pfam00743532 FMO-like Flavin-binding monooxygenase-like. This family 97.94
PRK05976464 dihydrolipoamide dehydrogenase; Validated 97.93
PRK07818467 dihydrolipoamide dehydrogenase; Reviewed 97.93
PRK02106555 choline dehydrogenase; Validated 97.93
PRK07190480 hypothetical protein; Provisional 97.91
TIGR01816 615 sdhA_forward succinate dehydrogenase, flavoprotein subu 97.91
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Provision 97.9
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases 97.9
KOG2820399 consensus 97.86
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] 97.86
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.85
PRK07538413 hypothetical protein; Provisional 97.83
PRK06116450 glutathione reductase; Validated 97.82
PRK05868372 hypothetical protein; Validated 97.79
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.78
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.78
PRK01747660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 97.77
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [General fun 97.77
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.77
COG1231450 Monoamine oxidase [Amino acid transport and metabolism] 97.76
KOG0042 680 consensus 97.74
PRK07045388 putative monooxygenase; Reviewed 97.74
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Members of 97.7
PRK07236386 hypothetical protein; Provisional 97.66
COG2303542 BetA Choline dehydrogenase and related flavoproteins [A 97.65
PRK07846453 mycothione/glutathione reductase; Reviewed 97.63
pfam05834374 Lycopene_cycl Lycopene cyclase protein. This family con 97.59
TIGR01812 636 sdhA_frdA_Gneg succinate dehydrogenase or fumarate redu 97.58
PRK06467472 dihydrolipoamide dehydrogenase; Reviewed 97.56
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a gluta 97.55
KOG4254561 consensus 97.53
KOG2404477 consensus 97.5
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and relat 97.49
PTZ00052541 thioredoxin reductase; Provisional 97.48
COG3573552 Predicted oxidoreductase [General function prediction o 97.48
KOG0685498 consensus 97.34
PTZ00318514 NADH dehydrogenase; Provisional 97.31
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductase F s 97.31
TIGR01989481 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6; InterP 97.21
pfam01266309 DAO FAD dependent oxidoreductase. This family includes 97.19
TIGR02730506 carot_isom carotene isomerase; InterPro: IPR014101 Memb 97.19
PRK08255 770 salicylyl-CoA 5-hydroxylase; Reviewed 97.14
TIGR01984425 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase; InterP 97.11
TIGR00137444 gid gid protein; InterPro: IPR004417 The gid proteins a 96.9
COG2907447 Predicted NAD/FAD-binding protein [General function pre 96.9
pfam0007082 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 96.89
KOG1298509 consensus 96.88
KOG2614420 consensus 96.83
KOG1276491 consensus 96.61
KOG1238 623 consensus 96.44
pfam00996439 GDI GDP dissociation inhibitor. 96.42
TIGR01789392 lycopene_cycl lycopene cyclase; InterPro: IPR008461 Thi 96.2
TIGR02731454 phytoene_desat phytoene desaturase; InterPro: IPR014102 96.18
KOG3855481 consensus 96.16
TIGR01176 585 fum_red_Fp fumarate reductase, flavoprotein subunit; In 96.07
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase; InterPro: IPR0 96.04
TIGR02061 651 aprA adenylylsulfate reductase, alpha subunit; InterPro 96.03
KOG2960328 consensus 95.94
KOG1335506 consensus 95.78
PRK12409410 D-amino acid dehydrogenase small subunit; Provisional 95.71
PRK09496455 trkA potassium transporter peripheral membrane componen 95.67
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 95.57
PRK07233430 hypothetical protein; Provisional 95.28
PRK00711416 D-amino acid dehydrogenase small subunit; Validated 95.27
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 95.14
PRK06522307 2-dehydropantoate 2-reductase; Reviewed 95.05
PRK12921306 2-dehydropantoate 2-reductase; Provisional 94.99
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 94.97
COG5044434 MRS6 RAB proteins geranylgeranyltransferase component A 94.95
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production and c 94.9
PRK07588391 hypothetical protein; Provisional 94.88
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in tran 94.85
KOG4405547 consensus 94.84
KOG1439440 consensus 94.45
pfam02558150 ApbA Ketopantoate reductase PanE/ApbA. This is a family 94.43
PRK08229341 2-dehydropantoate 2-reductase; Provisional 94.36
TIGR01438513 TGR thioredoxin and glutathione reductase; InterPro: IP 94.29
pfam01494349 FAD_binding_3 FAD binding domain. This domain is involv 94.05
COG0686371 Ald Alanine dehydrogenase [Amino acid transport and met 93.97
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 93.91
TIGR01811 620 sdhA_Bsu succinate dehydrogenase or fumarate reductase, 93.89
pfam06100500 Strep_67kDa_ant Streptococcal 67 kDa myosin-cross-react 93.82
KOG2844 856 consensus 93.8
TIGR00136 630 gidA glucose-inhibited division protein A; InterPro: IP 93.76
PRK08267258 short chain dehydrogenase; Provisional 93.65
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelop 93.35
PRK02472450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.29
PRK02006501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.27
PRK01438481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.26
PRK05708305 2-dehydropantoate 2-reductase; Provisional 93.19
COG1233487 Phytoene dehydrogenase and related proteins [Secondary 92.98
PRK00141476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.78
PRK07024256 short chain dehydrogenase; Provisional 92.77
COG1748389 LYS9 Saccharopine dehydrogenase and related proteins [A 92.61
PRK05650270 short chain dehydrogenase; Provisional 92.58
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 92.56
PRK06223312 malate dehydrogenase; Reviewed 92.37
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisio 92.12
PRK06249313 2-dehydropantoate 2-reductase; Provisional 92.01
PRK07660283 consensus 91.98
PRK07102243 short chain dehydrogenase; Provisional 91.76
TIGR02356210 adenyl_thiF thiazole biosynthesis adenylyltransferase T 91.68
pfam02254115 TrkA_N TrkA-N domain. This domain is found in a wide va 91.44
TIGR01369 1089 CPSaseII_lrg carbamoyl-phosphate synthase, large subuni 91.36
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate 91.35
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene tetr 91.34
PRK01390457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.33
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.31
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.23
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.15
PRK07109338 short chain dehydrogenase; Provisional 91.12
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 91.09
PRK09117282 consensus 90.99
pfam01210159 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd 90.99
PRK03369487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.97
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.93
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.91
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 90.88
PRK08251248 short chain dehydrogenase; Provisional 90.87
TIGR01763308 MalateDH_bact malate dehydrogenase, NAD-dependent; Inte 90.77
pfam0007082 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 99.42
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 98.23
PRK13984604 putative oxidoreductase; Provisional 98.18
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 98.12
TIGR01318480 gltD_gamma_fam glutamate synthase, small subunit; Inter 98.09
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 98.08
PRK11749460 putative oxidoreductase; Provisional 98.02
PRK12814 652 putative NADPH-dependent glutamate synthase small subun 97.99
pfam07992277 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreducta 97.98
pfam03486405 HI0933_like HI0933-like protein. 97.98
PRK12771 560 putative glutamate synthase (NADPH) small subunit; Prov 97.95
PRK12831464 putative oxidoreductase; Provisional 97.9
PRK12778760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 97.86
TIGR03315 1012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 97.85
PRK09853 1032 putative selenate reductase subunit YgfK; Provisional 97.82
COG0493457 GltD NADPH-dependent glutamate synthase beta chain and 97.81
PRK12770350 putative glutamate synthase subunit beta; Provisional 97.73
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreduct 97.67
TIGR01316462 gltA glutamate synthase (NADPH), homotetrameric; InterP 97.6
COG1252 405 Ndh NADH dehydrogenase, FAD-containing subunit [Energy 97.57
KOG03992142 consensus 97.56
PRK12775 993 putative trifunctional 2-polyprenylphenol hydroxylase/g 97.55
KOG1336 478 consensus 97.53
PRK10262321 thioredoxin reductase; Provisional 97.39
PRK12779 944 putative bifunctional glutamate synthase subunit beta/2 97.38
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. This enz 97.31
KOG1399 448 consensus 97.3
KOG2495 491 consensus 97.19
COG1148 622 HdrA Heterodisulfide reductase, subunit A and related p 96.72
COG0492305 TrxB Thioredoxin reductase [Posttranslational modificat 96.69
PRK09897 535 hypothetical protein; Provisional 96.47
PTZ00188 506 adrenodoxin reductase; Provisional 94.53
TIGR02734526 crtI_fam phytoene desaturase; InterPro: IPR014105 Phyto 92.15
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit [Post 91.52
COG2081408 Predicted flavoproteins [General function prediction on 91.11
COG2081408 Predicted flavoproteins [General function prediction on 99.31
pfam03486405 HI0933_like HI0933-like protein. 99.25
PRK10015429 hypothetical protein; Provisional 98.93
pfam01134391 GIDA Glucose inhibited division protein A. 98.91
PRK05192 621 tRNA uridine 5-carboxymethylaminomethyl modification en 98.85
PRK06184503 hypothetical protein; Provisional 98.77
PRK08244494 hypothetical protein; Provisional 98.69
TIGR01790419 carotene-cycl lycopene cyclase family protein; InterPro 98.6
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethylamino 98.48
PRK06834488 hypothetical protein; Provisional 98.27
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 98.2
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 98.15
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.0
PRK09564443 coenzyme A disulfide reductase; Reviewed 97.97
PRK05249465 soluble pyridine nucleotide transhydrogenase; Provision 97.9
TIGR02053494 MerA mercuric reductase; InterPro: IPR011796 This entry 97.88
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Provision 97.85
PRK07845467 flavoprotein disulfide reductase; Reviewed 97.72
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 97.61
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.56
PRK09126392 hypothetical protein; Provisional 97.55
PRK07364413 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 97.54
TIGR02374 813 nitri_red_nirB nitrite reductase [NAD(P)H], large subun 97.3
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 97.21
PRK06996397 hypothetical protein; Provisional 97.08
PRK08948392 consensus 97.04
TIGR02360393 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase; Inter 96.66
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 92.74
PRK11728400 hypothetical protein; Provisional 99.14
TIGR02352357 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727 98.33
TIGR01317517 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small sub 99.07
PRK12409410 D-amino acid dehydrogenase small subunit; Provisional 99.04
PRK00711416 D-amino acid dehydrogenase small subunit; Validated 98.86
pfam01266309 DAO FAD dependent oxidoreductase. This family includes 98.74
COG1233487 Phytoene dehydrogenase and related proteins [Secondary 98.69
PRK07364413 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 98.69
pfam01494349 FAD_binding_3 FAD binding domain. This domain is involv 98.57
PRK09126392 hypothetical protein; Provisional 98.52
PRK07588391 hypothetical protein; Provisional 98.5
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 98.48
PRK07233430 hypothetical protein; Provisional 98.39
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 98.28
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 98.25
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and relat 98.24
PRK07045388 putative monooxygenase; Reviewed 98.19
PRK08948392 consensus 98.17
PRK06847375 hypothetical protein; Provisional 98.15
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.15
COG2509486 Uncharacterized FAD-dependent dehydrogenases [General f 98.09
PRK05868372 hypothetical protein; Validated 97.83
PRK06996397 hypothetical protein; Provisional 97.8
PRK06475400 salicylate hydroxylase; Provisional 97.7
PRK06753373 hypothetical protein; Provisional 97.52
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 97.51
TIGR01377401 soxA_mon sarcosine oxidase, monomeric form; InterPro: I 97.45
PRK07236386 hypothetical protein; Provisional 97.39
PRK07538413 hypothetical protein; Provisional 97.24
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 97.23
PRK07494386 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 97.15
PRK08774402 consensus 97.15
PRK13977577 myosin-cross-reactive antigen; Provisional 96.97
PRK08013400 hypothetical protein; Provisional 96.91
PRK07608389 hypothetical protein; Provisional 96.84
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Members of 96.74
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validated 96.63
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 96.47
PRK10157428 putative oxidoreductase FixC; Provisional 96.4
pfam01593444 Amino_oxidase Flavin containing amine oxidoreductase. T 96.14
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [General fun 95.93
PRK10015429 hypothetical protein; Provisional 95.73
PRK07208474 hypothetical protein; Provisional 95.68
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 95.5
KOG0029501 consensus 95.5
TIGR01790419 carotene-cycl lycopene cyclase family protein; InterPro 95.49
PRK11883452 protoporphyrinogen oxidase; Reviewed 95.47
TIGR02023408 BchP-ChlP geranylgeranyl reductase; InterPro: IPR010253 95.46
PRK06185409 hypothetical protein; Provisional 95.21
PRK11445348 putative oxidoreductase; Provisional 95.12
TIGR01424 478 gluta_reduc_2 glutathione-disulfide reductase; InterPro 95.12
PRK08163396 salicylate hydroxylase; Provisional 94.84
KOG1298 509 consensus 94.48
TIGR03467430 HpnE squalene-associated FAD-dependent desaturase. The 94.44
PRK06184 503 hypothetical protein; Provisional 94.37
PRK13369503 glycerol-3-phosphate dehydrogenase; Provisional 94.28
PRK12416466 protoporphyrinogen oxidase; Provisional 94.2
PRK12839 574 hypothetical protein; Provisional 94.11
TIGR02360393 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase; Inter 94.05
PRK11259377 solA N-methyltryptophan oxidase; Provisional 93.38
TIGR00031390 UDP-GALP_mutase UDP-galactopyranose mutase; InterPro: I 92.86
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR03364. T 92.6
KOG0405 478 consensus 91.85
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] 91.65
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [Amino 91.5
COG0579429 Predicted dehydrogenase [General function prediction on 98.79
pfam06039489 Mqo Malate:quinone oxidoreductase (Mqo). This family co 98.24
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.2
PRK05257499 malate:quinone oxidoreductase; Validated 97.63
PRK06567 1048 putative bifunctional glutamate synthase subunit beta/2 98.0
PRK13748 561 putative mercuric reductase; Provisional 97.87
PRK01747 660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 97.22
COG2072 443 TrkA Predicted flavoprotein involved in K+ transport [I 96.67
TIGR00692341 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627 L- 94.69
pfam01946229 Thi4 Thi4 family. This family includes a putative thiam 94.63
PRK09424510 pntA NAD(P) transhydrogenase subunit alpha; Provisional 94.44
PRK06522307 2-dehydropantoate 2-reductase; Reviewed 94.38
COG0686371 Ald Alanine dehydrogenase [Amino acid transport and met 94.36
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRP 94.09
PRK08229341 2-dehydropantoate 2-reductase; Provisional 93.59
PRK12921306 2-dehydropantoate 2-reductase; Provisional 92.74
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 92.69
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA deh 92.12
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 91.57
PRK06249313 2-dehydropantoate 2-reductase; Provisional 91.35
pfam02558150 ApbA Ketopantoate reductase PanE/ApbA. This is a family 91.24
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 91.16
PRK09880343 L-idonate 5-dehydrogenase; Provisional 90.93
TIGR00292283 TIGR00292 thiazole biosynthesis enzyme; InterPro: IPR00 90.73
PRK08244494 hypothetical protein; Provisional 97.79
PRK06834488 hypothetical protein; Provisional 97.78
TIGR01988445 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/Ub 97.65
TIGR01984425 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase; InterP 93.92
TIGR01373407 soxB sarcosine oxidase, beta subunit family; InterPro: 97.4
KOG2853509 consensus 96.65
PRK07190480 hypothetical protein; Provisional 97.39
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 96.81
PRK06126545 hypothetical protein; Provisional 94.13
PRK08132549 hypothetical protein; Provisional